BLAST/PSIBLAST alignment of GI: 254781203 and GI: 268589386 at iteration 1
>gi|268589386|ref|ZP_06123607.1| conserved hypothetical protein [Providencia rettgeri DSM 1131] Length = 594
>gi|291315413|gb|EFE55866.1| conserved hypothetical protein [Providencia rettgeri DSM 1131] Length = 594
 Score = 65.9 bits (159), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 68/266 (25%), Positives = 111/266 (41%), Gaps = 45/266 (16%)

Query: 11  IRDNIKEWAQRPRVSPDIKW--------HTGLGKEVINMPARSL----DKLVAPFREETH 58
           I   + +  Q P  S D  +        +TGL   +I  P + L    D +V+P   E +
Sbjct: 11  INQQLDDAMQSPENSGDADFFDGAFTSTYTGLYSGLIAKPEQVLWGIADTVVSPIAREVN 70

Query: 59  DQPNYYRGSRTDPHSVGTGAHLVEGLTSLAPYIAGAALAGKLL-SFIPTPLTRLAGLALQ 117
           +Q +    S          A   + + SL P  A    AG+++ S        L G A+ 
Sbjct: 71  EQFDINDTSEQFIQEQRKNAE--KQVRSLTPDRATTGTAGQVMFSLFDIGGEALTG-AMI 127

Query: 118 SAPLAAGALYAYLSHKAESSIHHQIEGVDKETADALAWREAIVHTSALLAP-------GA 170
             PL    L   +   ++     + +GVDK TA   A  E +     +L P       G 
Sbjct: 128 GGPLGGAMLVGGVQGFSDYE-KLRADGVDKNTAINKATGEGLFAGLGVLTPMTLGFKGGG 186

Query: 171 IASQSI-AKTVASGAVL--------------------NVPFGMVERGWSSKVLEDHGYPD 209
           I ++SI A+  A G  L                    N+  GM +RG++S++L++ GY  
Sbjct: 187 ILAESIGAQFTARGGTLSSLAGTAARATPDIVYASGSNIAMGMAQRGFASQILKERGYNQ 246

Query: 210 MAQHYRIFDMESLITDGLIGAFFGGM 235
           +A  Y ++D +++  DG++G  FGGM
Sbjct: 247 LASQYDVYDKQAIAIDGVLGVAFGGM 272