Score = 50.3 bits (119), Expect = 4e-08 Identities = 21/64 (32%), Positives = 32/64 (50%) Query: 56 KGEAMIEVEYLVKIALHHQKWYYRLDNPLFTDGLYDRVSERLDALQEQFPELFDEDHPWN 115 + +A L ++ + YY LD P D YDR+ + L A++EQ+PEL D P Sbjct: 2 RQQAERRAAELRELLNRYGYEYYVLDRPSVPDAEYDRLMQELIAIEEQYPELKTSDSPTQ 61 Query: 116 TVGY 119 +G Sbjct: 62 RIGG 65
class: Alpha and beta proteins (a+b)
fold: ATP-grasp
superfamily: DNA ligase/mRNA capping enzyme, catalytic domain
family: Adenylation domain of NAD+-dependent DNA ligase
domain: Adenylation domain of NAD+-dependent DNA ligase
species: Bacillus stearothermophilus [TaxId: 1422]