HHsearch alignment for GI: 254781197 and conserved domain: PRK13975

>PRK13975 thymidylate kinase; Provisional.
Probab=98.28  E-value=2.2e-06  Score=57.83  Aligned_cols=38  Identities=29%  Similarity=0.302  Sum_probs=31.3

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHCCCEEEEEEECCCCCCCCC
Q ss_conf             97189998899999899999998518981799861188899983
Q gi|254781197|r    1 MAHIFVLIGASGVGETTIAKQVVLNSEYLVMPVGVTTRRPRVDE   44 (185)
Q Consensus         1 m~kiivi~GpSGsGK~tl~~~L~~~~~~~~~~is~TTR~~R~~E   44 (185)
T Consensus         1 m~kfI~fEGiDGsGKsTq~~lL~~~L~~------~~t~epg~t~   38 (198)
T PRK13975          1 MNKFIVFEGIDGSGKTTQAKLLAEKLNA------KFTFEPTDGK   38 (198)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHCCC------CEEECCCCCC
T ss_conf             9988999899888699999999997387------4888979984