RPSBLAST alignment of GI: 254781196 and protein with PDBid: 1ta8

>1ta8_A DNA ligase, NAD-dependent; nucleotidyl transferase fold; HET: DNA NMN; 1.80A {Enterococcus faecalis V583} SCOP: d.142.2.2 PDB: 3ba8_A* 1tae_A* 3ba9_A* 3baa_A* 3bab_A* Length = 332
 Score = 57.3 bits (137), Expect = 8e-10
 Identities = 20/66 (30%), Positives = 30/66 (45%)

Query: 54  LSKGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHP 113
           L+   A    + L K    +   YY  D P   D +YDR+ + L  ++ +FP+L   D P
Sbjct: 6   LTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSP 65

Query: 114 WNTVGY 119
              VG 
Sbjct: 66  TQRVGG 71