HHsearch alignment for GI: 254781197 and conserved domain: smart00072

>smart00072 GuKc Guanylate kinase homologues. Active enzymes catalyze ATP-dependent phosphorylation of GMP to GDP. Structure resembles that of adenylate kinase. So-called membrane-associated guanylate kinase homologues (MAGUKs) do not possess guanylate kinase activities; instead at least some possess protein-binding functions.
Probab=100.00  E-value=0  Score=355.22  Aligned_cols=175  Identities=34%  Similarity=0.464  Sum_probs=164.3

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHCC-CEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCEEEEEEEECCCEEEE
Q ss_conf             71899988999998999999985189-81799861188899983235530001235421110276364455504860554
Q gi|254781197|r    2 AHIFVLIGASGVGETTIAKQVVLNSE-YLVMPVGVTTRRPRVDEKQYIDYRFISQSQFKGWKHTGLFIETTKVRDEYYGY   80 (185)
Q Consensus         2 ~kiivi~GpSGsGK~tl~~~L~~~~~-~~~~~is~TTR~~R~~E~~g~dY~Fvs~e~F~~~i~~g~flE~~~~~g~~YGt   80 (185)
T Consensus         2 ~r~iil~Gpsg~GK~tl~~~l~~~~~~~~~~~v~~TTR~~r~gE~~G~dY~Fvs~~~F~~~i~~~~flE~~~~~g~~YGt   81 (184)
T smart00072        2 RRPIVLSGPSGVGKGTLLAELIQEIPDAFERVVSHTTRPPRPGEVNGVDYHFVSREEFEDDIKSGLFLEWGEYSGNYYGT   81 (184)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCEEEEEEHHHHHHHHHCCHHHHHHHHCCCCCCC
T ss_conf             97799999999999999999986396450577876727998899999636997179999998727417888747877541


Q ss_pred             ECCCHHHHHHHCCCCCCCCCCCCHHHHHHCCCCCHHHHHHCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHH------HCC
Q ss_conf             43200233320123200243100013321055310112221332899999886303420789999999876------369
Q gi|254781197|r   81 LKEDINNPMEHGYDILLILTHQGLAPLKKLYEDQVTSIFIAPPSEAELIQRRIKRREDTPFNLDPDLFGKN------HSY  154 (185)
Q Consensus        81 ~~~~i~~~~~~g~~~il~id~~G~~~lk~~~~~~~~~IfI~pps~~~L~~RL~~R~~d~~~~i~~rl~~~~------~~f  154 (185)
T Consensus        82 ~~~~I~~~~~~g~~~ildi~~~g~~~l~~~~~-~~~~Ifi~pps~e~L~~RL~~Rg~~~~~~i~~Rl~~a~~e~~~~~~f  160 (184)
T smart00072       82 SKETIRQVAEQGKHCLLDIDPQGVKQLRKAQL-YPIVIFIAPPSSEELERRLRGRGTETAERIQKRLAAAQKEAQEYHLF  160 (184)
T ss_pred             HHHHHHHHHCCCCEEEEEECHHHHHHHHHHCC-CCEEEEEECCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHC
T ss_conf             06789998726986999962999999998588-80799993899999999997169999999999999999999647339


Q ss_pred             CEEEECCCHHHHHHHHHHHHHHH
Q ss_conf             88999397899999999999999
Q gi|254781197|r  155 SFTIVNNHLPTACRQVGFIREFV  177 (185)
Q Consensus       155 D~~IvNddle~a~~~l~~I~e~~  177 (185)
T Consensus       161 d~vIvN~dl~~a~~~l~~iI~~e  183 (184)
T smart00072      161 DYVIVNDDLEDAYEELKEILEAE  183 (184)
T ss_pred             CEEEECCCHHHHHHHHHHHHHHC
T ss_conf             99998989999999999999855