RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781199|ref|YP_003065612.1| hypothetical protein CLIBASIA_05530 [Candidatus Liberibacter asiaticus str. psy62] (157 letters) >gnl|CDD|31689 COG1500, COG1500, Predicted exosome subunit [Translation, ribosomal structure and biogenesis]. Length = 234 Score = 27.5 bits (61), Expect = 1.5 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 6/75 (8%) Query: 14 LLRFIPSGFERI---VDVVSEYLTKKQSI--EYDKLKLEMAKNDSSTQLDLAEIKAGIEE 68 L IP FER V + EY K + ++ ++K E + D S + + EI AG ++ Sbjct: 153 LRPIIPIRFERAKVAVKIPVEYAGKAYGLLRKFGEIKKEEWQEDGS-WICVLEIPAGNQD 211 Query: 69 LKIDKPIRLARIEAQ 83 + L + E Q Sbjct: 212 EFYELLNELTKGEVQ 226 >gnl|CDD|38081 KOG2870, KOG2870, KOG2870, NADH:ubiquinone oxidoreductase, NDUFS2/49 kDa subunit [Energy production and conversion]. Length = 452 Score = 27.2 bits (60), Expect = 2.1 Identities = 21/90 (23%), Positives = 43/90 (47%), Gaps = 7/90 (7%) Query: 21 GFERIVDVVSEYLTKKQSIEY-DKLK-LEMAKNDSSTQLDLAEIKAGIEELKIDKPIRLA 78 G E+++ EY T Q++ Y D+L + M N+ + L + ++ I+ K IR+ Sbjct: 108 GTEKLI----EYKTYTQALPYFDRLDYVSMMCNEQAYSLAVEKL-LNIDVPLRAKYIRVL 162 Query: 79 RIEAQKVKSGVKWVDGFTALIRPLTTFFWI 108 E ++ + + + + +T FFW+ Sbjct: 163 FGEITRIANHIMALGTHALDVGAMTPFFWL 192 >gnl|CDD|146444 pfam03805, CLAG, Cytoadherence-linked asexual protein. Clag (cytoadherence linked asexual gene) is a malaria surface protein which has been shown to be involved in the binding of Plasmodium falciparum infected erythrocytes to host endothelial cells, a process termed cytoadherence. The cytoadherence phenomenon is associated with the sequestration of infected erythrocytes in the blood vessels of the brain, cerebral malaria. Clag is a multi-gene family in Plasmodium falciparum with at least 9 members identified to date. Orthologous proteins in the rodent malaria species Plasmodium chabaudi (Lawson D Unpubl. obs.) suggest that the gene family is found in other malaria species and may play a more generic role in cytoadherence. Length = 1282 Score = 26.6 bits (59), Expect = 2.9 Identities = 12/31 (38%), Positives = 21/31 (67%) Query: 37 QSIEYDKLKLEMAKNDSSTQLDLAEIKAGIE 67 Q++E DKLKL +A +D+ LD+++ K + Sbjct: 28 QTLEQDKLKLPIATSDTKEYLDISKFKIINK 58 >gnl|CDD|38459 KOG3249, KOG3249, KOG3249, Uncharacterized conserved protein [Function unknown]. Length = 181 Score = 26.6 bits (58), Expect = 3.2 Identities = 4/28 (14%), Positives = 10/28 (35%) Query: 91 WVDGFTALIRPLTTFFWIIVYPLLVWWS 118 W+ +L + W ++ P+ Sbjct: 97 WLMFSLSLKMWVIVLLWFVLAPIAHRLD 124 >gnl|CDD|36189 KOG0971, KOG0971, KOG0971, Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning, Cytoskeleton]. Length = 1243 Score = 26.2 bits (57), Expect = 4.7 Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Query: 38 SIEYDKLKLEMAKNDSST-QLDLAEIKAGIEELKIDKPIRLARIEAQ 83 +IE L EMA+ + + Q ++ +K ++EL+ D I A +E + Sbjct: 312 AIEMATLDKEMAEERAESLQQEVEALKERVDELETDLEILKAEMEEK 358 >gnl|CDD|37825 KOG2614, KOG2614, KOG2614, Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion, General function prediction only]. Length = 420 Score = 25.7 bits (56), Expect = 5.7 Identities = 25/121 (20%), Positives = 48/121 (39%), Gaps = 8/121 (6%) Query: 13 FLLRFIPSGFERIVDVVSEYLTKKQSIEYDKLKLEMAKNDSSTQLDLAEIKAGIEELKID 72 FL + FE V V++E L + + + +N+S ++LA + K + Sbjct: 303 FLGQGGNCAFEDCV-VLAECLDEAINDVSLAGEEYSRENESHAIIELA-----MYSYKEE 356 Query: 73 KPIRLARIEAQKVKSGVKWVDGFTALIRPLTTFFWIIVYPLLVWWSVKEGMFNSDPLTLL 132 + RL R++ G+ + + + +F II L +K+ + N L Sbjct: 357 RWRRLLRLKVDAYLVGI--LPQSFGPLYLMVSFRDIIYSEALERLGIKKKILNDGSFFLF 414 Query: 133 S 133 S Sbjct: 415 S 415 >gnl|CDD|36641 KOG1428, KOG1428, KOG1428, Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms]. Length = 3738 Score = 25.8 bits (56), Expect = 5.8 Identities = 9/43 (20%), Positives = 21/43 (48%) Query: 45 KLEMAKNDSSTQLDLAEIKAGIEELKIDKPIRLARIEAQKVKS 87 +E ++D LA + G + L+ + P ++ +A++ S Sbjct: 2335 MVEFCESDEGEAWSLARDRGGNQYLRHEDPRERSKSDAKQAMS 2377 >gnl|CDD|35241 KOG0018, KOG0018, KOG0018, Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning]. Length = 1141 Score = 25.6 bits (56), Expect = 6.2 Identities = 16/58 (27%), Positives = 27/58 (46%), Gaps = 2/58 (3%) Query: 16 RFIPSGFERIVDVVSEYLTKKQSIEYDKLKLEMAKNDSSTQLDLAEIKAGIEELKIDK 73 P + + +S + K EY++LK EMAK + +T + + K+ E K K Sbjct: 139 GKNPKELTALFEEISGSIELKP--EYEELKYEMAKAEETTTGNYKKKKSIAAEKKEAK 194 >gnl|CDD|38307 KOG3097, KOG3097, KOG3097, Predicted membrane protein [Function unknown]. Length = 390 Score = 25.7 bits (56), Expect = 6.3 Identities = 13/66 (19%), Positives = 28/66 (42%), Gaps = 7/66 (10%) Query: 82 AQKVKSGVKWVDGFTALIRPLTTFFWIIVYPLLVWWSVKEGMFNSDPLTLLSPFTQEIIA 141 +K + V ++ F + L ++ PL ++ +++ +D FT+ +A Sbjct: 252 GEKRLASVSGLNIFQLTFKHLRDIRLRLLVPLTIFSGLEQAFLCAD-------FTKAYVA 304 Query: 142 CILGFW 147 C LG Sbjct: 305 CALGVS 310 >gnl|CDD|99834 cd06130, DNA_pol_III_epsilon_like, an uncharacterized bacterial subgroup of the DEDDh 3'-5' exonuclease domain family with similarity to the epsilon subunit of DNA polymerase III. This subfamily is composed of uncharacterized bacterial proteins with similarity to the epsilon subunit of DNA polymerase III (Pol III), a multisubunit polymerase which is the main DNA replicating enzyme in bacteria, functioning as the chromosomal replicase. The Pol III holoenzyme is a complex of ten different subunits, three of which (alpha, epsilon, and theta) compose the catalytic core. The Pol III epsilon subunit, encoded by the dnaQ gene, is a DEDDh-type 3'-5' exonuclease which is responsible for the proofreading activity of the polymerase, increasing the fidelity of DNA synthesis. It contains three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific Hx(4)D conserved pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. The epsilon subunit of Pol III also functions as a stabilizer of the holoenzyme complex. Length = 156 Score = 25.5 bits (57), Expect = 7.2 Identities = 11/34 (32%), Positives = 15/34 (44%), Gaps = 6/34 (17%) Query: 75 IRLARIEAQKVKSGVKWVDGFTALIRPLTTFFWI 108 I L ++ ++ VD F LIRP T F Sbjct: 19 IGLVKVRDGQI------VDTFYTLIRPPTRFDPF 46 >gnl|CDD|173875 cd08510, PBP2_Lactococcal_OppA_like, The substrate binding component of an ABC-type lactococcal OppA-like transport system contains. This family represents the substrate binding domain of an ATP-binding cassette (ABC)-type oligopeptide import system from Lactococcus lactis and other gram-positive bacteria, as well as its closet homologs from gram-negative bacteria. Oligopeptide-binding protein (OppA) from Lactococcus lactis can bind peptides of length from 4 to at least 35 residues without sequence preference. The oligopeptide import system OppABCDEF is consisting of five subunits: two homologous integral membrane proteins OppB and OppF that form the translocation pore; two homologous nucleotide-binding domains OppD and OppF that drive the transport process through binding and hydrolysis of ATP; and the substrate-binding protein or receptor OppA that determines the substrate specificity of the transport system. The dipeptide (DppA) and oligopeptide (OppA) binding proteins differ in several ways. The DppA binds dipeptides and some tripeptides and also is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction. Length = 516 Score = 25.3 bits (56), Expect = 7.2 Identities = 14/50 (28%), Positives = 21/50 (42%), Gaps = 8/50 (16%) Query: 62 IKAGIEELKIDKPIRLARIEAQKVKSGVKWVDGFTALIRPLTTFFWIIVY 111 +G + K+D + I +K GVKW DG +P+T Y Sbjct: 49 TDSGAAKFKLDDKAKTVTI---TIKDGVKWSDG-----KPVTAKDLEYSY 90 >gnl|CDD|38425 KOG3215, KOG3215, KOG3215, Uncharacterized conserved protein [Function unknown]. Length = 222 Score = 25.4 bits (55), Expect = 7.5 Identities = 7/34 (20%), Positives = 16/34 (47%) Query: 40 EYDKLKLEMAKNDSSTQLDLAEIKAGIEELKIDK 73 + KLE+ ++ + + +K + E KI + Sbjct: 93 NLVQKKLEIERSIQKARNKIELLKKQLHEAKIVR 126 >gnl|CDD|36049 KOG0831, KOG0831, KOG0831, Acyl-CoA:diacylglycerol acyltransferase (DGAT) [Lipid transport and metabolism]. Length = 334 Score = 25.2 bits (55), Expect = 7.7 Identities = 6/16 (37%), Positives = 7/16 (43%) Query: 102 LTTFFWIIVYPLLVWW 117 L T FW + VW Sbjct: 42 LFTRFWPLAILYAVWL 57 >gnl|CDD|99838 cd06135, Orn, DEDDh 3'-5' exonuclease domain of oligoribonuclease and similar proteins. Oligoribonuclease (Orn) is a DEDDh-type DnaQ-like 3'-5' exoribonuclease that is responsible for degrading small oligoribonucleotides to mononucleotides. It contains three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific Hx(4)D conserved pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. Orn is essential for Escherichia coli survival. The human homolog, also called Sfn (small fragment nuclease), is able to hydrolyze short single-stranded RNA and DNA oligomers. It plays a role in cellular nucleotide recycling. Length = 173 Score = 25.2 bits (56), Expect = 8.8 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 11/66 (16%) Query: 11 FRFLLRFIPSGFE----RIVDVVS--EYLTKKQSIEYDKLKLEMAKNDSSTQLDLAEIKA 64 RFL +++P E RI+DV S E + Y ++ + A T L +I+ Sbjct: 106 RRFLDKYMPELEEYLHYRILDVSSIKELARRW----YPEIYRK-APKKKGTHRALDDIRE 160 Query: 65 GIEELK 70 I ELK Sbjct: 161 SIAELK 166 >gnl|CDD|30565 COG0216, PrfA, Protein chain release factor A [Translation, ribosomal structure and biogenesis]. Length = 363 Score = 25.1 bits (55), Expect = 9.4 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 3/50 (6%) Query: 23 ERIVDVVSEYLTKKQSIEYDKLKLEMAKNDS---STQLDLAEIKAGIEEL 69 E IV+ EY ++ +E K L K+ + ++ E++A IEEL Sbjct: 46 EPIVEKYREYKKAQEDLEDAKEMLAEEKDPEMREMAEEEIKELEAKIEEL 95 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.324 0.141 0.425 Gapped Lambda K H 0.267 0.0668 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,958,161 Number of extensions: 97943 Number of successful extensions: 391 Number of sequences better than 10.0: 1 Number of HSP's gapped: 391 Number of HSP's successfully gapped: 30 Length of query: 157 Length of database: 6,263,737 Length adjustment: 86 Effective length of query: 71 Effective length of database: 4,405,363 Effective search space: 312780773 Effective search space used: 312780773 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 53 (24.3 bits)