BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781202|ref|YP_003065615.1| hypothetical protein
CLIBASIA_05545 [Candidatus Liberibacter asiaticus str. psy62]
         (864 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254781202|ref|YP_003065615.1| hypothetical protein CLIBASIA_05545 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040879|gb|ACT57675.1| hypothetical protein CLIBASIA_05545 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|317120668|gb|ADV02491.1| hypothetical protein SC1_gp030 [Liberibacter phage SC1]
 gi|317120812|gb|ADV02633.1| hypothetical protein SC1_gp030 [Candidatus Liberibacter asiaticus]
          Length = 864

 Score = 1782 bits (4616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 864/864 (100%), Positives = 864/864 (100%)

Query: 1   MKPECIQVLNKAAGRELSKKELRRLEDGIVRAYVSLDGKGLSKAERYRLAGLKAEEDFQK 60
           MKPECIQVLNKAAGRELSKKELRRLEDGIVRAYVSLDGKGLSKAERYRLAGLKAEEDFQK
Sbjct: 1   MKPECIQVLNKAAGRELSKKELRRLEDGIVRAYVSLDGKGLSKAERYRLAGLKAEEDFQK 60

Query: 61  ELIRSVNDAIDEAYKRHQLRSDLDRVQAGVYGKSQALFNKLFFKAGSAEVPLEMKIKAAE 120
           ELIRSVNDAIDEAYKRHQLRSDLDRVQAGVYGKSQALFNKLFFKAGSAEVPLEMKIKAAE
Sbjct: 61  ELIRSVNDAIDEAYKRHQLRSDLDRVQAGVYGKSQALFNKLFFKAGSAEVPLEMKIKAAE 120

Query: 121 TKVLSKFNEYAEVGSKNLGFTLDKQFGLDVFDEMKGKKTQNEQASRLVKQYFETQRELHS 180
           TKVLSKFNEYAEVGSKNLGFTLDKQFGLDVFDEMKGKKTQNEQASRLVKQYFETQRELHS
Sbjct: 121 TKVLSKFNEYAEVGSKNLGFTLDKQFGLDVFDEMKGKKTQNEQASRLVKQYFETQRELHS 180

Query: 181 QAHEAGLDYKFFENRIPQPMSVDKLRATKKDDFVRSMLDWLDLSRYKDIDGTPLSRSEIA 240
           QAHEAGLDYKFFENRIPQPMSVDKLRATKKDDFVRSMLDWLDLSRYKDIDGTPLSRSEIA
Sbjct: 181 QAHEAGLDYKFFENRIPQPMSVDKLRATKKDDFVRSMLDWLDLSRYKDIDGTPLSRSEIA 240

Query: 241 SFVGEVFAERVRSTSFKDPSIPSSEVGVKREFERVFHFKDSQAHMDYMEHFGVSTNVNTI 300
           SFVGEVFAERVRSTSFKDPSIPSSEVGVKREFERVFHFKDSQAHMDYMEHFGVSTNVNTI
Sbjct: 241 SFVGEVFAERVRSTSFKDPSIPSSEVGVKREFERVFHFKDSQAHMDYMEHFGVSTNVNTI 300

Query: 301 LTSELASLSKDIVIARELGPNADSFVKQMIVQTIANDQEASAGNKVLKDWLGRNKLEVRQ 360
           LTSELASLSKDIVIARELGPNADSFVKQMIVQTIANDQEASAGNKVLKDWLGRNKLEVRQ
Sbjct: 301 LTSELASLSKDIVIARELGPNADSFVKQMIVQTIANDQEASAGNKVLKDWLGRNKLEVRQ 360

Query: 361 EAMLQMWEVMRYGETVENTGWANWMAGLRSAAGASMLGQHPIGALLEDGFISRQMLSRVG 420
           EAMLQMWEVMRYGETVENTGWANWMAGLRSAAGASMLGQHPIGALLEDGFISRQMLSRVG
Sbjct: 361 EAMLQMWEVMRYGETVENTGWANWMAGLRSAAGASMLGQHPIGALLEDGFISRQMLSRVG 420

Query: 421 IDKEAIQRINKMPLKERMELLSDVGLYAEGVVAHGRNMMEGSDAFQIGHKLHSKMHKWSG 480
           IDKEAIQRINKMPLKERMELLSDVGLYAEGVVAHGRNMMEGSDAFQIGHKLHSKMHKWSG
Sbjct: 421 IDKEAIQRINKMPLKERMELLSDVGLYAEGVVAHGRNMMEGSDAFQIGHKLHSKMHKWSG 480

Query: 481 AEYLDKKRISSHALIVYNQIGRMTDTYASLKDLKADPRLDPSIKAFFKQLDDTDFTVIKR 540
           AEYLDKKRISSHALIVYNQIGRMTDTYASLKDLKADPRLDPSIKAFFKQLDDTDFTVIKR
Sbjct: 481 AEYLDKKRISSHALIVYNQIGRMTDTYASLKDLKADPRLDPSIKAFFKQLDDTDFTVIKR 540

Query: 541 AKAMSSPDGYLYARTPSTIKNLKDADLRDLARMSDKIAYHRKKLKNSKTLSPEQRQELQQ 600
           AKAMSSPDGYLYARTPSTIKNLKDADLRDLARMSDKIAYHRKKLKNSKTLSPEQRQELQQ
Sbjct: 541 AKAMSSPDGYLYARTPSTIKNLKDADLRDLARMSDKIAYHRKKLKNSKTLSPEQRQELQQ 600

Query: 601 QLADLERKEINILKDKVSNKMHALVLDNVQTSVRGAMHTSLFDRQRLGLLTYKRGTRAGE 660
           QLADLERKEINILKDKVSNKMHALVLDNVQTSVRGAMHTSLFDRQRLGLLTYKRGTRAGE
Sbjct: 601 QLADLERKEINILKDKVSNKMHALVLDNVQTSVRGAMHTSLFDRQRLGLLTYKRGTRAGE 660

Query: 661 ALRMFQQFTTTPTGMFLNILDLSNSAKMPKGASMALNHVWIQYSATMALAGIGVASIKAL 720
           ALRMFQQFTTTPTGMFLNILDLSNSAKMPKGASMALNHVWIQYSATMALAGIGVASIKAL
Sbjct: 661 ALRMFQQFTTTPTGMFLNILDLSNSAKMPKGASMALNHVWIQYSATMALAGIGVASIKAL 720

Query: 721 LRGEDPSLPEVIYDGTLANGALLPYMDRLTKLVSKGDRAAIGGLLGPVPSMVTNLTSSAV 780
           LRGEDPSLPEVIYDGTLANGALLPYMDRLTKLVSKGDRAAIGGLLGPVPSMVTNLTSSAV
Sbjct: 721 LRGEDPSLPEVIYDGTLANGALLPYMDRLTKLVSKGDRAAIGGLLGPVPSMVTNLTSSAV 780

Query: 781 ELATKDNENSKVNATKAIRKTLPFMNMWYLKNSFDHLILNQILEELNPGYLDRQQSKKKK 840
           ELATKDNENSKVNATKAIRKTLPFMNMWYLKNSFDHLILNQILEELNPGYLDRQQSKKKK
Sbjct: 781 ELATKDNENSKVNATKAIRKTLPFMNMWYLKNSFDHLILNQILEELNPGYLDRQQSKKKK 840

Query: 841 KGIELFQNMDEGLPHRLPFPFGED 864
           KGIELFQNMDEGLPHRLPFPFGED
Sbjct: 841 KGIELFQNMDEGLPHRLPFPFGED 864


>gi|309702799|emb|CBJ02130.1| hypothetical phage protein [Escherichia coli ETEC H10407]
          Length = 825

 Score =  164 bits (415), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 209/874 (23%), Positives = 357/874 (40%), Gaps = 98/874 (11%)

Query: 1   MKPECIQVLNKAAGRELSKKELRRLEDGIVRAYVSL------DGKGLSKAERYRLAGLKA 54
           M+ ECIQ + +AA R L+ +E++ +ED I R   SL        + L+ AER R AG  A
Sbjct: 2   MRQECIQAVQQAAKRTLTAREIQDIEDRIYRNMRSLARDDPASWRQLTDAERLRRAGQLA 61

Query: 55  EEDFQKELIRSVNDAIDEAYKRHQLRSDLDRVQAGVYGKSQALFNKLFFKAG--SAEVPL 112
            ++ Q+E              R +L + ++  Q G  GK  AL   + F A   S  + +
Sbjct: 62  SDELQREAALKKRRVALTISARQRLDNFINNYQ-GADGKLGALNRTIAFSADGKSNFLSV 120

Query: 113 EMKIKAAETKVLSKFNE-YAEVGSKNLGFTLDKQFGLDVFDEMKGKKTQNEQASRLVKQY 171
           E + KA     LS+  E +  V  +  G   D+    D+  EM+G+ T N +A +  K +
Sbjct: 121 ESRTKATRDYALSQLQEAFEAVDPRFFGLFEDEAGVRDLVFEMRGQNTGNAKARKGAKAW 180

Query: 172 FETQRELHSQAHEAGLDYKFFENR-IPQPMSVDKLRATKKDDFVRSMLDWLDLSRYKDID 230
            E    L  + ++AG D  + EN  IPQ  S++K+ A  KD +V  ++  LD   Y   D
Sbjct: 181 GEVTELLRRRFNDAGGDIGYLENWGIPQHHSMEKVGAVTKDKWVSDVIGKLDRKYYTRSD 240

Query: 231 GTPLSRSEIASFVGEVFAERVRS--TSFKDPSIPSSEVGVKR-EFERVFHFKDSQAHMDY 287
           G  +S SE+ +F+GE +            D  +  S     R    R  HFKD+ +++ Y
Sbjct: 241 GQLMSDSELTAFLGEAYNTIATGGLNKLTDTGMRISGARANRGNASRQIHFKDADSYLQY 300

Query: 288 MEHFGVSTNVNTILTSELASLSKDIVIARELGPNADSFVKQMIVQTIANDQEA--SAGNK 345
            + +G   ++  I+   L  +SKDI +    GPN D   + ++ Q  A    A  S   K
Sbjct: 301 QQLYG-DRSLWEIMVGHLEGISKDIALVETYGPNPDHVFRSLLDQVKAETATANPSKTGK 359

Query: 346 VLKDWLGRNKLEVRQEAMLQMWEVMRYGETVENTGWANWMAGLRSAAGASMLGQHPIGAL 405
           V        +L    E +     +    + V N   A W   +R+   AS LG   + + 
Sbjct: 360 V-------ERLANNTENLYNF--ISGKTQPVANPHIARWSDNIRNWLVASRLGSALLSSF 410

Query: 406 LEDG--FISRQMLSRVGIDKEAIQRINKMPLKERME--LLSDVGLYAEGVVAHGRNMMEG 461
            + G  ++S + ++ + +++    ++  M    R E  L    GL  E ++         
Sbjct: 411 SDLGTMYLSAK-VTNLPMNQLFRNQLEAMDPTNRTELALARRAGLAMESLLGSVNRWAMD 469

Query: 462 SDAFQIGHKLHSKMHKWSGAEYLDKKRISSHALIVYNQIGRMTDTYASLKDL-KADPRLD 520
           +    +     + + + SG          ++ + +   +G +      L+ L  +D R+ 
Sbjct: 470 NMGPSVSRWAATAVMRASGLTAWSDAHKRAYGVTMMGSLGEVVSRTPDLRSLDDSDFRIL 529

Query: 521 PSIKAFFKQLDDTDFTVIKRAKAMSSPDGYLYARTPSTIKNLKDADLRDLARMSDKIAYH 580
            S     K + DTD++V K A+     +G     TP +I  + D+ ++ L          
Sbjct: 530 KS-----KGITDTDWSVWKLAQQEDWGNGNNTMLTPESIMRIPDSAVKHLG--------- 575

Query: 581 RKKLKNSKTLSPEQ-RQELQQQLADLERKEINILKDKVSNKMHALVLDNVQTSVRGAMHT 639
                      PE+ + E  ++L     +E+++       +    V   +Q         
Sbjct: 576 ----------EPERVKFEAMRKLLGAVTEEVDMAVITPGAREQMFVGSGLQ--------- 616

Query: 640 SLFDRQRLGLLTYKRGTRAGEALRMFQQFTTTPTGMFLNILDLSNSAKMPKGASMALNHV 699
                         RGT  GE  R    F + P  + +     S +  MP     A    
Sbjct: 617 --------------RGTWKGELTRSVFLFKSFPISVVMR--HWSRAMGMPSAGGRAAYIA 660

Query: 700 WIQYSATMALAGIGVAS--IKALLRGEDPS------LPEVIYDGTLANGALLPYMDRLTK 751
               S TM    +G  S  I  L+ G +P       + +   +  L  G    Y D L  
Sbjct: 661 TFLASTTM----LGALSMQITDLINGRNPKEMTGDHMVKFWINAFLKGGGAGLYGDFLFS 716

Query: 752 LVSKGDRAAIGGLLGPVPSMVTNLTSSA----VELATKDNENSKVNATKAIRKTLPFMNM 807
             ++    A+  +LGPV  +V ++   A    +      NE +  +  K  +  +P  N+
Sbjct: 717 DHTRYGSGALASMLGPVAGLVDDVVKIAQGIPLNAVEGKNEQTGGDLVKLGKGLMPGANL 776

Query: 808 WYLKNSFDHLILNQILEELNPGYLDRQQSKKKKK 841
           WYLK + DH+I NQ+ E  +PGYL + + + KK+
Sbjct: 777 WYLKAALDHMIFNQMQEYFSPGYLRKMEQRSKKE 810


>gi|332344341|gb|AEE57675.1| conserved hypothetical protein [Escherichia coli UMNK88]
          Length = 824

 Score =  158 bits (399), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 206/873 (23%), Positives = 366/873 (41%), Gaps = 96/873 (10%)

Query: 1   MKPECIQVLNKAAGRELSKKELRRLEDGIVRAYVS------LDGKGLSKAER-YRLAGLK 53
           M+ ECIQ + +AA R L+ +E++ +ED I R   S      +  + LS++ER YR A L 
Sbjct: 1   MRQECIQAVQQAAQRTLTAREIQNIEDRIYRNMRSIARDDPMSWRQLSESERLYRAAQLA 60

Query: 54  AEEDFQKELIRSVNDAIDEAYKRHQLRSDLDRVQAGVYGKSQALFNKLFFKAG--SAEVP 111
           +EE  ++  ++    A+  A  R +L   ++  Q G  GK  AL   + F A   S  + 
Sbjct: 61  SEELQREAALKKRRVALTIA-ARQRLDKFINSYQ-GADGKLGALNRTIAFNADGKSNFLS 118

Query: 112 LEMKIKAAETKVLSKFNE-YAEVGSKNLGFTLDKQFGLDVFDEMKGKKTQNEQASRLVKQ 170
           +E + KA     LS+  E +  V  +  G   D+    D+  EM+G+ T N +A +  K 
Sbjct: 119 VESRTKATRDYALSQLQEAFEAVDPRFFGLFEDEAGVRDLVYEMRGQNTGNAKARKGAKA 178

Query: 171 YFETQRELHSQAHEAGLDYKFFENR-IPQPMSVDKLRATKKDDFVRSMLDWLDLSRYKDI 229
           + E    L  + ++AG D  + EN  IPQ  S++K+ A  KD +V  ++  LD   Y   
Sbjct: 179 WREVTELLRRRFNDAGGDIGYLENWGIPQHHSMEKVGAVSKDKWVSDVIGKLDRKYYIRA 238

Query: 230 DGTPLSRSEIASFVGEVFAERVRS--TSFKDPSIPSSEVGVKR-EFERVFHFKDSQAHMD 286
           DG  ++ +E+++F+GE +            D  +  S     R    R  HFKD+ +++ 
Sbjct: 239 DGQLMNDAELSAFLGEAYNTIATGGLNKLTDTGMRISGARANRGNASRQIHFKDADSYLQ 298

Query: 287 YMEHFGVSTNVNTILTSELASLSKDIVIARELGPNADSFVKQMIVQTIANDQEA--SAGN 344
           Y + +G   ++  I+   L  +SKDI +    GPN D   + ++ Q  A    A  S   
Sbjct: 299 YQQLYG-DRSLWEIMVGHLEGISKDIALVETYGPNPDHVFRSLLDQVKAETATANPSKTG 357

Query: 345 KVLKDWLGRNKLEVRQEAMLQMWEVMRYGETVENTGWANWMAGLRSAAGASMLGQHPIGA 404
           KV        +L  + E +     +    + V N   A W   +R+   AS LG   + +
Sbjct: 358 KV-------ERLANKTENLYNF--ISGKTQPVANPHIARWSDNIRNWLVASRLGSALLSS 408

Query: 405 LLEDG--FISRQMLSRVGIDKEAIQRINKMPLKERMELLSD--VGLYAEGVVAHGRNMME 460
             + G  ++S + ++ + +++    ++  M    R EL      GL  E ++        
Sbjct: 409 FSDLGTMYLSAK-VTNLPMNQLFRNQLEAMDPTNRTELARARRAGLAMESLLGSVNRWAM 467

Query: 461 GSDAFQIGHKLHSKMHKWSGAEYLDKKRISSHALIVYNQIGRMTDTYASLKDL-KADPRL 519
            +    +     + + + SG          ++ + +   +G +      L+ L   D R+
Sbjct: 468 DNMGPSVSRWAATAVMRASGLTAWSDAHKRAYGVTMMGSLGEVVSRTPDLRSLDDYDFRI 527

Query: 520 DPSIKAFFKQLDDTDFTVIKRAKAMSSPDGYLYARTPSTIKNLKDADLRDLARMSDKIAY 579
             S     K + DTD++V K A+     +G     TP +I  + D+ ++ L         
Sbjct: 528 LKS-----KGITDTDWSVWKLAQQEDWGNGNNTMLTPESIMRIPDSAVKHLG-------- 574

Query: 580 HRKKLKNSKTLSPEQRQELQQQLADLERKEINILKDKVSNKMHALVLDNVQTSVRGAMHT 639
                       PE+