BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781205|ref|YP_003065618.1| hypothetical protein CLIBASIA_05560 [Candidatus Liberibacter asiaticus str. psy62] (171 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781205|ref|YP_003065618.1| hypothetical protein CLIBASIA_05560 [Candidatus Liberibacter asiaticus str. psy62] Length = 171 Score = 346 bits (888), Expect = 1e-97, Method: Compositional matrix adjust. Identities = 171/171 (100%), Positives = 171/171 (100%) Query: 1 MSIGMDDLLYGLSLASPLVGAGLRISSTLASHRSSIRDHEYRSLLAEENALRADVLYLDR 60 MSIGMDDLLYGLSLASPLVGAGLRISSTLASHRSSIRDHEYRSLLAEENALRADVLYLDR Sbjct: 1 MSIGMDDLLYGLSLASPLVGAGLRISSTLASHRSSIRDHEYRSLLAEENALRADVLYLDR 60 Query: 61 EDQARREGIMDTGVFRMKAVLSGVSGASLDLLVGQNTRNAYKGINTARTAREQTVARFAK 120 EDQARREGIMDTGVFRMKAVLSGVSGASLDLLVGQNTRNAYKGINTARTAREQTVARFAK Sbjct: 61 EDQARREGIMDTGVFRMKAVLSGVSGASLDLLVGQNTRNAYKGINTARTAREQTVARFAK 120 Query: 121 EAGWHRANKEAVKNNRWASVAAIAGPPMVESASSAGMKMFRRYNVKGKDAS 171 EAGWHRANKEAVKNNRWASVAAIAGPPMVESASSAGMKMFRRYNVKGKDAS Sbjct: 121 EAGWHRANKEAVKNNRWASVAAIAGPPMVESASSAGMKMFRRYNVKGKDAS 171 >gi|254780143|ref|YP_003064556.1| DNA-directed RNA polymerase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 1386 Score = 23.1 bits (48), Expect = 3.1, Method: Composition-based stats. Identities = 24/121 (19%), Positives = 49/121 (40%), Gaps = 23/121 (19%) Query: 23 LRISSTLASHRSSIR-------DHEYRSLLAEENALRADVLYLDREDQARREGIMDTGVF 75 LR+ S ++ +R D RS+ E + ++L D++D+ + I+D ++ Sbjct: 929 LRVPSGVSGTVVDVRIFNRHGIDKNERSISVEREQI--ELLARDKDDE---QVILDRNIY 983 Query: 76 RMKAVLSGVSGASLDLLVGQNTRNAYKGINTARTAREQTVARFAKEAGWHRA-NKEAVKN 134 +++L GQN + KG + ++ + + W A E V+ Sbjct: 984 ----------SRLMEILCGQNAVSGPKGFKKSTVLSSDLISEYPRSQWWQFAVQDEKVQR 1033 Query: 135 N 135 N Sbjct: 1034 N 1034 >gi|254780187|ref|YP_003064600.1| 30S ribosomal protein S4 [Candidatus Liberibacter asiaticus str. psy62] Length = 206 Score = 21.9 bits (45), Expect = 5.9, Method: Compositional matrix adjust. Identities = 17/66 (25%), Positives = 28/66 (42%), Gaps = 13/66 (19%) Query: 20 GAGLRISSTLASHRSSIRDHEYRSLLAEENALRAD-----VLYLDREDQARREGIMDTGV 74 G LR + + I + ++RS+ E + R D + +L E +DT V Sbjct: 49 GLQLRAKQKMKKYYGDISEKKFRSIFKEADRSRGDTSHNLISFL--------ESRLDTIV 100 Query: 75 FRMKAV 80 +R K V Sbjct: 101 YRAKFV 106 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.316 0.129 0.357 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,339 Number of Sequences: 1233 Number of extensions: 3131 Number of successful extensions: 10 Number of sequences better than 100.0: 3 Number of HSP's better than 100.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 3 length of query: 171 length of database: 328,796 effective HSP length: 68 effective length of query: 103 effective length of database: 244,952 effective search space: 25230056 effective search space used: 25230056 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 35 (18.1 bits)