HHsearch alignment for GI: 254781197 and conserved domain: COG4618

>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only].
Probab=96.89  E-value=0.0012  Score=42.02  Aligned_cols=49  Identities=24%  Similarity=0.208  Sum_probs=32.7

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             71899988999998999999985189817998611888999832355300012354211
Q gi|254781197|r    2 AHIFVLIGASGVGETTIAKQVVLNSEYLVMPVGVTTRRPRVDEKQYIDYRFISQSQFKG   60 (185)
Q Consensus         2 ~kiivi~GpSGsGK~tl~~~L~~~~~~~~~~is~TTR~~R~~E~~g~dY~Fvs~e~F~~   60 (185)
T Consensus       362 G~~lgIIGPSgSGKSTLaR~lvG~w~p~~G~VR----------LDga~l~qWd~e~lG~  410 (580)
T COG4618         362 GEALGIIGPSGSGKSTLARLLVGIWPPTSGSVR----------LDGADLRQWDREQLGR  410 (580)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCCCCCCEE----------ECCHHHHCCCHHHHCC
T ss_conf             866788788876577899999811356787377----------5626451279888511