RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781199|ref|YP_003065612.1| hypothetical protein CLIBASIA_05530 [Candidatus Liberibacter asiaticus str. psy62] (157 letters) >d1itwa_ c.77.1.2 (A:) Monomeric isocitrate dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 740 Score = 26.3 bits (58), Expect = 1.4 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Query: 24 RIVDVVSEYLTKKQSIEYDKLKL-EMAKNDSSTQLDLAEIKAGIEELK 70 R++ EYLT Q I D +L ++A + + L I A + +LK Sbjct: 46 RLIATFPEYLTDTQKISDDLAELGKLATTPDANIIKLPNISASVPQLK 93 >d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Length = 260 Score = 25.1 bits (54), Expect = 2.6 Identities = 6/16 (37%), Positives = 11/16 (68%) Query: 14 LLRFIPSGFERIVDVV 29 L++ +P + RI DV+ Sbjct: 4 LVKLLPKRWVRIGDVL 19 >d1zq7a1 d.309.1.1 (A:1-199) Hypothetical protein MM0484 {Methanosarcina mazei [TaxId: 2209]} Length = 199 Score = 24.8 bits (54), Expect = 3.5 Identities = 10/35 (28%), Positives = 13/35 (37%) Query: 52 DSSTQLDLAEIKAGIEELKIDKPIRLARIEAQKVK 86 DS L +KAG+ K + E Q K Sbjct: 152 DSIDFLSHTCMKAGLSPDAWVKGAEVYCFEGQIFK 186 >d1hdmb2 d.19.1.1 (B:3-87) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} Length = 85 Score = 24.5 bits (53), Expect = 4.7 Identities = 7/19 (36%), Positives = 9/19 (47%) Query: 124 FNSDPLTLLSPFTQEIIAC 142 FN D LT P ++ C Sbjct: 26 FNKDLLTCWDPEENKMAPC 44 >d1k8ib2 d.19.1.1 (B:1-94) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), H2-DM [TaxId: 10090]} Length = 94 Score = 23.7 bits (51), Expect = 7.4 Identities = 8/26 (30%), Positives = 10/26 (38%) Query: 124 FNSDPLTLLSPFTQEIIACILGFWYT 149 FN D L P +I+ C G Sbjct: 27 FNKDLLACWDPDVGKIVPCEFGVLSR 52 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.324 0.141 0.425 Gapped Lambda K H 0.267 0.0499 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 616,271 Number of extensions: 27174 Number of successful extensions: 67 Number of sequences better than 10.0: 1 Number of HSP's gapped: 67 Number of HSP's successfully gapped: 10 Length of query: 157 Length of database: 2,407,596 Length adjustment: 78 Effective length of query: 79 Effective length of database: 1,336,656 Effective search space: 105595824 Effective search space used: 105595824 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.2 bits)