HHsearch alignment for GI: 254781197 and conserved domain: cd01131

>cd01131 PilT Pilus retraction ATPase PilT. PilT is a nucleotide binding protein responsible for the retraction of type IV pili, likely by pili disassembly. This retraction provides the force required for travel of bacteria in low water environments by a mechanism known as twitching motility.
Probab=96.37  E-value=0.0038  Score=39.02  Aligned_cols=115  Identities=15%  Similarity=0.201  Sum_probs=53.0

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCC-EEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCEEEEEEEECCCEEEEEC
Q ss_conf             8999889999989999999851898-179986118889998323553000123542111027636445550486055443
Q gi|254781197|r    4 IFVLIGASGVGETTIAKQVVLNSEY-LVMPVGVTTRRPRVDEKQYIDYRFISQSQFKGWKHTGLFIETTKVRDEYYGYLK   82 (185)
Q Consensus         4 iivi~GpSGsGK~tl~~~L~~~~~~-~~~~is~TTR~~R~~E~~g~dY~Fvs~e~F~~~i~~g~flE~~~~~g~~YGt~~   82 (185)
T Consensus         3 liLitG~TGSGKTTtl~all~~i~~~~~~~I-iTiE-------DPiE~~~~~~---------~~~i~q~e~-g~~~~sf~   64 (198)
T cd01131           3 LVLVTGPTGSGKSTTLAAMIDYINKNKTHHI-LTIE-------DPIEFVHESK---------RSLINQREV-GLDTLSFE   64 (198)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCCCCEE-EEEC-------CCHHHHCCCC---------CEEEEECCC-CCCCCCHH
T ss_conf             8999899999799999999985363788369-9964-------7377523676---------448873330-78863799


Q ss_pred             CCHHHHHHHCCCCCCCCCCCCHHHHH----HCCCCCHHHHHHCCCCHHHHHHHHHHCC
Q ss_conf             20023332012320024310001332----1055310112221332899999886303
Q gi|254781197|r   83 EDINNPMEHGYDILLILTHQGLAPLK----KLYEDQVTSIFIAPPSEAELIQRRIKRR  136 (185)
Q Consensus        83 ~~i~~~~~~g~~~il~id~~G~~~lk----~~~~~~~~~IfI~pps~~~L~~RL~~R~  136 (185)
T Consensus        65 ~~lr~aLR~~PDvI~vGEiRd~et~~~al~aa~TGHlV~sTlHa~sa~~ai~Rl~~~~  122 (198)
T cd01131          65 NALKAALRQDPDVILVGEMRDLETIRLALTAAETGHLVMSTLHTNSAAKTIDRIIDVF  122 (198)
T ss_pred             HHHHHHHHHCCCEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHC
T ss_conf             9999998548885752777899999999999971993999767598999999999968