RPSBLAST alignment of GI: 254781196 and protein with PDBid: 3jsl

>3jsl_A DNA ligase; NAD+-dependent, DNA damage, DNA repair, DNA replication, magnesium, manganese, metal-binding, NAD, zinc; HET: DNA; 1.80A {Staphylococcus aureus} PDB: 3jsn_A* Length = 318
 Score = 53.7 bits (128), Expect = 1e-08
 Identities = 18/57 (31%), Positives = 25/57 (43%)

Query: 62  EVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWNTVG 118
            V  L  +   +   YY  DNP   D  YD++   L  ++E+ PE    D P   VG
Sbjct: 7   RVNELHDLLNQYSYEYYVEDNPSVPDSEYDKLLHELIKIEEEHPEYKTVDSPTVRVG 63