BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254781198|ref|YP_003065611.1| guanylate kinase [Candidatus Liberibacter asiaticus str. psy62] (117 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done >gi|254781198|ref|YP_003065611.1| guanylate kinase [Candidatus Liberibacter asiaticus str. psy62] gi|254040875|gb|ACT57671.1| guanylate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 117 Score = 228 bits (581), Expect = 2e-58, Method: Composition-based stats. Identities = 117/117 (100%), Positives = 117/117 (100%) Query: 1 MNSMERRSVMDTNHKGSNLPPEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDN 60 MNSMERRSVMDTNHKGSNLPPEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDN Sbjct: 1 MNSMERRSVMDTNHKGSNLPPEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDN 60 Query: 61 REDIANVRIEVANVRIEVANVRTEMLGLIWKIPATAIGISICLRFLANVMDKGIHLF 117 REDIANVRIEVANVRIEVANVRTEMLGLIWKIPATAIGISICLRFLANVMDKGIHLF Sbjct: 61 REDIANVRIEVANVRIEVANVRTEMLGLIWKIPATAIGISICLRFLANVMDKGIHLF 117 >gi|317120703|gb|ADV02526.1| hypothetical protein SC1_gp235 [Liberibacter phage SC1] gi|317120807|gb|ADV02628.1| hypothetical protein SC1_gp235 [Liberibacter phage SC1] Length = 123 Score = 227 bits (578), Expect = 5e-58, Method: Composition-based stats. Identities = 117/117 (100%), Positives = 117/117 (100%) Query: 1 MNSMERRSVMDTNHKGSNLPPEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDN 60 MNSMERRSVMDTNHKGSNLPPEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDN Sbjct: 7 MNSMERRSVMDTNHKGSNLPPEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDN 66 Query: 61 REDIANVRIEVANVRIEVANVRTEMLGLIWKIPATAIGISICLRFLANVMDKGIHLF 117 REDIANVRIEVANVRIEVANVRTEMLGLIWKIPATAIGISICLRFLANVMDKGIHLF Sbjct: 67 REDIANVRIEVANVRIEVANVRTEMLGLIWKIPATAIGISICLRFLANVMDKGIHLF 123 >gi|315121785|ref|YP_004062274.1| hypothetical protein CKC_00175 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495187|gb|ADR51786.1| hypothetical protein CKC_00175 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 99 Score = 45.1 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 51/107 (47%), Gaps = 38/107 (35%) Query: 11 DTNHKGSNLPPEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDNREDIANVRIE 70 + NHK S+ P + D+R+TLLE NY+RL+DK++ +I Sbjct: 8 EKNHKTSSQP------LTDYRLTLLENNYDRLNDKLD--------------------KIL 41 Query: 71 VANVRIEVANVRTEMLGLIWKIPATAIGISICLRFLANVMDKGIHLF 117 VA VR G++WKIPA IS+ L +V++ I +F Sbjct: 42 VA-VR-----------GMLWKIPAIFAAISLLLHSFISVLEFPIKIF 76 >gi|328953339|ref|YP_004370673.1| hypothetical protein Desac_1644 [Desulfobacca acetoxidans DSM 11109] gi|328453663|gb|AEB09492.1| hypothetical protein Desac_1644 [Desulfobacca acetoxidans DSM 11109] Length = 141 Score = 39.3 bits (90), Expect = 0.17, Method: Composition-based stats. Identities = 16/25 (64%), Positives = 22/25 (88%) Query: 61 REDIANVRIEVANVRIEVANVRTEM 85 +EDIAN+R E+AN+R E AN+RTE+ Sbjct: 62 KEDIANLRTEIANLRTETANLRTEV 86 Score = 36.2 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 27/99 (27%), Positives = 49/99 (49%), Gaps = 6/99 (6%) Query: 25 KNIQDHRITLLEKNYERLSDKVEASHTK--LMEAILDNREDIANVRIEVANVRIEV---- 78 + I+ R ++ L+ K + ++ + + E I + R +IAN+R E AN+R EV Sbjct: 31 QKIEKQRTSVKADLLMELATKADVANLRAEVKEDIANLRTEIANLRTETANLRTEVKDDL 90 Query: 79 ANVRTEMLGLIWKIPATAIGISICLRFLANVMDKGIHLF 117 N+RTE+ I ++ I + ++ L + GI F Sbjct: 91 GNLRTEIKTDITRLDGELKSIRLWMKLLVAIGILGISFF 129 Score = 35.4 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 11/58 (18%) Query: 40 ERLSDKVEASHTK-----LMEAILDNREDIANVRIEV----ANVRIEVANVRTEMLGL 88 + L K+E T LME L + D+AN+R EV AN+R E+AN+RTE L Sbjct: 27 QDLDQKIEKQRTSVKADLLME--LATKADVANLRAEVKEDIANLRTEIANLRTETANL 82 >gi|168490166|ref|ZP_02714365.1| PblB [Streptococcus pneumoniae SP195] gi|183571459|gb|EDT91987.1| PblB [Streptococcus pneumoniae SP195] Length = 3023 Score = 39.3 bits (90), Expect = 0.18, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 36/57 (63%), Gaps = 1/57 (1%) Query: 28 QDHRITLLEKNYERLSDKVEASHTKLMEAILDNREDIANVRIEVANVRIEVANVRTE 84 QD R++ +E N+++ +D +EA ++L E L + DI+++ + N+R V ++ T+ Sbjct: 1139 QDERVSAVESNFKQRADSLEAGVSRLTEG-LRTKADISSLNVTAENIRQSVKSLETD 1194 >gi|307066694|ref|YP_003875660.1| PblB, putative [Streptococcus pneumoniae AP200] gi|306408231|gb|ADM83658.1| PblB, putative [Streptococcus phage PhiSpn_200] Length = 3035 Score = 38.9 bits (89), Expect = 0.27, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Query: 28 QDHRITLLEKNYERLSDKVEASHTKLMEAILDNREDIANVRIEVANVRIEVANVRTE 84 QD R++ +E N+++ +D +EA +L E L + DI+++ + N+R V ++ T+ Sbjct: 1404 QDERVSAVESNFKQRADSLEAGVNRLTEG-LRTKADISSLNVTAENIRQSVKSLETD 1459 >gi|169833508|ref|YP_001693486.1| hypothetical protein SPH_0062 [Streptococcus pneumoniae Hungary19A-6] gi|168996010|gb|ACA36622.1| PblB [Streptococcus pneumoniae Hungary19A-6] Length = 3038 Score = 38.9 bits (89), Expect = 0.27, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Query: 28 QDHRITLLEKNYERLSDKVEASHTKLMEAILDNREDIANVRIEVANVRIEVANVRTE 84 QD R++ +E N+++ +D +EA +L E L + DI+++ + N+R V ++ T+ Sbjct: 1404 QDERVSAVESNFKQRADSLEAGVNRLTEG-LRTKADISSLNVTAENIRQSVKSLETD 1459 >gi|322696012|gb|EFY87811.1| hypothetical protein MAC_06178 [Metarhizium acridum CQMa 102] Length = 830 Score = 38.5 bits (88), Expect = 0.29, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 31/58 (53%) Query: 3 SMERRSVMDTNHKGSNLPPEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDN 60 S+E+ +D + + S LPP EIK+ + H + + + + + D AS + E I DN Sbjct: 149 SIEKNDEVDVDTRVSRLPPPEIKSDEQHLVNVQDASTTSVDDATPASSQQTAEEIFDN 206 >gi|294658698|ref|XP_461037.2| DEHA2F15554p [Debaryomyces hansenii CBS767] gi|202953320|emb|CAG89407.2| DEHA2F15554p [Debaryomyces hansenii] Length = 289 Score = 37.0 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 24/62 (38%), Positives = 31/62 (50%), Gaps = 5/62 (8%) Query: 5 ERRSVMDTNHKGSNLPPE--EIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDNRE 62 E+ + H+ NLPPE E K I+D R E N SD E T+LME L +E Sbjct: 81 EKDQCIYYTHRSQNLPPEDSENKTIEDSR---EESNIAITSDNNEIWKTELMEEFLRLKE 137 Query: 63 DI 64 D+ Sbjct: 138 DV 139 >gi|317120746|gb|ADV02568.1| hypothetical protein SC2_gp240 [Liberibacter phage SC2] gi|317120760|gb|ADV02581.1| hypothetical protein SC2_gp240 [Liberibacter phage SC2] Length = 155 Score = 36.6 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 31/102 (30%), Positives = 51/102 (50%), Gaps = 16/102 (15%) Query: 11 DTNHKGSNLPPEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDNREDIANVRIE 70 + HK S+ P + ++R+TLLEKNY+RL +KV+ K +D R D +++ Sbjct: 32 EKTHKTSSQP------LTEYRLTLLEKNYDRLENKVDRLSDK-----MDARFDFLIDKMD 80 Query: 71 VANVRIEVANVRTEMLGLIWKIPATAIGISICLRFLANVMDK 112 + R++ R E LI K+ + + FL + MDK Sbjct: 81 KESKRVD---ARFEF--LIDKMDKESKRVDARFEFLIDKMDK 117 >gi|307709097|ref|ZP_07645556.1| septation ring formation regulator ezrA [Streptococcus mitis SK564] gi|307620043|gb|EFN99160.1| septation ring formation regulator ezrA [Streptococcus mitis SK564] Length = 575 Score = 36.2 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 20/68 (29%), Positives = 38/68 (55%), Gaps = 2/68 (2%) Query: 21 PEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDNREDIANVRIEVANVRIEVAN 80 P+++++++D LL+ NY +EA L EA+ N+E+IA ++E+ N E Sbjct: 233 PDQLEDLEDGYRKLLDANYHFAETDIEARFQLLYEALKKNQENIA--KLELDNAEYENTQ 290 Query: 81 VRTEMLGL 88 ++ E+ L Sbjct: 291 IQEEINAL 298 >gi|307704604|ref|ZP_07641507.1| septation ring formation regulator ezrA [Streptococcus mitis SK597] gi|307621849|gb|EFO00883.1| septation ring formation regulator ezrA [Streptococcus mitis SK597] Length = 575 Score = 35.8 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 20/68 (29%), Positives = 37/68 (54%), Gaps = 2/68 (2%) Query: 21 PEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDNREDIANVRIEVANVRIEVAN 80 P+++++++D LL+ NY +EA L EA+ N E+IA ++E+ N E Sbjct: 233 PDQLEDLEDGYRKLLDANYHFAETDIEARFQLLYEALKKNHENIA--KLELDNAEYENTQ 290 Query: 81 VRTEMLGL 88 ++ E+ L Sbjct: 291 IQEEINAL 298 >gi|255718697|ref|XP_002555629.1| KLTH0G13728p [Lachancea thermotolerans] gi|238937013|emb|CAR25192.1| KLTH0G13728p [Lachancea thermotolerans] Length = 2966 Score = 35.8 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 19/63 (30%), Positives = 37/63 (58%), Gaps = 1/63 (1%) Query: 24 IKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDNRE-DIANVRIEVANVRIEVANVR 82 + N+++ R+++ + YE + + VE H KL+E +DN E D+ I++A+ + N+R Sbjct: 1202 VVNLENSRLSISPECYEVIGNAVEQCHKKLIEQFIDNIELDVVLHFIKMASRQKNYKNIR 1261 Query: 83 TEM 85 M Sbjct: 1262 VLM 1264 >gi|194336863|ref|YP_002018657.1| Gas vesicle synthesis GvpLGvpF [Pelodictyon phaeoclathratiforme BU-1] gi|194309340|gb|ACF44040.1| Gas vesicle synthesis GvpLGvpF [Pelodictyon phaeoclathratiforme BU-1] Length = 257 Score = 35.8 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 18/64 (28%), Positives = 34/64 (53%) Query: 21 PEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDNREDIANVRIEVANVRIEVAN 80 P+EI+N+ D R L + ER +KVE + ++D ++I +E+ +R E+ Sbjct: 88 PDEIRNLLDRRYGELSELLERFENKVEYNLKASWRCMIDIYKEIDKEHVELKQLRREIEG 147 Query: 81 VRTE 84 ++ E Sbjct: 148 LKDE 151 >gi|68076775|ref|XP_680307.1| dynein heavy chain [Plasmodium berghei strain ANKA] gi|56501222|emb|CAH98434.1| dynein heavy chain, putative [Plasmodium berghei] Length = 4363 Score = 35.4 bits (80), Expect = 2.6, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 33/51 (64%), Gaps = 1/51 (1%) Query: 37 KNYERLSDKVEASHTKLMEAILDNR-EDIANVRIEVANVRIEVANVRTEML 86 +N E+ +KVE + ++ E IL + ++I N++IE+ N + E+ N++ E+ Sbjct: 396 ENVEKNKEKVEIQYNEIKEKILKYKNKEIKNIKIEIKNFKEELINLKNEIF 446 >gi|82793506|ref|XP_728067.1| P-type ATPase [Plasmodium yoelii yoelii str. 17XNL] gi|23484230|gb|EAA19632.1| ATPase, P-type, HAD superfamily, subfamily IC, putative [Plasmodium yoelii yoelii] Length = 1764 Score = 35.4 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 22/74 (29%), Positives = 37/74 (50%) Query: 3 SMERRSVMDTNHKGSNLPPEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDNRE 62 +++ RS N +N E KNI H+ + KN + S V A K+ + L++RE Sbjct: 1169 NLDLRSETILNFMKTNFFNSEKKNIIPHQTMVDLKNDKHHSSSVLAKQEKVYSSFLESRE 1228 Query: 63 DIANVRIEVANVRI 76 + NV+ +VR+ Sbjct: 1229 SLGNVKSSSESVRM 1242 >gi|254780339|ref|YP_003064752.1| hypothetical protein CLIBASIA_01120 [Candidatus Liberibacter asiaticus str. psy62] gi|254040016|gb|ACT56812.1| hypothetical protein CLIBASIA_01120 [Candidatus Liberibacter asiaticus str. psy62] Length = 88 Score = 35.0 bits (79), Expect = 3.4, Method: Composition-based stats. Identities = 18/50 (36%), Positives = 32/50 (64%), Gaps = 3/50 (6%) Query: 51 TKLMEAILDNREDIANVRIEVANVRIEVANVRTEMLGLIWKIPATAIGIS 100 + L EAI +NR +IAN+R +++ ++ +++E+ + WKI T IG S Sbjct: 8 SNLKEAITNNRVEIANIRADMSGTSMK---IQSEINNMSWKILTTMIGCS 54 >gi|322376371|ref|ZP_08050864.1| septation ring formation regulator EzrA [Streptococcus sp. M334] gi|321282178|gb|EFX59185.1| septation ring formation regulator EzrA [Streptococcus sp. M334] Length = 575 Score = 35.0 bits (79), Expect = 3.4, Method: Composition-based stats. Identities = 20/68 (29%), Positives = 37/68 (54%), Gaps = 2/68 (2%) Query: 21 PEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDNREDIANVRIEVANVRIEVAN 80 P+++++++D LL+ NY +EA L EA+ N E+IA ++E+ N E Sbjct: 233 PDQLEDLEDGYRKLLDANYHFAETDIEARFQLLHEALKKNHENIA--QLELDNAEYENTQ 290 Query: 81 VRTEMLGL 88 ++ E+ L Sbjct: 291 IQEEINAL 298 >gi|302927526|ref|XP_003054516.1| hypothetical protein NECHADRAFT_75320 [Nectria haematococca mpVI 77-13-4] gi|256735457|gb|EEU48803.1| hypothetical protein NECHADRAFT_75320 [Nectria haematococca mpVI 77-13-4] Length = 586 Score = 35.0 bits (79), Expect = 3.8, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 32/60 (53%) Query: 4 MERRSVMDTNHKGSNLPPEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDNRED 63 + RR + + + + E+I N+ D RI + KN E L ++EA+ KL A + ++ D Sbjct: 69 VNRREIDEIFGQKNRKSKEQILNVLDRRIDYVTKNIESLEKQIEAAENKLAAATVISQPD 128 >gi|289167708|ref|YP_003445977.1| negative regulator of septation ring formation [Streptococcus mitis B6] gi|288907275|emb|CBJ22110.1| negative regulator of septation ring formation [Streptococcus mitis B6] Length = 575 Score = 34.7 bits (78), Expect = 4.1, Method: Composition-based stats. Identities = 20/68 (29%), Positives = 37/68 (54%), Gaps = 2/68 (2%) Query: 21 PEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDNREDIANVRIEVANVRIEVAN 80 P+++++++D LL+ NY +E+ L EA+ N E+IA ++E+ N E Sbjct: 233 PDQLEDLEDGYRKLLDANYHFAETDIESRFQLLYEALKKNHENIA--QLELDNAEYENTQ 290 Query: 81 VRTEMLGL 88 V+ E+ L Sbjct: 291 VQEEINAL 298 >gi|298705207|emb|CBJ28638.1| conserved unknown protein [Ectocarpus siliculosus] Length = 1030 Score = 34.7 bits (78), Expect = 4.3, Method: Composition-based stats. Identities = 25/86 (29%), Positives = 45/86 (52%), Gaps = 2/86 (2%) Query: 4 MERRSVMDTNHKGSNLPPEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDNRED 63 ++R + ++ N KG N EE+K +++ + + + VE +K EA L E+ Sbjct: 659 LKRLAKLEKNEKGHNAMTEELKKMEEETGIRVGFDSSLEFNTVEGDLSKEDEARL--IEE 716 Query: 64 IANVRIEVANVRIEVANVRTEMLGLI 89 + N R E+ N+++ A V E+LG I Sbjct: 717 LDNARDEIKNIKMRQAMVTHELLGNI 742 >gi|332523905|ref|ZP_08400157.1| septation ring formation regulator EzrA [Streptococcus porcinus str. Jelinkova 176] gi|332315169|gb|EGJ28154.1| septation ring formation regulator EzrA [Streptococcus porcinus str. Jelinkova 176] Length = 574 Score = 34.7 bits (78), Expect = 4.7, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 30/52 (57%) Query: 21 PEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDNREDIANVRIEVA 72 P+++ +++ LLE+NY +EA ++ EAI N D+AN+ ++ A Sbjct: 232 PDQLDDLESGYRRLLEENYHFAETNIEARFQEIREAIRTNSSDLANLDLDSA 283 >gi|297374660|emb|CBL42947.1| hypothetical protein mtbajb2F00038 [Candidatus Magnetobacterium bavaricum] Length = 81 Score = 34.7 bits (78), Expect = 4.9, Method: Composition-based stats. Identities = 23/69 (33%), Positives = 40/69 (57%), Gaps = 2/69 (2%) Query: 32 ITLLEKNYERLSDKVEASHTKLM-EAILDNREDIANVRIEVANVRIEVANVRTEMLGLIW 90 IT+ + ++L D+ + K++ EA LD R D+A + ++A VR E+A +R E+L L W Sbjct: 4 ITIPKALRDKLGDEGTDAFIKVISEAGLDTRRDLAT-KDDIAKVRDEIAIIRGELLLLKW 62 Query: 91 KIPATAIGI 99 + G+ Sbjct: 63 MMGILIAGV 71 >gi|307708512|ref|ZP_07644977.1| septation ring formation regulator EzrA [Streptococcus mitis NCTC 12261] gi|307615428|gb|EFN94636.1| septation ring formation regulator EzrA [Streptococcus mitis NCTC 12261] Length = 575 Score = 34.7 bits (78), Expect = 4.9, Method: Composition-based stats. Identities = 20/68 (29%), Positives = 37/68 (54%), Gaps = 2/68 (2%) Query: 21 PEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDNREDIANVRIEVANVRIEVAN 80 P+++++++D LL+ NY +E+ L EA+ N E+IA ++E+ N E Sbjct: 233 PDQLEDLEDGYRKLLDANYHFSETDIESRFQLLYEALKKNHENIA--QLELDNAEYENTQ 290 Query: 81 VRTEMLGL 88 V+ E+ L Sbjct: 291 VQEEINAL 298 >gi|195125263|ref|XP_002007101.1| GI12568 [Drosophila mojavensis] gi|193918710|gb|EDW17577.1| GI12568 [Drosophila mojavensis] Length = 4641 Score = 34.7 bits (78), Expect = 4.9, Method: Composition-based stats. Identities = 23/78 (29%), Positives = 44/78 (56%), Gaps = 8/78 (10%) Query: 22 EEIKNIQD--HRITLLEKNYERLSDKVEASHTKLMEAI------LDNREDIANVRIEVAN 73 +E++NI++ R+ L N ++++ L+E++ L+ ED A++ VA Sbjct: 742 KEVRNIKNLGFRVPLTIVNKAHQANQIYPYAISLIESVRTYERTLEKIEDRASIVPLVAG 801 Query: 74 VRIEVANVRTEMLGLIWK 91 +R EV N+ +E +GLIW+ Sbjct: 802 LRKEVLNLVSEGIGLIWE 819 >gi|213403356|ref|XP_002172450.1| tip elongation aberrant protein [Schizosaccharomyces japonicus yFS275] gi|212000497|gb|EEB06157.1| tip elongation aberrant protein [Schizosaccharomyces japonicus yFS275] Length = 1161 Score = 34.7 bits (78), Expect = 5.0, Method: Composition-based stats. Identities = 22/80 (27%), Positives = 46/80 (57%), Gaps = 12/80 (15%) Query: 5 ERRSVMDTNHKGSNLPPEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDNREDI 64 +++S++D+N +NL ++ ++ R L E+N + +++ + S +E +LDNR Sbjct: 852 KKQSLLDSN---ANL----VQQLEASR-NLYEENVKAINENLTTS----IEKLLDNRNST 899 Query: 65 ANVRIEVANVRIEVANVRTE 84 ANV IE N ++ + ++ E Sbjct: 900 ANVEIEALNEQLRLNKIKLE 919 >gi|315122491|ref|YP_004062980.1| hypothetical protein CKC_03715 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495893|gb|ADR52492.1| hypothetical protein CKC_03715 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 158 Score = 34.3 bits (77), Expect = 5.5, Method: Composition-based stats. Identities = 18/42 (42%), Positives = 27/42 (64%), Gaps = 4/42 (9%) Query: 48 ASHTKLMEAILDNREDIANVRIEVANVRIE----VANVRTEM 85 A+ L + D +EDI NVR +++NVR E ++NVRTE+ Sbjct: 30 ATKADLADVKTDLKEDIVNVRADISNVRTELKEDISNVRTEL 71 >gi|242309426|ref|ZP_04808581.1| chaperone protein clpB [Helicobacter pullorum MIT 98-5489] gi|239523997|gb|EEQ63863.1| chaperone protein clpB [Helicobacter pullorum MIT 98-5489] Length = 847 Score = 34.3 bits (77), Expect = 5.8, Method: Composition-based stats. Identities = 26/73 (35%), Positives = 41/73 (56%), Gaps = 16/73 (21%) Query: 23 EIKNIQDHRITLL----EKNYER-------LSDKVEASHTKLMEAILDNREDIANVRIEV 71 EI+++Q + LL EKN R LSDK E T +EA +N + + N E+ Sbjct: 407 EIESLQVEKEALLMEKSEKNNARIQEIQKELSDKNETKKT--LEAQFENEKQVFN---EI 461 Query: 72 ANVRIEVANVRTE 84 AN++I++ ++RTE Sbjct: 462 ANIKIQIDSLRTE 474 >gi|330038559|ref|XP_003239631.1| CorA Metal Ion Transporter (MIT) Family [Cryptomonas paramecium] gi|327206555|gb|AEA38733.1| CorA Metal Ion Transporter (MIT) Family [Cryptomonas paramecium] Length = 373 Score = 34.3 bits (77), Expect = 6.4, Method: Composition-based stats. Identities = 18/66 (27%), Positives = 38/66 (57%), Gaps = 2/66 (3%) Query: 24 IKNIQDHR-ITLLEKNYERLSDKVEASHTKLMEAILDNREDIANVRIEVANVRIEVANVR 82 I+N+ +H I +L +NY ++ D + S KL++ +D+ ED+ ++R++ RI + Sbjct: 248 IRNLTEHEEIEILAENYLQIIDYL-TSRAKLLDNAIDDTEDLVSIRLDTIRNRILFVELT 306 Query: 83 TEMLGL 88 ++ L Sbjct: 307 LNIISL 312 >gi|328953337|ref|YP_004370671.1| hypothetical protein Desac_1642 [Desulfobacca acetoxidans DSM 11109] gi|328453661|gb|AEB09490.1| hypothetical protein Desac_1642 [Desulfobacca acetoxidans DSM 11109] Length = 167 Score = 34.3 bits (77), Expect = 6.5, Method: Composition-based stats. Identities = 18/33 (54%), Positives = 24/33 (72%), Gaps = 4/33 (12%) Query: 61 REDIANVRIEV----ANVRIEVANVRTEMLGLI 89 +ED AN+R EV AN+R E+AN+RTE+ G I Sbjct: 73 KEDFANLRAEVKEDIANLRTEIANLRTEVKGEI 105 >gi|195144940|ref|XP_002013454.1| GL23399 [Drosophila persimilis] gi|194102397|gb|EDW24440.1| GL23399 [Drosophila persimilis] Length = 1235 Score = 34.3 bits (77), Expect = 6.7, Method: Composition-based stats. Identities = 20/58 (34%), Positives = 32/58 (55%) Query: 37 KNYERLSDKVEASHTKLMEAILDNREDIANVRIEVANVRIEVANVRTEMLGLIWKIPA 94 K + DK+E + +A+ D EDI+ R +VAN+ E+ NV ++M + KI A Sbjct: 884 KEIDEDKDKMEKISSPKKQAVDDMEEDISKARRDVANLAKEIHNVGSQMSSVESKIEA 941 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.320 0.134 0.375 Lambda K H 0.267 0.0412 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 972,833,297 Number of Sequences: 14124377 Number of extensions: 32020417 Number of successful extensions: 123526 Number of sequences better than 10.0: 69 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 51 Number of HSP's that attempted gapping in prelim test: 123471 Number of HSP's gapped (non-prelim): 87 length of query: 117 length of database: 4,842,793,630 effective HSP length: 84 effective length of query: 33 effective length of database: 3,656,345,962 effective search space: 120659416746 effective search space used: 120659416746 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 75 (33.5 bits)