PSIBLAST alignment of GI: 254781196 and protein with PDB id: 1ta8

>gi|56966057|pdb|1TA8|A Chain A, Structural Rearrangement Accompanying Nad+ Synthesis Within A Bacterial Dna Ligase Crystal Length = 332
 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 20/65 (30%), Positives = 30/65 (46%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           L+   A    + L K    +   YY  D P   D +YDR+ + L  ++ +FP+L   D P
Sbjct: 6   LTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSP 65

Query: 114 WNTVG 118
              VG
Sbjct: 66  TQRVG 70