RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781202|ref|YP_003065615.1| hypothetical protein CLIBASIA_05545 [Candidatus Liberibacter asiaticus str. psy62] (864 letters) >gnl|CDD|35153 COG5594, COG5594, Uncharacterized integral membrane protein [Function unknown]. Length = 827 Score = 31.4 bits (71), Expect = 1.2 Identities = 22/128 (17%), Positives = 47/128 (36%), Gaps = 3/128 (2%) Query: 487 KRISSHALIVYNQIGRMTDTYASLKDLKADPRLDPSIKAFFKQLDDTDFTVIKRAKAMSS 546 R + + ++ + L ++ R D +K F +L + + + + Sbjct: 190 LRSPLYQQSLLTLQNNLSSRTVLISGLPSELRSDEELKELFDKLKVGEIDSDVLCRDLGT 249 Query: 547 PDGYLYARTPSTIKNLKDADLRDLARMSDKIAYHRKKLKNSKTLSPEQRQELQQQLADLE 606 LY +K L+ A L ++ K H K K S L+P +++E + + Sbjct: 250 LQ-ELYKERDKILKKLEKALNELLNKLLKK--SHLKTNKKSGKLTPSRKKEFEILPEYVP 306 Query: 607 RKEINILK 614 K+ + Sbjct: 307 DKKRPKHR 314 >gnl|CDD|146932 pfam04536, DUF477, Domain of unknown function (DUF477). The function of this presumed domain is unknown. It is found in both eukarya and eubacteria. Length = 124 Score = 29.9 bits (68), Expect = 3.4 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 3/29 (10%) Query: 588 KTLSPEQRQELQQQLADLERK---EINIL 613 LS +R L+Q LA LE+K EI ++ Sbjct: 1 GLLSAAERARLEQALAALEQKTGGEIVVV 29 >gnl|CDD|31701 COG1512, COG1512, Beta-propeller domains of methanol dehydrogenase type [General function prediction only]. Length = 271 Score = 29.5 bits (66), Expect = 4.2 Identities = 13/23 (56%), Positives = 17/23 (73%) Query: 586 NSKTLSPEQRQELQQQLADLERK 608 + TLS +R L+QQLADLE+K Sbjct: 39 LTGTLSAAERGALEQQLADLEQK 61 >gnl|CDD|40025 KOG4828, KOG4828, KOG4828, Uncharacterized conserved protein [Function unknown]. Length = 125 Score = 29.2 bits (65), Expect = 5.4 Identities = 12/53 (22%), Positives = 22/53 (41%), Gaps = 2/53 (3%) Query: 490 SSHALIVYNQIGRMTDTYASLKDLKADPRLDP--SIKAFFKQLDDTDFTVIKR 540 + H L+V Q+G+M Y D+K +P + LD+ + + Sbjct: 32 AKHILLVITQLGKMGTIYNVHFDVKKSEVDNPEFHVSVPIGMLDEPETRSAAQ 84 >gnl|CDD|37602 KOG2391, KOG2391, KOG2391, Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones, Intracellular trafficking, secretion, and vesicular transport]. Length = 365 Score = 28.8 bits (64), Expect = 6.1 Identities = 25/101 (24%), Positives = 45/101 (44%), Gaps = 12/101 (11%) Query: 540 RAKAMSSPDGYLYARTPSTIKNLKDADLRDLARMSDKIAYHRKKLKNSKTLSPEQRQELQ 599 RA +S+ L R ++ L+ A+ L R +++ ++KL ++ L+ Sbjct: 208 RASVISAVREKLRRRREEEMERLQ-AEQESLKRTEEELNIGKQKLV-------AMKETLE 259 Query: 600 QQLADLERKEINILKDKVS---NKMHALVLDNVQTSVRGAM 637 QQL L+ K I+ILK KV K L ++ ++ Sbjct: 260 QQLQSLQ-KNIDILKSKVREALEKAENLEALDIDEAIECTA 299 >gnl|CDD|39983 KOG4786, KOG4786, KOG4786, Ubinuclein, nuclear protein interacting with cellular and viral transcription factors [Transcription, Signal transduction mechanisms]. Length = 1136 Score = 28.7 bits (63), Expect = 6.8 Identities = 11/50 (22%), Positives = 20/50 (40%) Query: 224 SRYKDIDGTPLSRSEIASFVGEVFAERVRSTSFKDPSIPSSEVGVKREFE 273 S K +S +I E+ ++ S+S P+ P++ K E Sbjct: 234 SAQKGSTTVTMSAKKICKQQEEIAKQKPSSSSVTPPAAPTASTPKKEEIG 283 >gnl|CDD|145855 pfam02919, Topoisom_I_N, Eukaryotic DNA topoisomerase I, DNA binding fragment. Topoisomerase I promotes the relaxation of DNA superhelical tension by introducing a transient single-stranded break in duplex DNA and are vital for the processes of replication, transcription, and recombination. This family may be more than one structural domain. Length = 215 Score = 28.7 bits (65), Expect = 6.9 Identities = 15/65 (23%), Positives = 29/65 (44%), Gaps = 10/65 (15%) Query: 559 IKNLKDADLRDLARMSDKIAYHRKKLKNSKTLSPEQRQELQQQLADLERK----EINILK 614 IK L+ D + Y + + K +S E+++ L+++ LE ++ K Sbjct: 80 IKELEKCDFTPIY------EYFEAEKEKKKAMSKEEKKALKEEKDKLEEPYGYCLVDGRK 133 Query: 615 DKVSN 619 +KV N Sbjct: 134 EKVGN 138 >gnl|CDD|113842 pfam05087, Rota_VP2, Rotavirus VP2 protein. Rotavirus particles consist of three concentric proteinaceous capsid layers. The innermost capsid (core) is made of VP2. The genomic RNA and the two minor proteins VP1 and VP3 are encapsidated within this layer. The N-terminus of rotavirus VP2 is necessary for the encapsidation of VP1 and VP3. Length = 887 Score = 28.8 bits (64), Expect = 7.7 Identities = 16/58 (27%), Positives = 31/58 (53%), Gaps = 4/58 (6%) Query: 577 IAYHRKKLKNSKTLSPEQRQELQQQLADLERKEINILKDKVSNKMHALVLDNVQTSVR 634 +AY ++ +N++ E+ ++ + Q E KEI LK+KV +K + D+ V+ Sbjct: 1 MAYRNRRRRNTQQKDAEKEKQTENQ----EEKEIKELKEKVKDKKQVVTTDDSPKDVK 54 >gnl|CDD|37339 KOG2128, KOG2128, KOG2128, Ras GTPase-activating protein family - IQGAP [Signal transduction mechanisms]. Length = 1401 Score = 28.4 bits (63), Expect = 7.8 Identities = 8/39 (20%), Positives = 18/39 (46%) Query: 565 ADLRDLARMSDKIAYHRKKLKNSKTLSPEQRQELQQQLA 603 D+R+L R ++ L+ + E+ + L ++L Sbjct: 1225 NDIRNLRRRREERRAELDILQQTLRALCEKNEFLSEKLI 1263 >gnl|CDD|143433 cd07115, ALDH_HMSADH_HapE, Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like. 4-hydroxymuconic semialdehyde dehydrogenase (HapE, EC=1.2.1.61) of Pseudomonas fluorescens ACB involved in 4-hydroxyacetophenone degradation, and putative hydroxycaproate semialdehyde dehydrogenase (ChnE) of Brachymonas petroleovorans involved in cyclohexane metabolism, and other similar sequences, are present in this CD. Length = 453 Score = 28.6 bits (64), Expect = 8.6 Identities = 14/50 (28%), Positives = 21/50 (42%), Gaps = 3/50 (6%) Query: 234 LSRSEIASFVGEVFAERVRSTSFKDPSIPSSEVG---VKREFERVFHFKD 280 L I E F RS DP P +++G + +F+RV + D Sbjct: 267 LVHESIYDEFLERFTSLARSLRPGDPLDPKTQMGPLVSQAQFDRVLDYVD 316 >gnl|CDD|111752 pfam02898, NO_synthase, Nitric oxide synthase, oxygenase domain. Length = 367 Score = 28.2 bits (63), Expect = 9.4 Identities = 10/36 (27%), Positives = 18/36 (50%) Query: 152 DEMKGKKTQNEQASRLVKQYFETQRELHSQAHEAGL 187 D + K+ + A + QY+ + + S+AH A L Sbjct: 1 DTPRPKEELLQHAKDFINQYYSSIKRSKSEAHLARL 36 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.317 0.132 0.372 Gapped Lambda K H 0.267 0.0694 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 9,976,980 Number of extensions: 529467 Number of successful extensions: 1635 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1634 Number of HSP's successfully gapped: 31 Length of query: 864 Length of database: 6,263,737 Length adjustment: 102 Effective length of query: 762 Effective length of database: 4,059,619 Effective search space: 3093429678 Effective search space used: 3093429678 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 62 (27.7 bits)