>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1). NFT1 belongs to the MRP (mulrtidrug resisitance-associated protein) family of ABC transporters. Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions such as glutathione, glucuronate, and sulfate.

Probab=97.56 E-value=0.00013 Score=47.56 Aligned_cols=49 Identities=16% Similarity=0.185 Sum_probs=31.4 Q ss_pred CCEEEEECCCCCCHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHH Q ss_conf 71899988999998999999985189817998611888999832355300012354211 Q gi|254781197|r 2 AHIFVLIGASGVGETTIAKQVVLNSEYLVMPVGVTTRRPRVDEKQYIDYRFISQSQFKG 60 (185) Q Consensus 2 ~kiivi~GpSGsGK~tl~~~L~~~~~~~~~~is~TTR~~R~~E~~g~dY~Fvs~e~F~~ 60 (185) T Consensus 34 Ge~v~ivG~sGsGKSTLl~ll~g~~~p~~G~I~----------idg~di~~~~~~~~r~ 82 (207) T cd03369 34 GEKIGIVGRTGAGKSTLILALFRFLEAEEGKIE----------IDGIDISTIPLEDLRS 82 (207) T ss_pred CCEEEEECCCCCCHHHHHHHHHHHCCCCCCEEE----------ECCEECCCCCHHHHHH T ss_conf 999999999998799999999987288887899----------9999954079999995

HHsearch alignment for GI: 254781197 and conserved domain: cd03369