HHsearch alignment for GI: 254781197 and conserved domain: PRK13541

>PRK13541 cytochrome c biogenesis protein CcmA; Provisional.
Probab=97.07  E-value=0.00086  Score=42.75  Aligned_cols=33  Identities=15%  Similarity=0.175  Sum_probs=24.5

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHCCCEEEEEE
Q ss_conf             718999889999989999999851898179986
Q gi|254781197|r    2 AHIFVLIGASGVGETTIAKQVVLNSEYLVMPVG   34 (185)
Q Consensus         2 ~kiivi~GpSGsGK~tl~~~L~~~~~~~~~~is   34 (185)
T Consensus        26 G~i~~i~G~NGsGKSTLlk~i~Gl~~p~~G~I~   58 (195)
T PRK13541         26 SAITYIKGANGCGKSSLLRMIAGIMQPSSGNIY   58 (195)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEE
T ss_conf             979999999998199999999679889840899