PSIBLAST alignment of GI: 254781196 and protein with PDB id: 1v9p

>gi|47169437|pdb|1V9P|A Chain A, Crystal Structure Of Nad+-Dependent Dna Ligase Length = 584
>gi|47169438|pdb|1V9P|B Chain B, Crystal Structure Of Nad+-Dependent Dna Ligase Length = 584
 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 33/65 (50%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           +++ EA   +  L  +  +H   YY L +P  +D  YDR+   L  L+E+FPE    D P
Sbjct: 1   MTREEARRRINELRDLIRYHNYRYYVLADPEISDAEYDRLLRELKELEERFPEFKSPDSP 60

Query: 114 WNTVG 118
              VG
Sbjct: 61  TEQVG 65