RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781204|ref|YP_003065617.1| hypothetical protein CLIBASIA_05555 [Candidatus Liberibacter asiaticus str. psy62] (707 letters) >gnl|CDD|37291 KOG2080, KOG2080, KOG2080, Uncharacterized conserved protein, contains DENN and RUN domains [Signal transduction mechanisms]. Length = 1295 Score = 31.2 bits (70), Expect = 0.91 Identities = 19/99 (19%), Positives = 38/99 (38%), Gaps = 1/99 (1%) Query: 374 NPSLSLASTMMATKYKEILEKSHRQSMQELNQDAISWGIKYKQIDPLRFDTEESFADSLR 433 +PSL +T + K I +K+ R ++++ +A+ GI + I +T + L Sbjct: 761 SPSLIAQATFVEELLKNIEKKTKRMLLEKMGTEAVRLGITHPSIARAEENTLIASGCDLL 820 Query: 434 QRA-GFVKKIKDDYNLTTSHFNKTEENQLRTQLVKRPAS 471 ++ +IK + H N V+ Sbjct: 821 EKIWSHGLQIKQGKSALWGHLQTYVSNLGGYASVEGSPR 859 >gnl|CDD|31397 COG1204, COG1204, Superfamily II helicase [General function prediction only]. Length = 766 Score = 31.1 bits (70), Expect = 0.98 Identities = 19/72 (26%), Positives = 28/72 (38%), Gaps = 5/72 (6%) Query: 640 KDTGEYDPY-TIKYMNVGSGKYMIIKNGNPKVDKEGKTIIINVEDVNRDERMESTIRH-- 696 KDT YDP I + V M + G P D G+ II+ + E I+ Sbjct: 364 KDTRRYDPKGGIVDIPVLDVLQMAGRAGRPGYDDYGEAIILATSHDELEYLAELYIQSEP 423 Query: 697 --YEHQIFNEHA 706 E ++ +E Sbjct: 424 EPIESKLGDELN 435 >gnl|CDD|33628 COG3836, HpcH, 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase [Carbohydrate transport and metabolism]. Length = 255 Score = 31.4 bits (71), Expect = 1.0 Identities = 37/127 (29%), Positives = 51/127 (40%), Gaps = 26/127 (20%) Query: 9 PLVEAVTPNQDAVRDSVNPQAGLRDLGDALGKATQFLEGIRRDNAFATANTRYTELSFKA 68 P+V+ + AV + P G R +G AL +A++F R + A AN L Sbjct: 96 PMVDTAEQARQAVAATRYPPLGERGVGSALARASRF---GRIADYLAQANDEICLL---- 148 Query: 69 VQDFHDFTNSLDTRDSLQAGDKIK--EYVDGRIRSAYD-----RFLSSISHRDVRKKFQA 121 VQ ++TR L D I E VDG D L + H +V QA Sbjct: 149 VQ--------IETRAGLDNLDAIAAVEGVDGVFIGPADLAASLGHLGNPGHPEV----QA 196 Query: 122 QVEHDIR 128 +EH I Sbjct: 197 AIEHIIA 203 >gnl|CDD|143432 cd07114, ALDH_DhaS, Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like. Uncharacterized aldehyde dehydrogenase from Candidatus pelagibacter (DhaS) and other related sequences are present in this CD. Length = 457 Score = 31.0 bits (71), Expect = 1.1 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 24/70 (34%) Query: 254 EDVSKAIGLA-------GWDRLDDTKRRRLL--------EH------LSSRDNALNTKLR 292 DV +A+ A W +L T+R +LL + L +RDN KL Sbjct: 19 ADVDRAVAAARAAFEGGAWRKLTPTERGKLLRRLADLIEANAEELAELETRDNG---KLI 75 Query: 293 KETQAQARRI 302 +ET+AQ R + Sbjct: 76 RETRAQVRYL 85 >gnl|CDD|145172 pfam01866, Diphthamide_syn, Putative diphthamide synthesis protein. Human DPHL2 is a candidate tumour suppressor gene. DPH2 from yeast, which confers resistance to diphtheria toxin has been found to be involved in diphthamide synthesis. Diphtheria toxin inhibits eukaryotic protein synthesis by ADP-ribosylating diphthamide, a posttranslationally modified histidine residue present in EF2. The exact function of the members of this family is unknown. Length = 300 Score = 29.1 bits (66), Expect = 3.8 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Query: 407 AISWGIKYKQIDPLRFDTEESFADS-LRQRAGFVKKIKD 444 A++ G + DP + EE AD LR+R ++K +D Sbjct: 164 ALATGKPVYRYDPYSGEVEEYDADKMLRRRYAAIEKARD 202 >gnl|CDD|145835 pfam02887, PK_C, Pyruvate kinase, alpha/beta domain. As well as being found in pyruvate kinase this family is found as an isolated domain in some bacterial proteins. Length = 117 Score = 29.0 bits (66), Expect = 4.8 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Query: 403 LNQDAISWGIKYKQIDPLRFDTEESFADSLR--QRAGFVKK 441 + A+ WG+ D T+E A++LR + AG +KK Sbjct: 52 ARRLALYWGVHPVLGDERSISTDEIIAEALRVAKDAGLIKK 92 >gnl|CDD|37711 KOG2500, KOG2500, KOG2500, Uncharacterized conserved protein [Function unknown]. Length = 253 Score = 28.8 bits (64), Expect = 5.2 Identities = 11/31 (35%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Query: 668 PKVD---KEGKTIIINVEDVNRDERMESTIR 695 P +D KEG+TI IN++++ + + S R Sbjct: 146 PSLDLGFKEGETIKINIKNITKKKGAASWPR 176 >gnl|CDD|109451 pfam00393, 6PGD, 6-phosphogluconate dehydrogenase, C-terminal domain. This family represents the C-terminal all-alpha domain of 6-phosphogluconate dehydrogenase. The domain contains two structural repeats of 5 helices each. Length = 290 Score = 28.7 bits (65), Expect = 5.7 Identities = 15/51 (29%), Positives = 27/51 (52%), Gaps = 3/51 (5%) Query: 362 KFLQKIDDEYISNPSLSLASTMMATKYKEILEKSHRQSMQELNQDAISWGI 412 +FL KI D Y NP L + ++ +K+ +++ QS + + A+ GI Sbjct: 192 QFLDKIKDAYEKNP--DLPNLLLDPYFKKEIKEYQ-QSWRRVVAIAVEAGI 239 >gnl|CDD|30711 COG0362, Gnd, 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism]. Length = 473 Score = 28.6 bits (64), Expect = 6.0 Identities = 26/74 (35%), Positives = 39/74 (52%), Gaps = 10/74 (13%) Query: 362 KFLQKIDDEYISNPSLSLASTMMATKYKEILEKSHRQSMQELNQDAISWGIKYKQIDPL- 420 KFL KI D + NP LA+ ++A +K ILE+ QS++ + A+ GI P+ Sbjct: 370 KFLDKITDAFDENP--ELANLLLAPYFKSILEEYQ-QSLRRVVAYAVEAGI------PVP 420 Query: 421 RFDTEESFADSLRQ 434 F + S+ DS R Sbjct: 421 AFSSALSYYDSYRT 434 >gnl|CDD|133279 cd01878, HflX, HflX subfamily. A distinct conserved domain with a glycine-rich segment N-terminal of the GTPase domain characterizes the HflX subfamily. The E. coli HflX has been implicated in the control of the lambda cII repressor proteolysis, but the actual biological functions of these GTPases remain unclear. HflX is widespread, but not universally represented in all three superkingdoms. Length = 204 Score = 28.6 bits (65), Expect = 6.5 Identities = 16/49 (32%), Positives = 19/49 (38%), Gaps = 9/49 (18%) Query: 240 DVSDSARERSLEVVEDVSKAIGLAG---------WDRLDDTKRRRLLEH 279 D SD E +E VE V K +G D LDD + LE Sbjct: 129 DASDPDYEEQIETVEKVLKELGAEDIPMILVLNKIDLLDDEELEERLEA 177 >gnl|CDD|38017 KOG2806, KOG2806, KOG2806, Chitinase [Carbohydrate transport and metabolism]. Length = 432 Score = 27.8 bits (61), Expect = 9.8 Identities = 14/41 (34%), Positives = 18/41 (43%) Query: 97 GRIRSAYDRFLSSISHRDVRKKFQAQVEHDIRDYHTKGVDI 137 G F +S R +R KF V I+DY GVD+ Sbjct: 129 GGSHGNSGLFSLVLSDRMIRAKFIESVVSFIKDYGFDGVDL 169 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.314 0.130 0.361 Gapped Lambda K H 0.267 0.0649 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 7,977,608 Number of extensions: 413230 Number of successful extensions: 822 Number of sequences better than 10.0: 1 Number of HSP's gapped: 821 Number of HSP's successfully gapped: 24 Length of query: 707 Length of database: 6,263,737 Length adjustment: 101 Effective length of query: 606 Effective length of database: 4,081,228 Effective search space: 2473224168 Effective search space used: 2473224168 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 61 (27.4 bits)