RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= gi|254781202|ref|YP_003065615.1| hypothetical protein
CLIBASIA_05545 [Candidatus Liberibacter asiaticus str. psy62]
         (864 letters)



>1e32_A P97; membrane fusion; HET: ADP; 2.9A {Mus musculus}
           (A:109-197)
          Length = 89

 Score = 31.6 bits (72), Expect = 0.40
 Identities = 13/56 (23%), Positives = 18/56 (32%)

Query: 733 YDGTLANGALLPYMDRLTKLVSKGDRAAIGGLLGPVPSMVTNLTSSAVELATKDNE 788
             G L    L PY     + + KGD   + G +  V   V     S   +   D  
Sbjct: 18  ITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTV 73


>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase,
           oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces
           coelicolor} (A:163-245)
          Length = 83

 Score = 31.7 bits (72), Expect = 0.41
 Identities = 13/42 (30%), Positives = 18/42 (42%), Gaps = 4/42 (9%)

Query: 202 VDKLRATKKDDFVRSMLDWLDLSRYKDIDGTPLSRSEIASFV 243
           +   RAT  DD    M   L  +R  + DG  LS  E+   +
Sbjct: 37  IAAKRATPGDD----MTSLLIAARDDEGDGDRLSPEELRDTL 74


>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural
           genomics, PSI-2, protein structure initiative; 2.00A
           {Listeria monocytogenes} (A:1-219,A:425-464)
          Length = 259

 Score = 29.6 bits (65), Expect = 1.7
 Identities = 12/49 (24%), Positives = 22/49 (44%)

Query: 561 NLKDADLRDLARMSDKIAYHRKKLKNSKTLSPEQRQELQQQLADLERKE 609
           +L+D DLR +  + + I    K  K    +S +Q   + + +AD     
Sbjct: 2   SLEDKDLRSIQEVRNLIESANKAQKELAAMSQQQIDTIVKAIADAGYGA 50


>2hwj_A AGR_C_2837P, hypothetical protein ATU1540; structural
           genomics, PSI-2, protein structure initiative; 2.61A
           {Agrobacterium tumefaciens str} (A:)
          Length = 205

 Score = 29.0 bits (65), Expect = 2.5
 Identities = 22/128 (17%), Positives = 38/128 (29%), Gaps = 21/128 (16%)

Query: 471 LHSKMHKWSG------AEYLDKKRISSHALIVYNQIGR--MTD---TYASLKDLKADPRL 519
           +  K  +W         ++L    +     +V     R  + D      +L        +
Sbjct: 29  VELKRKEWRETRKKDGDDFLGNHIVP----VVAGPKDRAYLIDHHHLVLALSKEG-VEHV 83

Query: 520 DPSIKAFFKQLDDTDFTVIKRAKAMSSPDGYLYAR-----TPSTIKNLKDADLRDLARMS 574
             S  A F  L   +F  +   + +  P      R      P  I +L+D   R LA   
Sbjct: 84  LTSEVAKFSHLGKDEFWSVXDHRNLIYPFDAQGLRRQSGDIPKNIHDLEDDPFRSLAGAL 143

Query: 575 DKIAYHRK 582
                + K
Sbjct: 144 RXAGGYAK 151


>2kpt_A Putative secreted protein; methods development, alpha/beta,
           structural genomics, PSI-2, protein structure
           initiative; NMR {Corynebacterium glutamicum} (A:)
          Length = 148

 Score = 29.1 bits (65), Expect = 2.6
 Identities = 6/61 (9%), Positives = 14/61 (22%), Gaps = 8/61 (13%)

Query: 588 KTLSPEQRQELQQQLADLERKEINILKDKVSNKMHALVLDNVQTSVRGAMHTSLFDRQRL 647
             +S      +Q  + D++  E           +  + L +                   
Sbjct: 22  GQISSSDITNIQAAIDDVKASE--------QKVIFVVFLSSFDGVDPETWTQQALQANGG 73

Query: 648 G 648
           G
Sbjct: 74  G 74


>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc
           target T1583, PSI, protein structure initiative; 2.46A
           {Deinococcus radiodurans} (A:1-26,A:140-246)
          Length = 133

 Score = 28.1 bits (62), Expect = 4.8
 Identities = 14/64 (21%), Positives = 23/64 (35%), Gaps = 7/64 (10%)

Query: 454 HGRNMMEGSDAFQIGHKLHSKMHKWSGAEYLDKKRISSHALIVYNQIGRMTDTYASLKDL 513
           HG  M+EG   +++          +      D   + +H    Y  +GR    Y   KD+
Sbjct: 75  HGLLMLEGEGLYKLEEN-------YYPVTAGDIIWMGAHCPQWYGALGRNWSKYLLYKDM 127

Query: 514 KADP 517
              P
Sbjct: 128 NRHP 131


>2oeg_A UTP-glucose-1-phosphate uridylyltransferase 2, putative;
           rossmann-fold, beta-helix, pyrophosphorylase; HET: UPG;
           2.30A {Leishmania major} PDB: 2oef_A* (A:1-408)
          Length = 408

 Score = 28.1 bits (62), Expect = 5.3
 Identities = 1/39 (2%), Positives = 8/39 (20%), Gaps = 1/39 (2%)

Query: 584 LKNSKTLSPEQRQELQQQLADLERKEIN-ILKDKVSNKM 621
              S       ++    ++ +   +            + 
Sbjct: 6   KSLSAAAQACVKKXRDAKVNEACIRTFIAQHVXVSKGET 44


>2qpt_A EH domain-containing protein-2; protein-nucleotide complex,
           membrane protein, endocytosis; HET: ANP; 3.10A {Mus
           musculus} (A:1-57,A:295-432)
          Length = 195

 Score = 27.5 bits (61), Expect = 6.6
 Identities = 28/145 (19%), Positives = 49/145 (33%), Gaps = 33/145 (22%)

Query: 433 PLKERMELLSDVGLYAEGVVAHGRNMMEGSDAFQIGHKLHSKMHKWSGAEYLDKKRISSH 492
            L   +  L+D+   A  V  H         A+ I + L  +M    G E   KK++   
Sbjct: 56  ALHAALRKLNDLVKRARLVRVH---------AYIISY-LKKEMPTVFGKENK-KKQLILK 104

Query: 493 ALIVYNQIGRMTDTYASLKDLKADPRLDPSIKAFFKQLDDTDFTVIKRAKAMSSPDGYLY 552
             +++ +I        S  D        P  +   + L   DFT     K          
Sbjct: 105 LPVIFAKIQLEHHI--SPGDF-------PDCQKMQELLMAHDFTKFHSLK---------- 145

Query: 553 ARTPSTIKNLKDADLRDLARMSDKI 577
              P  ++ L D   +D+A++   +
Sbjct: 146 ---PKLLEALDDMLAQDIAKLMPLL 167


>1cb8_A Protein (chondroitinase AC); lyase, chondroitin degradation;
           HET: MAN RAM GCU MFU; 1.90A {Flavobacterium heparinum}
           (A:1-187)
          Length = 187

 Score = 27.6 bits (61), Expect = 6.8
 Identities = 11/61 (18%), Positives = 17/61 (27%), Gaps = 1/61 (1%)

Query: 477 KWSGAEYLDKKRISSHALIVYNQIGRMTDTYASLK-DLKADPRLDPSIKAFFKQLDDTDF 535
            W    Y D    +        Q+  +   Y         D ++   I   FK   D+D 
Sbjct: 40  SWKDVPYKDDAMTNWLPNNHLLQLETIIQAYIEKDSHYYGDDKVFDQISKAFKYWYDSDP 99

Query: 536 T 536
            
Sbjct: 100 K 100


>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC,
           macrolide monooxygenase, antibiotic biosynthesis, heme,
           iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces
           venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A*
           2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* (A:170-263)
          Length = 94

 Score = 27.1 bits (60), Expect = 8.6
 Identities = 9/42 (21%), Positives = 18/42 (42%), Gaps = 6/42 (14%)

Query: 202 VDKLRATKKDDFVRSMLDWLDLSRYKDIDGTPLSRSEIASFV 243
           +D  R    +D + +++      R  D DG+ L+  E+    
Sbjct: 53  IDSKRGQDGEDLLSALV------RTSDEDGSRLTSEELLGMA 88


>1sa3_A Type II restriction enzyme MSPI; protein-DNA complex,
           hydrolase/DNA complex; 1.95A {Moraxella SP}
           (A:1-124,A:195-239)
          Length = 169

 Score = 26.9 bits (59), Expect = 9.4
 Identities = 18/61 (29%), Positives = 28/61 (45%)

Query: 55  EEDFQKELIRSVNDAIDEAYKRHQLRSDLDRVQAGVYGKSQALFNKLFFKAGSAEVPLEM 114
           E+D   +L++++N  +D         +DL R  AG   K+ A     F    S  VPL +
Sbjct: 59  EKDISSKLLKALNLDLDNIIDVSSSDTDLGRTIAGGSPKTDATIRFTFHNQSSRLVPLNI 118

Query: 115 K 115
           K
Sbjct: 119 K 119


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.317    0.132    0.372 

Gapped
Lambda     K      H
   0.267   0.0420    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 6,264,747
Number of extensions: 285853
Number of successful extensions: 1115
Number of sequences better than 10.0: 1
Number of HSP's gapped: 1115
Number of HSP's successfully gapped: 30
Length of query: 864
Length of database: 4,956,049
Length adjustment: 96
Effective length of query: 768
Effective length of database: 1,710,769
Effective search space: 1313870592
Effective search space used: 1313870592
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)