BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781206|ref|YP_003065619.1| hypothetical protein
CLIBASIA_05565 [Candidatus Liberibacter asiaticus str. psy62]
         (1246 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|317120672|gb|ADV02495.1| hypothetical protein SC1_gp060 [Liberibacter phage SC1]
 gi|317120816|gb|ADV02637.1| hypothetical protein SC1_gp060 [Candidatus Liberibacter asiaticus]
          Length = 1340

 Score = 2616 bits (6781), Expect = 0.0,   Method: Composition-based stats.
 Identities = 1246/1246 (100%), Positives = 1246/1246 (100%)

Query: 1    MNELATSIDYQTNNLDQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYI 60
            MNELATSIDYQTNNLDQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYI
Sbjct: 95   MNELATSIDYQTNNLDQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYI 154

Query: 61   VGPIEQRLKKVSERYERVVSRDLTLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLL 120
            VGPIEQRLKKVSERYERVVSRDLTLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLL
Sbjct: 155  VGPIEQRLKKVSERYERVVSRDLTLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLL 214

Query: 121  CRFMDMVETEDEHKINKQVRDALESAGFDLESTQENIRKVESALINNNMKDAFRFLELAQ 180
            CRFMDMVETEDEHKINKQVRDALESAGFDLESTQENIRKVESALINNNMKDAFRFLELAQ
Sbjct: 215  CRFMDMVETEDEHKINKQVRDALESAGFDLESTQENIRKVESALINNNMKDAFRFLELAQ 274

Query: 181  KSKETADSHIIEAIDVGTKLKENTPPTTFTSISKVLLKSNNMQDVVFTKIKEVVKKHVNA 240
            KSKETADSHIIEAIDVGTKLKENTPPTTFTSISKVLLKSNNMQDVVFTKIKEVVKKHVNA
Sbjct: 275  KSKETADSHIIEAIDVGTKLKENTPPTTFTSISKVLLKSNNMQDVVFTKIKEVVKKHVNA 334

Query: 241  ELGHRKLRGLAFDHTYFNDKLNQFLKEIKNHQKEYDESEKGSSKARYHAAYAHIYWDLAN 300
            ELGHRKLRGLAFDHTYFNDKLNQFLKEIKNHQKEYDESEKGSSKARYHAAYAHIYWDLAN
Sbjct: 335  ELGHRKLRGLAFDHTYFNDKLNQFLKEIKNHQKEYDESEKGSSKARYHAAYAHIYWDLAN 394

Query: 301  DWVNGRVGDKSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAE 360
            DWVNGRVGDKSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAE
Sbjct: 395  DWVNGRVGDKSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAE 454

Query: 361  IRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKAD 420
            IRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKAD
Sbjct: 455  IRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKAD 514

Query: 421  KEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKG 480
            KEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKG
Sbjct: 515  KEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKG 574

Query: 481  KEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQ 540
            KEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQ
Sbjct: 575  KEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQ 634

Query: 541  DQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDS 600
            DQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDS
Sbjct: 635  DQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDS 694

Query: 601  YKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNF 660
            YKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNF
Sbjct: 695  YKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNF 754

Query: 661  LSQWSPLGLMYEKDELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGESSVRK 720
            LSQWSPLGLMYEKDELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGESSVRK
Sbjct: 755  LSQWSPLGLMYEKDELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGESSVRK 814

Query: 721  HSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKEDPKRGKSESYLSDIRSELQKVNKTVM 780
            HSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKEDPKRGKSESYLSDIRSELQKVNKTVM
Sbjct: 815  HSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKEDPKRGKSESYLSDIRSELQKVNKTVM 874

Query: 781  DIRIKLRLYGIFQDIPQEQPPLYTIISGSEKILQGDYTFPPLSSLDVQSKFDSSYSKLFE 840
            DIRIKLRLYGIFQDIPQEQPPLYTIISGSEKILQGDYTFPPLSSLDVQSKFDSSYSKLFE
Sbjct: 875  DIRIKLRLYGIFQDIPQEQPPLYTIISGSEKILQGDYTFPPLSSLDVQSKFDSSYSKLFE 934

Query: 841  IFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQL 900
            IFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQL
Sbjct: 935  IFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQL 994

Query: 901  SRAKKYKESNDERIVSFIRSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQ 960
            SRAKKYKESNDERIVSFIRSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQ
Sbjct: 995  SRAKKYKESNDERIVSFIRSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQ 1054

Query: 961  LSSRLKELNIDNAYGLWNEYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQ 1020
            LSSRLKELNIDNAYGLWNEYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQ
Sbjct: 1055 LSSRLKELNIDNAYGLWNEYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQ 1114

Query: 1021 KAGGDPSLMMDYEKVEPSDVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSY 1080
            KAGGDPSLMMDYEKVEPSDVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSY
Sbjct: 1115 KAGGDPSLMMDYEKVEPSDVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSY 1174

Query: 1081 VNPKRMHADTESDIYFEEFKRSLSSWEDEPRIEVERDATLPRLAKDDGSKEDEYEGGANE 1140
            VNPKRMHADTESDIYFEEFKRSLSSWEDEPRIEVERDATLPRLAKDDGSKEDEYEGGANE
Sbjct: 1175 VNPKRMHADTESDIYFEEFKRSLSSWEDEPRIEVERDATLPRLAKDDGSKEDEYEGGANE 1234

Query: 1141 RYVCIPSMDTSESFNSTMGKKRRIFKVVVRVINTADLEVGILGFPIVPVEELRGKPKTGE 1200
            RYVCIPSMDTSESFNSTMGKKRRIFKVVVRVINTADLEVGILGFPIVPVEELRGKPKTGE
Sbjct: 1235 RYVCIPSMDTSESFNSTMGKKRRIFKVVVRVINTADLEVGILGFPIVPVEELRGKPKTGE 1294

Query: 1201 FEVLVPSDASLNPEIIIRQKTGGYFCLTSITAHTQFEGERYEHRHG 1246
            FEVLVPSDASLNPEIIIRQKTGGYFCLTSITAHTQFEGERYEHRHG
Sbjct: 1295 FEVLVPSDASLNPEIIIRQKTGGYFCLTSITAHTQFEGERYEHRHG 1340


>gi|254781206|ref|YP_003065619.1| hypothetical protein CLIBASIA_05565 [Candidatus Liberibacter
            asiaticus str. psy62]
 gi|254040883|gb|ACT57679.1| hypothetical protein CLIBASIA_05565 [Candidatus Liberibacter
            asiaticus str. psy62]
          Length = 1246

 Score = 2602 bits (6744), Expect = 0.0,   Method: Composition-based stats.
 Identities = 1246/1246 (100%), Positives = 1246/1246 (100%)

Query: 1    MNELATSIDYQTNNLDQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYI 60
            MNELATSIDYQTNNLDQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYI
Sbjct: 1    MNELATSIDYQTNNLDQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYI 60

Query: 61   VGPIEQRLKKVSERYERVVSRDLTLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLL 120
            VGPIEQRLKKVSERYERVVSRDLTLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLL
Sbjct: 61   VGPIEQRLKKVSERYERVVSRDLTLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLL 120

Query: 121  CRFMDMVETEDEHKINKQVRDALESAGFDLESTQENIRKVESALINNNMKDAFRFLELAQ 180
            CRFMDMVETEDEHKINKQVRDALESAGFDLESTQENIRKVESALINNNMKDAFRFLELAQ
Sbjct: 121  CRFMDMVETEDEHKINKQVRDALESAGFDLESTQENIRKVESALINNNMKDAFRFLELAQ 180

Query: 181  KSKETADSHIIEAIDVGTKLKENTPPTTFTSISKVLLKSNNMQDVVFTKIKEVVKKHVNA 240
            KSKETADSHIIEAIDVGTKLKENTPPTTFTSISKVLLKSNNMQDVVFTKIKEVVKKHVNA
Sbjct: 181  KSKETADSHIIEAIDVGTKLKENTPPTTFTSISKVLLKSNNMQDVVFTKIKEVVKKHVNA 240

Query: 241  ELGHRKLRGLAFDHTYFNDKLNQFLKEIKNHQKEYDESEKGSSKARYHAAYAHIYWDLAN 300
            ELGHRKLRGLAFDHTYFNDKLNQFLKEIKNHQKEYDESEKGSSKARYHAAYAHIYWDLAN
Sbjct: 241  ELGHRKLRGLAFDHTYFNDKLNQFLKEIKNHQKEYDESEKGSSKARYHAAYAHIYWDLAN 300

Query: 301  DWVNGRVGDKSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAE 360
            DWVNGRVGDKSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAE
Sbjct: 301  DWVNGRVGDKSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAE 360

Query: 361  IRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKAD 420
            IRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKAD
Sbjct: 361  IRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKAD 420

Query: 421  KEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKG 480
            KEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKG
Sbjct: 421  KEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKG 480

Query: 481  KEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQ 540
            KEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQ
Sbjct: 481  KEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQ 540

Query: 541  DQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDS 600
            DQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDS
Sbjct: 541  DQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDS 600

Query: 601  YKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNF 660
            YKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNF
Sbjct: 601  YKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNF 660

Query: 661  LSQWSPLGLMYEKDELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGESSVRK 720
            LSQWSPLGLMYEKDELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGESSVRK
Sbjct: 661  LSQWSPLGLMYEKDELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGESSVRK 720

Query: 721  HSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKEDPKRGKSESYLSDIRSELQKVNKTVM 780
            HSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKEDPKRGKSESYLSDIRSELQKVNKTVM
Sbjct: 721  HSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKEDPKRGKSESYLSDIRSELQKVNKTVM 780

Query: 781  DIRIKLRLYGIFQDIPQEQPPLYTIISGSEKILQGDYTFPPLSSLDVQSKFDSSYSKLFE 840
            DIRIKLRLYGIFQDIPQEQPPLYTIISGSEKILQGDYTFPPLSSLDVQSKFDSSYSKLFE
Sbjct: 781  DIRIKLRLYGIFQDIPQEQPPLYTIISGSEKILQGDYTFPPLSSLDVQSKFDSSYSKLFE 840

Query: 841  IFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQL 900
            IFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQL
Sbjct: 841  IFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQL 900

Query: 901  SRAKKYKESNDERIVSFIRSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQ 960
            SRAKKYKESNDERIVSFIRSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQ
Sbjct: 901  SRAKKYKESNDERIVSFIRSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQ 960

Query: 961  LSSRLKELNIDNAYGLWNEYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQ 1020
            LSSRLKELNIDNAYGLWNEYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQ
Sbjct: 961  LSSRLKELNIDNAYGLWNEYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQ 1020

Query: 1021 KAGGDPSLMMDYEKVEPSDVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSY 1080
            KAGGDPSLMMDYEKVEPSDVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSY
Sbjct: 1021 KAGGDPSLMMDYEKVEPSDVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSY 1080

Query: 1081 VNPKRMHADTESDIYFEEFKRSLSSWEDEPRIEVERDATLPRLAKDDGSKEDEYEGGANE 1140
            VNPKRMHADTESDIYFEEFKRSLSSWEDEPRIEVERDATLPRLAKDDGSKEDEYEGGANE
Sbjct: 1081 VNPKRMHADTESDIYFEEFKRSLSSWEDEPRIEVERDATLPRLAKDDGSKEDEYEGGANE 1140

Query: 1141 RYVCIPSMDTSESFNSTMGKKRRIFKVVVRVINTADLEVGILGFPIVPVEELRGKPKTGE 1200
            RYVCIPSMDTSESFNSTMGKKRRIFKVVVRVINTADLEVGILGFPIVPVEELRGKPKTGE
Sbjct: 1141 RYVCIPSMDTSESFNSTMGKKRRIFKVVVRVINTADLEVGILGFPIVPVEELRGKPKTGE 1200

Query: 1201 FEVLVPSDASLNPEIIIRQKTGGYFCLTSITAHTQFEGERYEHRHG 1246
            FEVLVPSDASLNPEIIIRQKTGGYFCLTSITAHTQFEGERYEHRHG
Sbjct: 1201 FEVLVPSDASLNPEIIIRQKTGGYFCLTSITAHTQFEGERYEHRHG 1246


>gi|315121931|ref|YP_004062420.1| hypothetical protein CKC_00905 [Candidatus Liberibacter solanacearum
            CLso-ZC1]
 gi|315122893|ref|YP_004063382.1| hypothetical protein CKC_05745 [Candidatus Liberibacter solanacearum
            CLso-ZC1]
 gi|313495333|gb|ADR51932.1| hypothetical protein CKC_00905 [Candidatus Liberibacter solanacearum
            CLso-ZC1]
 gi|313496295|gb|ADR52894.1| hypothetical protein CKC_05745 [Candidatus Liberibacter solanacearum
            CLso-ZC1]
          Length = 327

 Score =  105 bits (262), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 74/221 (33%), Positives = 117/221 (52%), Gaps = 21/221 (9%)

Query: 1034 KVEPSDVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSYVNPKRMHADTE-- 1091
            +V+ +D+++   +DL KRF+ L   K   +    P+I     +V   + P       +  
Sbjct: 110  EVDDTDILS---EDLLKRFEKLHEVKHVPEKYSKPRIEADPTKVLKPITPPVPSPQEKVI 166

Query: 1092 SDIYFEEFKRS-------LSSWEDEPRIEV----ERDATLPRLAKDDGSKEDEYEGGANE 1140
             ++  + +K+        L+S +D+  + V     +D  L +     G K   +EG  + 
Sbjct: 167  PEVIDQHYKQEPVEREDYLTSDDDDADVRVYATSRKDGKLVQRLLKQGEKPLAHEG-TSY 225

Query: 1141 RYVCI---PSMDTSESFNSTMGKKRRIFKVVVRVINTADLEVGILGFPIVPVEELRGKPK 1197
             Y CI   P +DT ++FN+  GKK RIFK  ++VINT+D+EVG+ G  + P+EELRG PK
Sbjct: 226  GYDCIVRLPPIDTGDAFNNFSGKKVRIFKGSIKVINTSDIEVGVYGEEMHPIEELRGSPK 285

Query: 1198 TGEFEVLVPSDASLNPEIIIRQK-TGGYFCLTSITAHTQFE 1237
            TGEF   + SDA   PE++I+ K    +F LTS+T H   E
Sbjct: 286  TGEFTFPIYSDAQHLPELVIKHKGESSHFHLTSVTTHFTVE 326


>gi|315122424|ref|YP_004062913.1| hypothetical protein CKC_03380 [Candidatus Liberibacter solanacearum
            CLso-ZC1]
 gi|313495826|gb|ADR52425.1| hypothetical protein CKC_03380 [Candidatus Liberibacter solanacearum
            CLso-ZC1]
          Length = 101

 Score = 99.8 bits (247), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 51/98 (52%), Positives = 63/98 (64%), Gaps = 1/98 (1%)

Query: 1141 RYVCIPSMDTSESFNSTMGKKRRIFKVVVRVINTADLEVGI-LGFPIVPVEELRGKPKTG 1199
            RYV IP +D  E F    GKKRR+FKV +RVINTA+LE+ I      V VE+L+G PK G
Sbjct: 3    RYVTIPRIDIGEPFGGLSGKKRRVFKVSLRVINTANLEIRIGKDNSWVCVEQLQGAPKIG 62

Query: 1200 EFEVLVPSDASLNPEIIIRQKTGGYFCLTSITAHTQFE 1237
            EFEV +     ++ E+ IRQ +   FCLTSITAH   E
Sbjct: 63   EFEVFMQDSCGIDSELTIRQTSPSPFCLTSITAHLATE 100


>gi|328870017|gb|EGG18392.1| hypothetical protein DFA_03886 [Dictyostelium fasciculatum]
          Length = 1814

 Score = 69.4 bits (168), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 61/203 (30%), Positives = 96/203 (47%), Gaps = 15/203 (7%)

Query: 398  NAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVP 457
            N ++EK  ++Q+AKEKAD E+ D+ AKEK+D+ + D+  +EK+  K E D   L      
Sbjct: 1359 NEKKEKAAKDQQAKEKADNEEKDRLAKEKSDKAEQDRIAKEKSD-KEEKDR--LAKEKAA 1415

Query: 458  THSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNET 517
                    KE+ +++ +D  +  KE    E  DR   ER   D  + + +A +   K+E 
Sbjct: 1416 NDEQARIAKEKSVKDEQD--RIAKEKSDKEEQDRVAKERAAND--EQARIAKEKSDKSEQ 1471

Query: 518  PAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQE---QE 574
              I   K   A+  K   DK  QD+  K  A      + + A +   K +KE Q+   +E
Sbjct: 1472 DRIAKEKEEQARLAKEKADKDEQDRLAKEKAD-----KEEQARLAKEKSDKEEQDRIAKE 1526

Query: 575  ENLRVAEIIQQSRMQSEDLQEKA 597
            E  R+A+       Q    +EKA
Sbjct: 1527 EQARIAKEKSDKEEQDRIAKEKA 1549



 Score = 45.5 bits (106), Expect = 0.062,   Method: Composition-based stats.
 Identities = 53/208 (25%), Positives = 88/208 (42%), Gaps = 49/208 (23%)

Query: 369  AETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADR---EKADKE--- 422
            A+ R A    A +A   S+  +   +A+   ++ +  +E+  K++ DR   EKADKE   
Sbjct: 1449 AKERAANDEQARIAKEKSDKSEQDRIAKEKEEQARLAKEKADKDEQDRLAKEKADKEEQA 1508

Query: 423  --AKEKADREKADK-DLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKK 479
              AKEK+D+E+ D+   +E+  I  E  D                 KEE+    K++  K
Sbjct: 1509 RLAKEKSDKEEQDRIAKEEQARIAKEKSD-----------------KEEQDRIAKEKADK 1551

Query: 480  ------GKEPGTTETDDR--EETERKNQDILDNSLLA------------GKTHTKNETPA 519
                   KE    E  DR  +E E KN   L +  L+             +T ++N+ PA
Sbjct: 1552 EEQDRIAKEKSDKEEQDRIAKEEEEKNHQTLKHLTLSRPKKSTTKSTGTTETESENQEPA 1611

Query: 520  I---PTAKAPPAQAHKGIQDKKPQDQRE 544
                PT    P +  + ++ ++P    E
Sbjct: 1612 KVEEPTKVEEPVKVEEPVKVEEPTKVEE 1639


>gi|308457811|ref|XP_003091269.1| hypothetical protein CRE_26828 [Caenorhabditis remanei]
 gi|308257606|gb|EFP01559.1| hypothetical protein CRE_26828 [Caenorhabditis remanei]
          Length = 616

 Score = 59.4 bits (142), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 39/101 (38%), Positives = 54/101 (53%), Gaps = 19/101 (18%)

Query: 402 EKQRREQEAKEKADREKADKE--AKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTH 459
           EK  R++ AKEKAD+EKAD+E  AKEKAD+EKADK+  +K     E  D           
Sbjct: 143 EKAARDKAAKEKADQEKADQERDAKEKADKEKADKEKADKEKSDKEKAD----------- 191

Query: 460 SVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQD 500
                 KE+  +E  D+ K  KE    E  D+E+ +++  D
Sbjct: 192 ------KEKSDKEKADKEKADKEKADKEKADKEKADKEKAD 226



 Score = 55.9 bits (133), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 39/103 (37%), Positives = 53/103 (51%), Gaps = 3/103 (2%)

Query: 343 KQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEE 402
           K  RD A+K KAD   A+     + KA+   A    A+      E        +  A +E
Sbjct: 144 KAARDKAAKEKADQEKADQERDAKEKADKEKADKEKADKEKSDKEKADKEKSDKEKADKE 203

Query: 403 KQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAE 445
           K  +E+  KEKAD+EKAD   KEKAD+EKADKD   K  ++ +
Sbjct: 204 KADKEKADKEKADKEKAD---KEKADKEKADKDKAAKEKVERD 243


>gi|328870962|gb|EGG19334.1| villin [Dictyostelium fasciculatum]
          Length = 1641

 Score = 58.2 bits (139), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 63/254 (24%), Positives = 121/254 (47%), Gaps = 26/254 (10%)

Query: 381 VANFTSELKQATVLARANAQEEKQRR---EQEAKEKADREKADKEAKEKADREKADKDLQ 437
           +A   S+ ++   +A+  + +E+Q R   E+ AKEK+D+E+ D+ AKEKADRE+ ++  +
Sbjct: 390 IAKEKSDKEEQDRIAKEKSDKEEQDRLEKERVAKEKSDKEEQDRLAKEKADREEQERIAK 449

Query: 438 EKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDR---EET 494
           EK+  K E D              ++  ++ + EE   + +  KE    E  DR   E++
Sbjct: 450 EKSD-KEEQDRL---------EKERIAKEKSDKEE---QDRIAKEKADKEEQDRIAKEKS 496

Query: 495 ERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIG-- 552
           +++ QD L+   +A +   K E   +   +    ++ K  QD+  +++  K     I   
Sbjct: 497 DKEEQDRLEKERIAKEKSDKEEQDRLEKERIAKEKSDKEEQDRIAKEKAAKEEQDRIAKE 556

Query: 553 -VGESDYAGIKLTKKEKELQEQEENLRVA----EIIQQSRMQSEDLQEKAWDSYKEWKSL 607
              + +   +   K +KE Q++ E  R+A    +  +Q R+  E   ++  D   + K+ 
Sbjct: 557 KAAKEEQDRLAKEKADKEEQDRLEKERIAKEKSDKEEQDRIAKEKAAKEEQDRIAKEKAA 616

Query: 608 SPDEIKQRFQKYAK 621
             DE +   +K AK
Sbjct: 617 KEDEDRIAKEKAAK 630



 Score = 56.7 bits (135), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 76/288 (26%), Positives = 127/288 (44%), Gaps = 18/288 (6%)

Query: 340 DQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANA 399
           D  KQ +D A+ VK       I      K E          +A   S+ ++   LA+  A
Sbjct: 184 DTFKQDQDAAALVKEKEEQERIAKEKSDKEEQD-------RLAKEKSDKEEQDRLAKEKA 236

Query: 400 QEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTH 459
            +E+Q  E+ AKEK+D+E+ D+ AKEKAD+E+ ++  +EK+  + + D            
Sbjct: 237 DKEEQ--ERIAKEKSDKEEQDRLAKEKADKEEQERIAKEKSYCQEKADKEEQDRLEKERI 294

Query: 460 SVKLPPKEEELEEVKDEGKKGKEPG-TTETDDREETER---KNQDILDNSLLAGKTHTKN 515
           + +   KEE+    K++  K ++     E  D+EE +R   +  D  +   +A +   K 
Sbjct: 295 AKEKSDKEEQDRIAKEKSDKEEQDRIAKEKSDKEEQDRLAKEKSDKEEQERIAKEKSDKE 354

Query: 516 ETPAIPTAKAPPAQAH---KGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQE 572
           E   +   K+   +     K   DK+ QD+ EK   +     + +   I   K +KE Q+
Sbjct: 355 EQDRLAKEKSDKEEQDRLAKEKADKEEQDRLEKERIAKEKSDKEEQDRIAKEKSDKEEQD 414

Query: 573 QEENLRVAEIIQQSRMQSEDLQEKAWDSYKE--WKSLSPDEIKQRFQK 618
           + E  RVA+       Q    +EKA    +E   K  S  E + R +K
Sbjct: 415 RLEKERVAKEKSDKEEQDRLAKEKADREEQERIAKEKSDKEEQDRLEK 462



 Score = 55.5 bits (132), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 50/212 (23%), Positives = 107/212 (50%), Gaps = 18/212 (8%)

Query: 397 ANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSV 456
           A  + +K+ +++ AKEK+D+E+ ++ AKEK+D+E+ D+  +EK+  K E D         
Sbjct: 321 AKEKSDKEEQDRLAKEKSDKEEQERIAKEKSDKEEQDRLAKEKSD-KEEQDRLA------ 373

Query: 457 PTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDR---EETERKNQDILDNSLLAGKTHT 513
                K    +EE + ++ E +  KE    E  DR   E+++++ QD L+   +A +   
Sbjct: 374 -----KEKADKEEQDRLEKE-RIAKEKSDKEEQDRIAKEKSDKEEQDRLEKERVAKEKSD 427

Query: 514 KNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQ 573
           K E   +   KA   +  +  ++K  ++++++     I   +SD        KEK  +E+
Sbjct: 428 KEEQDRLAKEKADREEQERIAKEKSDKEEQDRLEKERIAKEKSDKEEQDRIAKEKADKEE 487

Query: 574 EENL--RVAEIIQQSRMQSEDLQEKAWDSYKE 603
           ++ +    ++  +Q R++ E + ++  D  ++
Sbjct: 488 QDRIAKEKSDKEEQDRLEKERIAKEKSDKEEQ 519


>gi|224122178|ref|XP_002330559.1| predicted protein [Populus trichocarpa]
 gi|222872117|gb|EEF09248.1| predicted protein [Populus trichocarpa]
          Length = 1681

 Score = 57.8 bits (138), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 139/653 (21%), Positives = 250/653 (38%), Gaps = 124/653 (18%)

Query: 388 LKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQ-EKTPIKAEG 446
           L+QA  L    A + +   E+ AK +A +E  +KEA  +   EK    LQ E + +  +G
Sbjct: 35  LRQAVKLLTEQADKFQAENEERAKVEAAKEGREKEAALRVKLEKEISALQSEVSTLNQKG 94

Query: 447 DDFGLGLPSVPTHSVKLPPK-----EEELEEVKDEGKKGKEPGTTETDDREETERKNQDI 501
             F    P V    VKL        E+E+  +K+  ++ K         R ++E+KN ++
Sbjct: 95  SAF----PEVENTEVKLLQDQIFKGEKEISRLKELLEREKL--------RADSEKKNAEV 142

Query: 502 LDNSLLAGKTHT-----------------KNETPAIPTAKAPPAQAHKGIQDKKPQDQRE 544
              S      H                  +NE  A+ +  +   Q  KG    + ++   
Sbjct: 143 EKKSAADAWKHVKAEKEGKEKEAALRVSLENEISALKSEISSLQQ--KGSMVDEDKNGEV 200

Query: 545 KPLASDIGVGESDYAGIK-LTKKEKELQEQE------ENLRVAEIIQQSRMQSEDLQEKA 597
           K L   +  GE + + +K L ++EK   E E      E  R AE  QQ + +     E+ 
Sbjct: 201 KLLQDQVSKGEKEISRLKELHEREKTRAESEKKKAEVERKRAAEAWQQVKAEKAKADEER 260

Query: 598 WDSYKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAI----------NHF 647
             +  EWK    +E + + +   K    + S +       +E++K               
Sbjct: 261 KHASSEWK--KAEEYRLQLETLTKEAELAKSKLASETLKFEEANKKFEAEKLKVTKEKKH 318

Query: 648 LDNDFGYYRIHNFLSQWSPLGLMYEKDELHGV-----------------EAVYQKLDVLF 690
            D++      H  L++ +   LM E+     +                 E   ++L+ L 
Sbjct: 319 ADSEMAKAEAHRKLAEANWKKLMEEQSHTENICKQLEDARKRIEKPQKAEEYQRQLESLK 378

Query: 691 RHCIEN---LRANKNAVDAMSKAVEAGESSVRKH----SFEVLSSKHQKSVIAVNNFIKE 743
           +   E+   L A    ++  +K +EA ++ V K       EV ++K Q+ +   N     
Sbjct: 379 KEAAESKSKLVAETLKLEDANKMLEAEKAKVMKERKRADSEVATAKEQRKLAETNG---- 434

Query: 744 ITHHTRRLVKEDPKRGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLY 803
                R++++E  +       L D R +++++ K +        + G F D   E     
Sbjct: 435 -----RKVIEEKSRADNLSRQLEDARIKIEELEKGINGFIQSKNMGGTFDDQHDET---- 485

Query: 804 TIISGSEKILQGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFE 863
              +G +  ++       L +L    K +S  SKL   F     NN  KE          
Sbjct: 486 --TNGEDATIRDS-----LENL----KNNSDQSKLVLEFL----NN--KEATKRLDIEKR 528

Query: 864 RSLKNQAHLNAEV---ERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRS 920
           +++  +   ++E+   E+L  L++      A+ K    QLSR        DE  +     
Sbjct: 529 KAITEKKRADSEMVKAEKLRNLSKMNRKIAAEEKSRADQLSRQL------DEDKIKI--E 580

Query: 921 EFEREIKELKSVIEADAKENPNPNK--NQKKLQ-KTREKLVAQLSSRLKELNI 970
           E +++I+EL+S  +     +  P+K  N +K + K  EK V     RLK   +
Sbjct: 581 ELQKQIQELQSSKKVVVASSVLPDKVMNVEKTKLKFLEKQVKLEKMRLKHAKV 633


>gi|328867396|gb|EGG15779.1| alpha/beta hydrolase fold-1 domain-containing protein
           [Dictyostelium fasciculatum]
          Length = 841

 Score = 53.6 bits (127), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 50/194 (25%), Positives = 93/194 (47%), Gaps = 15/194 (7%)

Query: 389 KQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDD 448
           ++A+ +A+  A +E+  R   AKEKAD+E+AD+ AKEKAD+E+AD+  +EK   + E D 
Sbjct: 529 QEASRIAKEKADQEEADRI--AKEKADQEEADRIAKEKADQEEADRIAKEKAD-QEEADR 585

Query: 449 FGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLA 508
                        K    +EE + +  E    +E       + E   ++  D  + + +A
Sbjct: 586 IA-----------KEKADQEEADRIAKEKADQEEADRIAAQEAERIAKEKADQEEAARIA 634

Query: 509 GKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIG-VGESDYAGIKLTKKE 567
            +   + E   I   KA   +A +  ++K  Q++ ++  A +   + +      +  +  
Sbjct: 635 KEKADQEEADRIAKEKADQEEAERIAKEKADQEEADRIAAQEAARIAKEKADQEEADRIA 694

Query: 568 KELQEQEENLRVAE 581
           KE  +QEE  R+A+
Sbjct: 695 KEKADQEEADRIAK 708



 Score = 53.2 bits (126), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 68/264 (25%), Positives = 116/264 (43%), Gaps = 35/264 (13%)

Query: 372 RLAYSTIANVANFTSELKQAT-VLARANAQEEKQRREQE-----AKEKADREKADKEAKE 425
           R+A    A +A   S+ ++A  + A+  A+  K++ +QE     AKEKAD+E+AD+ AKE
Sbjct: 376 RIAAQETARIAKEKSDQEEADRIAAQETARIAKEKADQEEADRIAKEKADQEEADRIAKE 435

Query: 426 KADREKADK--------------DLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELE 471
           KAD+E+AD+              D +E   I  E  D           + ++  ++ + E
Sbjct: 436 KADQEEADRIAAQETARIAKEKADQEEADRIAKEKADQEEADRIAAQETARIAKEKADQE 495

Query: 472 EVKDEGKKGKEPGTTETDDREETERKNQDILDN------SLLAGKTHTKNETPAIPTAKA 525
           E     +  KE    E  DR   E+ +Q+  D       S +A +   + E   I   KA
Sbjct: 496 EAD---RIAKEKADQEEADRIAKEKADQEEADRIAAQEASRIAKEKADQEEADRIAKEKA 552

Query: 526 PPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKE------KELQEQEENLRV 579
              +A +  ++K  Q++ ++         E+D    +   +E      KE  +QEE  R+
Sbjct: 553 DQEEADRIAKEKADQEEADRIAKEKADQEEADRIAKEKADQEEADRIAKEKADQEEADRI 612

Query: 580 AEIIQQSRMQSEDLQEKAWDSYKE 603
           A    +   + +  QE+A    KE
Sbjct: 613 AAQEAERIAKEKADQEEAARIAKE 636



 Score = 42.4 bits (98), Expect = 0.49,   Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 44/65 (67%), Gaps = 6/65 (9%)

Query: 381 VANFTSELKQATVLARANAQEEKQRR--EQEA----KEKADREKADKEAKEKADREKADK 434
           +A   ++ ++A  +A+  A +E+  R   QEA    KEKAD+E+AD+ AKEKAD+E+AD+
Sbjct: 646 IAKEKADQEEAERIAKEKADQEEADRIAAQEAARIAKEKADQEEADRIAKEKADQEEADR 705

Query: 435 DLQEK 439
             +EK
Sbjct: 706 IAKEK 710


>gi|56205922|emb|CAI24424.1| myosin XVIIIa [Mus musculus]
          Length = 1998

 Score = 53.6 bits (127), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 113/594 (19%), Positives = 245/594 (41%), Gaps = 70/594 (11%)

Query: 369  AETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKAD 428
             E RL Y       +FT +  Q  +       E+K   EQ+++ + +R   D +A +  +
Sbjct: 1365 GEWRLKYERAVREVDFTKKRLQQEL-------EDKMEVEQQSRRQLERRLGDLQA-DSDE 1416

Query: 429  REKADKDLQEKTP-IKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTE 487
             ++A + L++K   + AE  D  L L      + +L  K+   +    E  +  E    E
Sbjct: 1417 SQRALQQLKKKCQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDS---ELSQAHEETQRE 1473

Query: 488  TDDREETERKNQDILDNSL-LAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKP 546
               RE+ +R+   +L  +  L  +   K+   A  T K    +A   +QD   Q+ +++ 
Sbjct: 1474 KLQREKLQREKDMLLAEAFSLKQQMEEKDLDIAGFTQKVVSLEAE--LQDISSQESKDEA 1531

Query: 547  LASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKS 606
              + +     D    K+  +E+EL EQ  ++++ E ++Q  +Q E+  E    + +E + 
Sbjct: 1532 SLAKVKKQLRDLEA-KVKDQEEELDEQAGSIQMLEQLKQMEVQLEEEYEDKQKALREKRE 1590

Query: 607  LS------PDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNF 660
            L        D++ QR  +  K   +            Q     ++H  +N      I   
Sbjct: 1591 LESKLSTLSDQVNQRDFESEKRLRKDLKRTKALLADAQ---IMLDHLKNNAPSKREIAQL 1647

Query: 661  LSQWSPLGLMYEKDELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGESSVRK 720
             +Q        E+ E     AV  +  +     +E+L      +D ++KA  A E  +  
Sbjct: 1648 KNQ-------LEESEFTCAAAVKARKAMEVE--MEDLHLQ---IDDIAKAKTALEEQL-- 1693

Query: 721  HSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKED----PKRGKSESYLSDIRSELQKVN 776
                   S+ Q+    + N ++E       L+K+      +  +  + ++D+++++++ N
Sbjct: 1694 -------SRLQREKNEIQNRLEEDQEDMNELMKKHKAAVAQASRDMAQMNDLQAQIEESN 1746

Query: 777  KTVMDIRIKLRLYGIFQDIPQEQPPLYTIISGSEKILQGDYTFPPLSSLDVQSKFDSSYS 836
            K   +++ KL+      +  ++     +++S  E  ++          L+ + +F+ +  
Sbjct: 1747 KEKQELQEKLQALQSQVEFLEQSMVDKSLVSRQEAKIR---------ELETRLEFEKTQV 1797

Query: 837  KLFEIFYGDW--TNNAIKEERYWTIYAFERSLKNQAHLNAEV----ERLSGLAQQPSDST 890
            K  E        T   + EER     A  R  +    L  ++    E +S LA++ ++++
Sbjct: 1798 KRLENLASRLKETMEKLTEERDQRAAAENREKEQNKRLQRQLRDTKEEMSELARKEAEAS 1857

Query: 891  ADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIKELKSVIEADAKENPNPN 944
                EL+  L       E+ ++ + + ++  F+R I +L++ IE + + + N +
Sbjct: 1858 RKKHELEMDLESL----EAANQSLQADLKLAFKR-IGDLQAAIEDEMESDENED 1906


>gi|24660442|gb|AAH39612.1| MYO18A protein [Homo sapiens]
          Length = 2002

 Score = 52.8 bits (125), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 115/594 (19%), Positives = 241/594 (40%), Gaps = 70/594 (11%)

Query: 369  AETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKAD 428
             E RL Y       +FT +  Q          E+K   EQ+ K + +R   D +A +  +
Sbjct: 1369 GEWRLKYERAVREVDFTKKRLQQEF-------EDKLEVEQQNKRQLERRLGDLQA-DSEE 1420

Query: 429  REKADKDLQEKTP-IKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTE 487
             ++A + L++K   + AE  D  L L      + +L  K+   +    E  +  E    E
Sbjct: 1421 SQRALQQLKKKCQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDS---ELSQAHEEAQRE 1477

Query: 488  TDDREETERKNQDILDNSL-LAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKP 546
               RE+ +R+   +L  +  L  +   K+   A  T K    +A   +QD   Q+ +++ 
Sbjct: 1478 KLQREKLQREKDMLLAEAFSLKQQLEEKDMDIAGFTQKVVSLEAE--LQDISSQESKDEA 1535

Query: 547  LASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKS 606
              + +     D    K+  +E+EL EQ   +++ E ++Q  +Q E+  E      +E + 
Sbjct: 1536 SLAKVKKQLRDLEA-KVKDQEEELDEQAGTIQMLEQLKQMEVQLEEEYEDKQKVLREKRE 1594

Query: 607  LS------PDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNF 660
            L        D++ +R  +  K   +            Q     ++H  ++      I   
Sbjct: 1595 LEGKLATLSDQVNRRDFESEKRLRKDLKRTKALLADAQ---LMLDHLKNSAPSKREIAQL 1651

Query: 661  LSQWSPLGLMYEKDELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGESSVRK 720
             +Q        E+ E     AV  +  +     IE+L      +D ++KA  A E  +  
Sbjct: 1652 KNQ-------LEESEFTCAAAVKARKAMEVE--IEDLHLQ---IDDIAKAKTALEEQL-- 1697

Query: 721  HSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKED----PKRGKSESYLSDIRSELQKVN 776
                   S+ Q+    + N ++E       L+K+      +  +  + ++D++++L++ N
Sbjct: 1698 -------SRLQREKNEIQNRLEEDQEDMNELMKKHKAAVAQASRDLAQINDLQAQLEEAN 1750

Query: 777  KTVMDIRIKLRLYGIFQDIPQEQPPLYTIISGSEKILQGDYTFPPLSSLDVQSKFDSSYS 836
            K   +++ KL+      +  ++     +++S  E  ++          L+ + +F+ +  
Sbjct: 1751 KEKQELQEKLQALQSQVEFLEQSMVDKSLVSRQEAKIR---------ELETRLEFERTQV 1801

Query: 837  KLFEIFYGDWTNNAIK--EERYWTIYAFERSLKNQAHLNAEV----ERLSGLAQQPSDST 890
            K  E        N  K  EER   I A  R  +    L  ++    E +  LA++ ++++
Sbjct: 1802 KRLESLASRLKENMEKLTEERDQRIAAENREKEQNKRLQRQLRDTKEEMGELARKEAEAS 1861

Query: 891  ADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIKELKSVIEADAKENPNPN 944
                EL+  L       E+ ++ + + ++  F+R I +L++ IE + + + N +
Sbjct: 1862 RKKHELEMDLESL----EAANQSLQADLKLAFKR-IGDLQAAIEDEMESDENED 1910


>gi|45357976|ref|NP_987533.1| hypothetical protein MMP0413 [Methanococcus maripaludis S2]
 gi|44920733|emb|CAF29969.1| Conserved hypothetical protein [Methanococcus maripaludis S2]
          Length = 731

 Score = 51.6 bits (122), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 53/211 (25%), Positives = 103/211 (48%), Gaps = 36/211 (17%)

Query: 2   NELATSIDYQTNNLDQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYIV 61
           N++A  I    + LD DK+    +AKTL  I D + HL E   +  +D N HK++   + 
Sbjct: 357 NKMAKDIKELHSMLDADKL---SLAKTLKEIFDIMDHLAEGDFSVRADENRHKNK---LQ 410

Query: 62  GPIEQRLKKVSERYERVVSRDLTLVIEAGLKDLKEVGDTLKRLAETGEVI---------- 111
             I   ++ VS+  E + S ++T++ +    +L++VG+ LKR  ET E +          
Sbjct: 411 KTINHAIENVSKMMENLKS-EITVLSD----ELEDVGEGLKRAKETSEQVTDAANQVATA 465

Query: 112 -------LSDKSDRL--LCRFMDMVETEDEHKINK--QVRDALESAGFDLESTQENIRKV 160
                  L D SD L    +  DMV  + E  ++   +V+D  E+    +E+  + ++K+
Sbjct: 466 AADQSAKLQDTSDELEKTAKAADMVYNDAEQSVDSAIEVKDNSETGVKKVENAIDTMQKI 525

Query: 161 ESALINNNMKDAFRFLELAQKSKETADSHII 191
            + +  + +  + +  EL ++SK+  +  ++
Sbjct: 526 TNVI--DELGKSIQ--ELGEESKKINEVTVL 552


>gi|315122423|ref|YP_004062912.1| hypothetical protein CKC_03375 [Candidatus Liberibacter solanacearum
            CLso-ZC1]
 gi|313495825|gb|ADR52424.1| hypothetical protein CKC_03375 [Candidatus Liberibacter solanacearum
            CLso-ZC1]
          Length = 86

 Score = 51.6 bits (122), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 41/79 (51%)

Query: 988  FEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGDPSLMMDYEKVEPSDVMAGLPDD 1047
            +E P  + +  I    KD++RL P+ S+SK  +K   D SL +DY K E       LPD 
Sbjct: 2    WEEPPLSDDERISNVFKDVERLRPLSSISKVTEKEADDTSLSLDYTKEENKQPSYDLPDA 61

Query: 1048 LAKRFKALLSWKGWHQLTP 1066
            ++KRF  L   K W +  P
Sbjct: 62   ISKRFDDLKDSKSWIKRKP 80


>gi|7549210|gb|AAF63787.1|AF142406_1 200 kDa antigen p200 [Babesia bigemina]
          Length = 1108

 Score = 51.6 bits (122), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 52/222 (23%), Positives = 108/222 (48%), Gaps = 3/222 (1%)

Query: 400 QEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTH 459
           Q E+++ E+EAKEKA+RE+ ++E  E+  REKA+++ +E+   + E  +           
Sbjct: 376 QREREKAEREAKEKAEREQREREKAEREAREKAEREQREREKAEREAREKAEREQREREK 435

Query: 460 SVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPA 519
           + +L  ++ E E  +   ++ +E    E + RE+ ER+ ++      LA +   +     
Sbjct: 436 AERLAREKAEREAREKAEREQREREKAEREAREKAEREQREREKAERLAREKAEREAREK 495

Query: 520 IPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQE--QEENL 577
               +    +A +  ++K  ++QRE+  A  +   +++    +  ++E+  +E  + E  
Sbjct: 496 AEREQREREKAEREAREKAEREQREREKAERLAREKAEREAREKAEREQREREKAEREAR 555

Query: 578 RVAEIIQQSRMQSEDL-QEKAWDSYKEWKSLSPDEIKQRFQK 618
             AE  Q+ R ++E L +EKA    +E       E  +R Q+
Sbjct: 556 EKAEREQREREKAERLAREKAEREAREKAEREAREKAEREQR 597



 Score = 47.4 bits (111), Expect = 0.017,   Method: Composition-based stats.
 Identities = 48/204 (23%), Positives = 95/204 (46%), Gaps = 5/204 (2%)

Query: 400 QEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTH 459
           Q E+++ E+EAKEKA+RE+ ++E  E+  +EKA+++ +E+   + E  +           
Sbjct: 208 QREREKAEREAKEKAEREQREREKAEREAKEKAEREQREREKAEREAKEKA---EREAKE 264

Query: 460 SVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPA 519
             +   +E E  E + + K  +E    E  +RE  E+  ++  + +    +   K E  A
Sbjct: 265 KAEREQREREKAEREAKEKAEREQREREKAEREAKEKAEREAKEKAEREQREREKAELEA 324

Query: 520 IPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRV 579
              A+    +  K  ++ K + +RE    ++    E + A  +L  KEK  +EQ E  + 
Sbjct: 325 KEKAEREQREREKAEREAKEKAEREAKEKAEREQREREKA--ELEAKEKAEREQREREKA 382

Query: 580 AEIIQQSRMQSEDLQEKAWDSYKE 603
               ++   + +  +EKA    +E
Sbjct: 383 EREAKEKAEREQREREKAEREARE 406



 Score = 42.0 bits (97), Expect = 0.73,   Method: Composition-based stats.
 Identities = 40/160 (25%), Positives = 78/160 (48%), Gaps = 4/160 (2%)

Query: 387 ELKQATVLARANAQEE-KQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAE 445
           E ++A  LAR  A+ E +++ E+EA+EKA+RE+ ++E  E+  REKA+++ +EK   +  
Sbjct: 564 EREKAERLAREKAEREAREKAEREAREKAEREQREREKAERLAREKAEREAREKAEREQR 623

Query: 446 GDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNS 505
             +             +   +E E  E + + K  +E    E  +RE  E+  ++  ++ 
Sbjct: 624 EREKA---EREAKEKAEREQREREKAEREAKEKAEREQREREKAEREAKEKAEREQREHE 680

Query: 506 LLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREK 545
               +   K E  A   A+    +  K  ++ K + +RE+
Sbjct: 681 KAEREAREKAEREAREKAEREQREREKAEREAKEKAEREQ 720



 Score = 42.0 bits (97), Expect = 0.73,   Method: Composition-based stats.
 Identities = 40/139 (28%), Positives = 61/139 (43%), Gaps = 1/139 (0%)

Query: 359 AEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREK 418
           AE     R KAE RLA       A   +E +Q          +EK  REQ  +EKA+RE 
Sbjct: 592 AEREQREREKAE-RLAREKAEREAREKAEREQREREKAEREAKEKAEREQREREKAEREA 650

Query: 419 ADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGK 478
            +K  +E+ +REKA+++ +EK   +    +                  E E  E +   +
Sbjct: 651 KEKAEREQREREKAEREAKEKAEREQREHEKAEREAREKAEREAREKAEREQREREKAER 710

Query: 479 KGKEPGTTETDDREETERK 497
           + KE    E  +RE+ ER+
Sbjct: 711 EAKEKAEREQREREKAERE 729


>gi|325911037|gb|ADZ45247.1| pneumococcal surface protein C [Streptococcus pneumoniae]
          Length = 707

 Score = 51.3 bits (121), Expect = 0.001,   Method: Composition-based stats.
 Identities = 53/204 (25%), Positives = 90/204 (44%), Gaps = 20/204 (9%)

Query: 395 ARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADK-----------DLQEK-TPI 442
           A+A  + EK    +  K K DREKA++EAK +AD ++ D+           DL E+ TP 
Sbjct: 214 AKAKVESEKAEATRLKKIKTDREKAEEEAKRRADAKEQDESKRRKSRVKRGDLGEQATPD 273

Query: 443 KAEGD----DFGLGLPSVPTHSVKLPPKEEELE-EVKDEGKKGKEPGTTETDDREETERK 497
           K E D    D  +G  ++P+ S+K   K  E E +V++  KK K     + +DR      
Sbjct: 274 KKENDAKSSDSSVGEKTLPSPSLKPGKKVAEAEKKVEEADKKAK---AQKEEDRRNYPTN 330

Query: 498 NQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESD 557
               L+  +       K     +   +A   Q  + I+  K + + +K  A+ +   ++D
Sbjct: 331 TYKTLELEIAESDVKVKEAELELVKEEAKEPQNEEKIKQAKAKVESKKAEATRLEKIKTD 390

Query: 558 YAGIKLTKKEKELQEQEENLRVAE 581
               +   K K  +E +   + AE
Sbjct: 391 RKKAEEEAKRKAAEEDKVKEKPAE 414


>gi|260949863|ref|XP_002619228.1| hypothetical protein CLUG_00387 [Clavispora lusitaniae ATCC 42720]
 gi|238846800|gb|EEQ36264.1| hypothetical protein CLUG_00387 [Clavispora lusitaniae ATCC 42720]
          Length = 879

 Score = 51.3 bits (121), Expect = 0.001,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 52/81 (64%), Gaps = 3/81 (3%)

Query: 368 KAETRLAYSTIANVANFTSELKQATVLARA---NAQEEKQRREQEAKEKADREKADKEAK 424
           +A+  +AY     +     E+++     +A    A++EK  +EQ A+EKA++EKA+++A+
Sbjct: 621 RAKANVAYQMREGLTRQLEEIQEQAAQEKAAQEKAEQEKAEQEQAAQEKAEQEKAEQDAQ 680

Query: 425 EKADREKADKDLQEKTPIKAE 445
           EKA++EK++++  E+  ++ E
Sbjct: 681 EKAEQEKSEQENLEQENLEQE 701


>gi|321467016|gb|EFX78008.1| hypothetical protein DAPPUDRAFT_105663 [Daphnia pulex]
          Length = 4511

 Score = 51.3 bits (121), Expect = 0.001,   Method: Composition-based stats.
 Identities = 94/414 (22%), Positives = 178/414 (42%), Gaps = 63/414 (15%)

Query: 389  KQATVLARANAQEEKQRREQEAKEKADR-----EKADKEAKEKADREKADKDLQEKTPIK 443
            K+A    R   +EE++RR Q+  E+ DR     E+ D+  KE+ ++++  K+ +EK  ++
Sbjct: 2297 KEAEEKDRLLKEEEEKRRIQKESEEKDRLQKEAEEKDRLLKEEEEKQRIQKESEEKDRLQ 2356

Query: 444  AEGDDFGLGLPS------VPTHSVKLPPKEEELEE----VKDEGKKGKEPGTTETDDREE 493
             E ++    L        +   S +    ++E EE    +K+E +K +    +E  DR +
Sbjct: 2357 KEAEEKDRLLKEEEEKQRIQKESEEKDRLQKEAEEKDRLLKEEEEKQRIQKESEEKDRLQ 2416

Query: 494  TERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGV 553
             E + +D L       K   + E+      +    +  + +++K+ + + +K        
Sbjct: 2417 KEAEEKDRLLKE-EEEKQRIQKESEEKDRLQKETEEKDRLLKEKEEKQRMQKESE----- 2470

Query: 554  GESDYAGIKLTKKEKELQEQEENLRV-AEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEI 612
             E D    +  +K++ L+E+EE  R+  E  ++ R+Q E  +EK        + L  +E 
Sbjct: 2471 -EKDRLQKEAEEKDRLLKEEEEKRRIQKESEEKDRLQKET-EEKD-------RLLKEEEE 2521

Query: 613  KQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSPLG---- 668
            KQR QK ++         D   K  +E D+     L  +    RI   L + + L     
Sbjct: 2522 KQRMQKESE-------EKDRLQKEAEEKDR----LLKEEEEKQRIQKELEEKNRLQKETE 2570

Query: 669  ----LMYEKDELHGVEAVYQKLDVLFRHCIENLRANKNA--VDAMSKAVEAGESSVRKHS 722
                L+ E++E   ++   ++ D L +   E  R  K A   D + K  E  +  + K  
Sbjct: 2571 EKDRLLKEEEEKQRIQKELEEKDCLQKELEEKERLQKEAEEKDLLLKEAEEKQHFLTKTD 2630

Query: 723  FEVLSSKH----QKSVIAVNNFIKEITHHTRRLVKED-----PKRGKSESYLSD 767
             E+  +K     ++  +  N   KE+   T+RL+KE+     PK  K +    D
Sbjct: 2631 -EIEGTKEDIEAEEKDLTKNETQKEV-EVTKRLLKEEESVQLPKESKEKESKQD 2682



 Score = 46.6 bits (109), Expect = 0.024,   Method: Composition-based stats.
 Identities = 88/395 (22%), Positives = 164/395 (41%), Gaps = 73/395 (18%)

Query: 389  KQATVLARANAQEEKQRREQEAKEKADR-----EKADKEAKEKADREKADKDLQEKTPIK 443
            K+A    R   +EE++RR Q+  E+ DR     E+ D+  KE+ ++ +  K+ +EK  ++
Sbjct: 2267 KEAEEKDRLLKEEEEKRRIQKESEEKDRLQKEAEEKDRLLKEEEEKRRIQKESEEKDRLQ 2326

Query: 444  AEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQD-IL 502
             E ++             +L  +EEE + ++ E         +E  DR + E + +D +L
Sbjct: 2327 KEAEE-----------KDRLLKEEEEKQRIQKE---------SEEKDRLQKEAEEKDRLL 2366

Query: 503  DNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIK 562
                   +   ++E       +A         +++K + Q+E          E D    +
Sbjct: 2367 KEEEEKQRIQKESEEKDRLQKEAEEKDRLLKEEEEKQRIQKESE--------EKDRLQKE 2418

Query: 563  LTKKEKELQEQEENLRV-AEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAK 621
              +K++ L+E+EE  R+  E  ++ R+Q E  +EK        + L   E KQR QK ++
Sbjct: 2419 AEEKDRLLKEEEEKQRIQKESEEKDRLQKET-EEKD-------RLLKEKEEKQRMQKESE 2470

Query: 622  VFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSPLGLMYEKDELHGVEA 681
                     D   K  +E D+     L  +    RI              E +E   ++ 
Sbjct: 2471 -------EKDRLQKEAEEKDR----LLKEEEEKRRIQK------------ESEEKDRLQK 2507

Query: 682  VYQKLDVLFRHCIENLRANKNA--VDAMSKAVEAGESSVRKHSFEVLSSKHQKSVIAVNN 739
              ++ D L +   E  R  K +   D + K  E  +  +++   E    + QK +   N 
Sbjct: 2508 ETEEKDRLLKEEEEKQRMQKESEEKDRLQKEAEEKDRLLKE---EEEKQRIQKELEEKNR 2564

Query: 740  FIKEITHHTRRLVKEDPKRGKSESYLSDIRSELQK 774
              KE T    RL+KE+ ++ + +  L + +  LQK
Sbjct: 2565 LQKE-TEEKDRLLKEEEEKQRIQKELEE-KDCLQK 2597



 Score = 44.3 bits (103), Expect = 0.12,   Method: Composition-based stats.
 Identities = 57/250 (22%), Positives = 111/250 (44%), Gaps = 47/250 (18%)

Query: 400  QEEKQRREQEAKEK----ADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPS 455
            +EEKQR + E++EK     + E+ D+  KE+ ++ +  K+ +EK  ++ E ++       
Sbjct: 2249 EEEKQRIQIESEEKDRLQKEAEEKDRLLKEEEEKRRIQKESEEKDRLQKEAEE------- 2301

Query: 456  VPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQD-ILDNSLLAGKTHTK 514
                  +L  +EEE   ++ E         +E  DR + E + +D +L       +   +
Sbjct: 2302 ----KDRLLKEEEEKRRIQKE---------SEEKDRLQKEAEEKDRLLKEEEEKQRIQKE 2348

Query: 515  NETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQE 574
            +E       +A         +++K + Q+E          E D    +  +K++ L+E+E
Sbjct: 2349 SEEKDRLQKEAEEKDRLLKEEEEKQRIQKESE--------EKDRLQKEAEEKDRLLKEEE 2400

Query: 575  ENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSY 634
            E  R    IQ+   + + LQ++A +     + L  +E KQR QK ++         D   
Sbjct: 2401 EKQR----IQKESEEKDRLQKEAEEKD---RLLKEEEEKQRIQKESE-------EKDRLQ 2446

Query: 635  KGTQESDKAI 644
            K T+E D+ +
Sbjct: 2447 KETEEKDRLL 2456



 Score = 41.2 bits (95), Expect = 1.1,   Method: Composition-based stats.
 Identities = 57/248 (22%), Positives = 104/248 (41%), Gaps = 38/248 (15%)

Query: 389  KQATVLARANAQEEKQRREQEAKEKADR-----EKADKEAKEKADREKADKDLQEKTPIK 443
            K+A    R   +EE++RR Q+  E+ DR     E+ D+  KE+ ++++  K+ +EK  ++
Sbjct: 2477 KEAEEKDRLLKEEEEKRRIQKESEEKDRLQKETEEKDRLLKEEEEKQRMQKESEEKDRLQ 2536

Query: 444  AEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDE-GKKGKEPGTTETDDR-----EETERK 497
             E ++             +L  +EEE + ++ E  +K +    TE  DR     EE +R 
Sbjct: 2537 KEAEE-----------KDRLLKEEEEKQRIQKELEEKNRLQKETEEKDRLLKEEEEKQRI 2585

Query: 498  NQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESD 557
             +++ +   L  +   K         K    +  +  Q    +    +    DI   E D
Sbjct: 2586 QKELEEKDCLQKELEEKERLQKEAEEKDLLLKEAEEKQHFLTKTDEIEGTKEDIEAEEKD 2645

Query: 558  YAGIKLTKKE--KELQEQEENLRVAEIIQ-----QSRMQSEDLQEKAWDSYKEWKSLSPD 610
                 LTK E  KE++  +  L+  E +Q     + +   +D Q+K      E   +  D
Sbjct: 2646 -----LTKNETQKEVEVTKRLLKEEESVQLPKESKEKESKQDQQQKE----VEGSQIKND 2696

Query: 611  EIKQRFQK 618
            E K R  +
Sbjct: 2697 EDKSRINE 2704


>gi|317120714|gb|ADV02536.1| hypothetical protein SC2_gp070 [Liberibacter phage SC2]
 gi|317120775|gb|ADV02596.1| hypothetical protein SC2_gp070 [Candidatus Liberibacter asiaticus]
          Length = 413

 Score = 50.9 bits (120), Expect = 0.001,   Method: Composition-based stats.
 Identities = 37/127 (29%), Positives = 62/127 (48%)

Query: 1107 EDEPRIEVERDATLPRLAKDDGSKEDEYEGGANERYVCIPSMDTSESFNSTMGKKRRIFK 1166
            ++   ++V  D ++    + D   E E  G        +PS+DT E+FN   G+KRR+  
Sbjct: 282  QESEMVKVSLDGSIVPYKQGDSIVEGEGIGYTYTSLAQLPSIDTGEAFNGLGGRKRRVVS 341

Query: 1167 VVVRVINTADLEVGILGFPIVPVEELRGKPKTGEFEVLVPSDASLNPEIIIRQKTGGYFC 1226
              VRV+N   LEVG     + PV+ L+ + K+GEF   +    +    + +RQK      
Sbjct: 342  SSVRVLNAQGLEVGTSFDKMYPVKGLKDEAKSGEFNCPLGGSFTSQDGLCLRQKGANTGA 401

Query: 1227 LTSITAH 1233
            +T++  H
Sbjct: 402  ITAVITH 408


>gi|91215359|ref|ZP_01252330.1| hypothetical protein P700755_09603 [Psychroflexus torquis ATCC
           700755]
 gi|91186311|gb|EAS72683.1| hypothetical protein P700755_09603 [Psychroflexus torquis ATCC
           700755]
          Length = 1138

 Score = 50.9 bits (120), Expect = 0.001,   Method: Composition-based stats.
 Identities = 44/160 (27%), Positives = 72/160 (45%), Gaps = 22/160 (13%)

Query: 817 YTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTN----NAIKEERYWTIYAFERSLKNQAHL 872
           Y FP   + D+     + YS  FE++  D  N    +  K   Y      E S +N    
Sbjct: 444 YAFP---NEDIDLMAGTDYSYYFEVYDNDEVNGRKSSKSKVFSYRQKTELEESTENLKRQ 500

Query: 873 NAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFER-------- 924
           N  VE+LS   +Q  +S A L+ELQ +  + K    +  +++ +FI+ + +R        
Sbjct: 501 NTAVEKLSEELKQQKESNATLRELQNKQRKEKNLDYTEKQKLDNFIKRQKQRMEMMKNYS 560

Query: 925 -----EIKELKSVIEADAKENPNP--NKNQKKLQKTREKL 957
                + K+L    +  AKEN      KNQK+++K +E L
Sbjct: 561 ERLKEDFKKLNPEEQDKAKENLEDRLEKNQKQIEKNQELL 600


>gi|310795759|gb|EFQ31220.1| stress response protein NST1 [Glomerella graminicola M1.001]
          Length = 1212

 Score = 50.9 bits (120), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 36/54 (66%), Gaps = 1/54 (1%)

Query: 387 ELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADRE-KADKDLQEK 439
           +LK+   L     +E+K++  +E KEK D+ K DKEAK KADRE KADK+  E+
Sbjct: 670 KLKEEARLREKENREQKEKEIRERKEKQDQAKRDKEAKAKADREAKADKESSER 723



 Score = 44.7 bits (104), Expect = 0.095,   Method: Composition-based stats.
 Identities = 38/166 (22%), Positives = 69/166 (41%), Gaps = 18/166 (10%)

Query: 390 QATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDF 449
           Q  +  +   + E++R+ +EA+EKA + K +   +EK +RE+ +K+++E+   K + D  
Sbjct: 644 QKRLQEQQEKRAEQERKAREAREKAQKLKEEARLREKENREQKEKEIRER---KEKQDQA 700

Query: 450 GLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAG 509
                +      +    +E  E +K E K  ++  T             +  L    +  
Sbjct: 701 KRDKEAKAKADREAKADKESSERLKQEEKAAQKAATITAAPIPIPNSGRR--LSQHPVPI 758

Query: 510 KTHTKN-----------ETPAIPTAKAP--PAQAHKGIQDKKPQDQ 542
            THT N            TPA+P A  P  P  A + ++   P  Q
Sbjct: 759 PTHTSNPASYASPKIPVATPALPKAPTPIRPKHASQPLETSLPGSQ 804


>gi|118357273|ref|XP_001011886.1| hypothetical protein TTHERM_00393100 [Tetrahymena thermophila]
 gi|89293653|gb|EAR91641.1| hypothetical protein TTHERM_00393100 [Tetrahymena thermophila
           SB210]
          Length = 904

 Score = 50.9 bits (120), Expect = 0.002,   Method: Composition-based stats.
 Identities = 42/169 (24%), Positives = 81/169 (47%), Gaps = 15/169 (8%)

Query: 130 EDEHKINKQVRDALESAGFDLESTQENIRKVESALINN------NMKDAFRFLELAQKSK 183
           E+E + N+ VRDAL S+ F ++  +     +E  LIN       N+KD    ++  + + 
Sbjct: 192 ENEKEANQFVRDALPSSIFIIKYDKTK-DLIEKKLINRAAQQEYNIKDDSSLIQFLRNTV 250

Query: 184 ETADSHIIEAID---VGTKLKENTPPTTFTSISKVLLKSNNMQDVVFTKIKEVVKKHVNA 240
              DS   +        +  K ++P    ++IS++ + SNN++  ++ K +E+ K++ N 
Sbjct: 251 IQKDSQQKQQTSFQLTQSSFKASSPTKNISTISQMQV-SNNLEHYIYFKFREMTKQNNNK 309

Query: 241 ELGHRKLRGLA--FDHTYFNDKLNQFLKEIKNHQKEYDESEKGSSKARY 287
           +    K++ +    D +  ND+  QF K+I  +Q    E    S  + Y
Sbjct: 310 QKQDNKIQQITKQVDVSQINDESKQFEKKI--YQSSIKEQSTNSINSNY 356


>gi|15242427|ref|NP_199365.1| unknown protein [Arabidopsis thaliana]
 gi|9758742|dbj|BAB09180.1| unnamed protein product [Arabidopsis thaliana]
 gi|332007881|gb|AED95264.1| Leucine-rich repeat (LRR) family protein [Arabidopsis thaliana]
          Length = 1167

 Score = 50.9 bits (120), Expect = 0.002,   Method: Composition-based stats.
 Identities = 50/225 (22%), Positives = 101/225 (44%), Gaps = 25/225 (11%)

Query: 395 ARANAQEEKQRREQEAK----------EKADREKADKEAKEKADREKADKDL-QEKTPIK 443
            +A+ +EEK++ E EA+          EK   +K+  E K   D+E AD D  +++  ++
Sbjct: 682 GKADLEEEKKQDEVEAEKSKSDEIVEGEKKPDDKSKVEKKGDGDKENADLDEGKKRDEVE 741

Query: 444 AEGDDFGLGLPSVPTHSVKLPPKE--EELEEVKDEGKKGKEPGTTETDDREETERKNQDI 501
           A+  + G     V     + PP+E  + ++ + D+  K ++ G  +    +  E K  D 
Sbjct: 742 AKKSESG---KVVEGDGKESPPQESIDTIQNMTDDQTKVEKEGDRDKGKVDPEEGKKHDE 798

Query: 502 LDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGI 561
           ++  +       K++       KA P++      + KP D +      + G GE +   +
Sbjct: 799 VEGGIW------KSDNGVEGVDKASPSRESTDAIENKPDDHQRGDKQEEKGDGEKEKVNL 852

Query: 562 KLTKKEKELQEQ---EENLRVAEIIQQSRMQSEDLQEKAWDSYKE 603
           +  KK  E++E+   ++N+   ++ +    +S+D  E   D  KE
Sbjct: 853 EEWKKHDEIKEESSKQDNVTGGDVKKSPPKESKDTMESKRDDQKE 897


>gi|71980604|ref|NP_001020990.1| UNCoordinated family member (unc-89) [Caenorhabditis elegans]
 gi|54607254|gb|AAV34801.1| Uncoordinated protein 89, isoform g, partially confirmed by
            transcript evidence [Caenorhabditis elegans]
          Length = 7122

 Score = 50.5 bits (119), Expect = 0.002,   Method: Composition-based stats.
 Identities = 57/231 (24%), Positives = 89/231 (38%), Gaps = 63/231 (27%)

Query: 401  EEKQRREQEAKEKADREKADKEAKEKADREKADKDL-----QEKTPIKAEGDDFGLGLPS 455
            EE +  ++++ EKAD +      KEK+  + A +D+     +EK+P K E        P+
Sbjct: 1614 EELKSPKEKSPEKADDKPKSPTKKEKSPEKSATEDVKSPTKKEKSPEKVEEK------PT 1667

Query: 456  VPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKN 515
             PT     P K+ + +EVK   KK K P T E                            
Sbjct: 1668 SPTKKESSPTKKTD-DEVKSPTKKEKSPQTVE---------------------------- 1698

Query: 516  ETPAIPTAKAPPAQAH-----KGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKEL 570
            E PA PT K    +       K  ++K P+   EKP +               TKKEK  
Sbjct: 1699 EKPASPTKKEKSPEKSVVEEVKSPKEKSPEKAEEKPKSP--------------TKKEKS- 1743

Query: 571  QEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKS---LSPDEIKQRFQK 618
             E+     V    ++ +   +  +EK     K+  S   ++ DE+K   +K
Sbjct: 1744 PEKSAAEEVKSPTKKEKSPEKSAEEKPKSPTKKESSPVKMADDEVKSPTKK 1794



 Score = 49.3 bits (116), Expect = 0.004,   Method: Composition-based stats.
 Identities = 54/230 (23%), Positives = 94/230 (40%), Gaps = 24/230 (10%)

Query: 385  TSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEK--TPI 442
            T ++K  T   ++  + E++      KE +  +K D E K    +EK+ + ++EK  +P 
Sbjct: 1646 TEDVKSPTKKEKSPEKVEEKPTSPTKKESSPTKKTDDEVKSPTKKEKSPQTVEEKPASPT 1705

Query: 443  KAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDIL 502
            K E       +  V +   K P K E  E+ K   KK K P  +  ++ +   +K +   
Sbjct: 1706 KKEKSPEKSVVEEVKSPKEKSPEKAE--EKPKSPTKKEKSPEKSAAEEVKSPTKKEKSPE 1763

Query: 503  DNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIK 562
             ++    K+ TK E+  +  A        K  ++K P+   EKP +              
Sbjct: 1764 KSAEEKPKSPTKKESSPVKMADDEVKSPTK--KEKSPEKVEEKPASP------------- 1808

Query: 563  LTKKEKELQEQ-EENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDE 611
             TKKEK  ++   E L+     ++S        +K  D  KE     P+E
Sbjct: 1809 -TKKEKTPEKSAAEELKSPTKKEKS---PSSPTKKTGDESKEKSPEKPEE 1854


>gi|71980588|ref|NP_001020985.1| UNCoordinated family member (unc-89) [Caenorhabditis elegans]
 gi|82583720|sp|O01761|UNC89_CAEEL RecName: Full=Muscle M-line assembly protein unc-89; AltName:
            Full=Uncoordinated protein 89
 gi|31746683|gb|AAP68958.1| Uncoordinated protein 89, isoform b, partially confirmed by
            transcript evidence [Caenorhabditis elegans]
          Length = 8081

 Score = 50.5 bits (119), Expect = 0.002,   Method: Composition-based stats.
 Identities = 57/231 (24%), Positives = 89/231 (38%), Gaps = 63/231 (27%)

Query: 401  EEKQRREQEAKEKADREKADKEAKEKADREKADKDL-----QEKTPIKAEGDDFGLGLPS 455
            EE +  ++++ EKAD +      KEK+  + A +D+     +EK+P K E        P+
Sbjct: 1614 EELKSPKEKSPEKADDKPKSPTKKEKSPEKSATEDVKSPTKKEKSPEKVEEK------PT 1667

Query: 456  VPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKN 515
             PT     P K+ + +EVK   KK K P T E                            
Sbjct: 1668 SPTKKESSPTKKTD-DEVKSPTKKEKSPQTVE---------------------------- 1698

Query: 516  ETPAIPTAKAPPAQAH-----KGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKEL 570
            E PA PT K    +       K  ++K P+   EKP +               TKKEK  
Sbjct: 1699 EKPASPTKKEKSPEKSVVEEVKSPKEKSPEKAEEKPKSP--------------TKKEKS- 1743

Query: 571  QEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKS---LSPDEIKQRFQK 618
             E+     V    ++ +   +  +EK     K+  S   ++ DE+K   +K
Sbjct: 1744 PEKSAAEEVKSPTKKEKSPEKSAEEKPKSPTKKESSPVKMADDEVKSPTKK 1794



 Score = 49.3 bits (116), Expect = 0.004,   Method: Composition-based stats.
 Identities = 54/230 (23%), Positives = 94/230 (40%), Gaps = 24/230 (10%)

Query: 385  TSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEK--TPI 442
            T ++K  T   ++  + E++      KE +  +K D E K    +EK+ + ++EK  +P 
Sbjct: 1646 TEDVKSPTKKEKSPEKVEEKPTSPTKKESSPTKKTDDEVKSPTKKEKSPQTVEEKPASPT 1705

Query: 443  KAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDIL 502
            K E       +  V +   K P K E  E+ K   KK K P  +  ++ +   +K +   
Sbjct: 1706 KKEKSPEKSVVEEVKSPKEKSPEKAE--EKPKSPTKKEKSPEKSAAEEVKSPTKKEKSPE 1763

Query: 503  DNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIK 562
             ++    K+ TK E+  +  A        K  ++K P+   EKP +              
Sbjct: 1764 KSAEEKPKSPTKKESSPVKMADDEVKSPTK--KEKSPEKVEEKPASP------------- 1808

Query: 563  LTKKEKELQEQ-EENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDE 611
             TKKEK  ++   E L+     ++S        +K  D  KE     P+E
Sbjct: 1809 -TKKEKTPEKSAAEELKSPTKKEKS---PSSPTKKTGDESKEKSPEKPEE 1854


>gi|1160355|gb|AAB00542.1| UNC-89 [Caenorhabditis elegans]
          Length = 6632

 Score = 50.5 bits (119), Expect = 0.002,   Method: Composition-based stats.
 Identities = 57/231 (24%), Positives = 89/231 (38%), Gaps = 63/231 (27%)

Query: 401  EEKQRREQEAKEKADREKADKEAKEKADREKADKDL-----QEKTPIKAEGDDFGLGLPS 455
            EE +  ++++ EKAD +      KEK+  + A +D+     +EK+P K E        P+
Sbjct: 1614 EELKSPKEKSPEKADDKPKSPTKKEKSPEKSATEDVKSPTKKEKSPEKVEEK------PT 1667

Query: 456  VPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKN 515
             PT     P K+ + +EVK   KK K P T E                            
Sbjct: 1668 SPTKKESSPTKKTD-DEVKSPTKKEKSPQTVE---------------------------- 1698

Query: 516  ETPAIPTAKAPPAQAH-----KGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKEL 570
            E PA PT K    +       K  ++K P+   EKP +               TKKEK  
Sbjct: 1699 EKPASPTKKEKSPEKSVVEEVKSPKEKSPEKAEEKPKSP--------------TKKEKS- 1743

Query: 571  QEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKS---LSPDEIKQRFQK 618
             E+     V    ++ +   +  +EK     K+  S   ++ DE+K   +K
Sbjct: 1744 PEKSAAEEVKSPTKKEKSPEKSAEEKPKSPTKKESSPVKMADDEVKSPTKK 1794



 Score = 49.3 bits (116), Expect = 0.004,   Method: Composition-based stats.
 Identities = 54/230 (23%), Positives = 94/230 (40%), Gaps = 24/230 (10%)

Query: 385  TSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEK--TPI 442
            T ++K  T   ++  + E++      KE +  +K D E K    +EK+ + ++EK  +P 
Sbjct: 1646 TEDVKSPTKKEKSPEKVEEKPTSPTKKESSPTKKTDDEVKSPTKKEKSPQTVEEKPASPT 1705

Query: 443  KAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDIL 502
            K E       +  V +   K P K E  E+ K   KK K P  +  ++ +   +K +   
Sbjct: 1706 KKEKSPEKSVVEEVKSPKEKSPEKAE--EKPKSPTKKEKSPEKSAAEEVKSPTKKEKSPE 1763

Query: 503  DNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIK 562
             ++    K+ TK E+  +  A        K  ++K P+   EKP +              
Sbjct: 1764 KSAEEKPKSPTKKESSPVKMADDEVKSPTK--KEKSPEKVEEKPASP------------- 1808

Query: 563  LTKKEKELQEQ-EENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDE 611
             TKKEK  ++   E L+     ++S        +K  D  KE     P+E
Sbjct: 1809 -TKKEKTPEKSAAEELKSPTKKEKS---PSSPTKKTGDESKEKSPEKPEE 1854


>gi|301621602|ref|XP_002940134.1| PREDICTED: putative sodium-coupled neutral amino acid transporter
           10-like [Xenopus (Silurana) tropicalis]
          Length = 1058

 Score = 50.5 bits (119), Expect = 0.002,   Method: Composition-based stats.
 Identities = 51/196 (26%), Positives = 90/196 (45%), Gaps = 32/196 (16%)

Query: 402 EKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPI-KAEGDDFGLGLPSVPTHS 460
           E+Q+ + E  E+ D ++       K+D E+    + ++ PI +  GDD            
Sbjct: 396 EEQKIKPEVLEREDLKEG------KSDLEEIQSQISDEKPIVEKPGDD---------RDK 440

Query: 461 VKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAI 520
            KLPPK+ E E++K  G         +T  REE +    D  D ++  G+ H     P +
Sbjct: 441 PKLPPKKLEEEQIK--GPIEVPQKEDDTKKREEVQLDRPDQGDIAVPVGEAH--RHEPPV 496

Query: 521 PTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGES---DYAGIKLTKKEKELQEQ-EEN 576
           P  +         + +KK Q++RE+   S +   ++   D   IK+ + E+E+++Q E N
Sbjct: 497 PRDEV-------AVDEKKDQEEREEKKESVVDNDDTEKKDKQEIKV-ENEQEIKDQAEAN 548

Query: 577 LRVAEIIQQSRMQSED 592
            R+ E + Q+  Q  D
Sbjct: 549 NRIKEPVPQNPPQEVD 564



 Score = 44.3 bits (103), Expect = 0.13,   Method: Composition-based stats.
 Identities = 49/216 (22%), Positives = 96/216 (44%), Gaps = 29/216 (13%)

Query: 400 QEEKQRREQEAKEKADREKADKE------AKEKADREKADKDLQE---KTPIKAEGDDFG 450
           QEE++ +++   +  D EK DK+       +E  D+ +A+  ++E   + P +   D   
Sbjct: 509 QEEREEKKESVVDNDDTEKKDKQEIKVENEQEIKDQAEANNRIKEPVPQNPPQEVDDPNK 568

Query: 451 LGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGK 510
             L + PT  VK  P  ++LE +   GK  + P   + +     E+ N D  +     GK
Sbjct: 569 QQLVNPPTPRVKEQPPFKDLEGI---GKDVEVPVEPKKNAEIAGEKNNNDFAN----PGK 621

Query: 511 THTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGES---DYAGIKLTKKE 567
                E P I   K        G +  + Q+   K   +    G++   D+A +    KE
Sbjct: 622 A---VENPPIKDEKNEQVPGDPGKEQHEVQNGEPKAGDNQAEAGKAELLDHAFLLQVIKE 678

Query: 568 KELQEQ---EENLRVAEIIQQSRM----QSEDLQEK 596
           +++Q++   ++  ++ E+I++  M    Q ED +++
Sbjct: 679 QQVQQKRLLDQQEKLLEVIKEQHMEIHQQKEDEEQQ 714


>gi|237808990|ref|YP_002893430.1| translation initiation factor IF-2 [Tolumonas auensis DSM 9187]
 gi|259491502|sp|C4L8X4|IF2_TOLAT RecName: Full=Translation initiation factor IF-2
 gi|237501251|gb|ACQ93844.1| translation initiation factor IF-2 [Tolumonas auensis DSM 9187]
          Length = 910

 Score = 50.5 bits (119), Expect = 0.002,   Method: Composition-based stats.
 Identities = 59/247 (23%), Positives = 107/247 (43%), Gaps = 29/247 (11%)

Query: 392 TVLARANAQEE-KQRREQEA-----KEKADREKADKEAKEKADREKADKDLQE----KTP 441
           +V+  A  Q+E +++  QEA     +E A  E+A K+A+ KA +E  +K  +E    K  
Sbjct: 99  SVIDEAQQQKEAEEKARQEAEKTRQEELAKAEQARKDAEAKARKEAEEKARKEAEARKQS 158

Query: 442 IKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDI 501
            +A  DD     P      VK      E ++  DE  K +E         EE +RK +  
Sbjct: 159 TEAAADDAAKS-PDEKARKVK-----AEADKRADENAK-REAEALRKKQEEEAQRKTE-- 209

Query: 502 LDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGI 561
                L  +  T+ E   I       A  ++G    + + +R   L  D+G   S +  +
Sbjct: 210 -----LEAQRKTELEAQRIAEEARRLAVENEGRWAAEEEARRRAELTDDVGEAASKF--V 262

Query: 562 KLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSL---SPDEIKQRFQK 618
           K  + E+E Q++ +  R   +++  +   E+ +E+     ++ K     +P+ ++  FQK
Sbjct: 263 KEAEAERERQDESKGRRRTGVVKAKKSPHEEAREERNSRARKGKRAKVHTPNSMQHGFQK 322

Query: 619 YAKVFYR 625
            A+   R
Sbjct: 323 PAQPVNR 329


>gi|71980586|ref|NP_001020984.1| UNCoordinated family member (unc-89) [Caenorhabditis elegans]
 gi|20198774|gb|AAB54132.2| Uncoordinated protein 89, isoform a, partially confirmed by
            transcript evidence [Caenorhabditis elegans]
          Length = 6632

 Score = 50.5 bits (119), Expect = 0.002,   Method: Composition-based stats.
 Identities = 57/231 (24%), Positives = 89/231 (38%), Gaps = 63/231 (27%)

Query: 401  EEKQRREQEAKEKADREKADKEAKEKADREKADKDL-----QEKTPIKAEGDDFGLGLPS 455
            EE +  ++++ EKAD +      KEK+  + A +D+     +EK+P K E        P+
Sbjct: 1614 EELKSPKEKSPEKADDKPKSPTKKEKSPEKSATEDVKSPTKKEKSPEKVEEK------PT 1667

Query: 456  VPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKN 515
             PT     P K+ + +EVK   KK K P T E                            
Sbjct: 1668 SPTKKESSPTKKTD-DEVKSPTKKEKSPQTVE---------------------------- 1698

Query: 516  ETPAIPTAKAPPAQAH-----KGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKEL 570
            E PA PT K    +       K  ++K P+   EKP +               TKKEK  
Sbjct: 1699 EKPASPTKKEKSPEKSVVEEVKSPKEKSPEKAEEKPKSP--------------TKKEKS- 1743

Query: 571  QEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKS---LSPDEIKQRFQK 618
             E+     V    ++ +   +  +EK     K+  S   ++ DE+K   +K
Sbjct: 1744 PEKSAAEEVKSPTKKEKSPEKSAEEKPKSPTKKESSPVKMADDEVKSPTKK 1794



 Score = 49.3 bits (116), Expect = 0.005,   Method: Composition-based stats.
 Identities = 54/230 (23%), Positives = 94/230 (40%), Gaps = 24/230 (10%)

Query: 385  TSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEK--TPI 442
            T ++K  T   ++  + E++      KE +  +K D E K    +EK+ + ++EK  +P 
Sbjct: 1646 TEDVKSPTKKEKSPEKVEEKPTSPTKKESSPTKKTDDEVKSPTKKEKSPQTVEEKPASPT 1705

Query: 443  KAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDIL 502
            K E       +  V +   K P K E  E+ K   KK K P  +  ++ +   +K +   
Sbjct: 1706 KKEKSPEKSVVEEVKSPKEKSPEKAE--EKPKSPTKKEKSPEKSAAEEVKSPTKKEKSPE 1763

Query: 503  DNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIK 562
             ++    K+ TK E+  +  A        K  ++K P+   EKP +              
Sbjct: 1764 KSAEEKPKSPTKKESSPVKMADDEVKSPTK--KEKSPEKVEEKPASP------------- 1808

Query: 563  LTKKEKELQEQ-EENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDE 611
             TKKEK  ++   E L+     ++S        +K  D  KE     P+E
Sbjct: 1809 -TKKEKTPEKSAAEELKSPTKKEKS---PSSPTKKTGDESKEKSPEKPEE 1854


>gi|244424|gb|AAB21297.1| chromogranin A [Bos taurus]
          Length = 449

 Score = 50.5 bits (119), Expect = 0.002,   Method: Composition-based stats.
 Identities = 66/277 (23%), Positives = 108/277 (38%), Gaps = 39/277 (14%)

Query: 361 IRHGNRFKAETRLAYS-----TIANVANFTSELKQATVLARANAQEEKQRREQEAKEKAD 415
           +RH N  K    LA       T     + + E + + VL + N Q E +   +E   K  
Sbjct: 70  LRHQNLLKELQDLALQGAKERTHQQKKHSSYEDELSEVLEKPNDQAEPKEVTEEVSSKDA 129

Query: 416 REKADKEAKEKADREKADKDLQEKTP-----IKAEGDDFGLG-----------LPSVPTH 459
            EK D   + +   E +D D  + +P      K E D+   G           L S+P  
Sbjct: 130 AEKRDDFKEVEKSDEDSDGDRPQASPGLGPGPKVEEDNQAPGEEEEAPSNAHPLASLP-- 187

Query: 460 SVKLP-PKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETP 518
           S K P P+ +E  E   +G   +E G +    R+    + ++  + +    K   + E+P
Sbjct: 188 SPKHPGPQAKEDSEGPSQGPASREKGLSAEQGRQTEREEEEEKWEEAEAREKAVPEEESP 247

Query: 519 AIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKEL----QEQE 574
                KAPP+  +K       + QR  P   + G G+      K  + + E     QE+E
Sbjct: 248 PTAAFKAPPSLGNK-------ETQRAAPGWPEDGAGKMGAEEAKPPEGKGEWAHSRQEEE 300

Query: 575 ENLRVAEIIQQSRMQSEDLQE----KAWDSYKEWKSL 607
           E  R  +++ +     E  QE    K W+  K W  +
Sbjct: 301 EMARAPQVLFRGGKSGEPEQEEQLSKEWEDAKRWSKM 337


>gi|198|emb|CAA27636.1| chromogranin A [Bos taurus]
 gi|86822126|gb|AAI05516.1| CHGA protein [Bos taurus]
          Length = 449

 Score = 50.1 bits (118), Expect = 0.002,   Method: Composition-based stats.
 Identities = 65/277 (23%), Positives = 106/277 (38%), Gaps = 39/277 (14%)

Query: 361 IRHGNRFKAETRLAYS-----TIANVANFTSELKQATVLARANAQEEKQRREQEAKEKAD 415
           +RH N  K    LA       T     + + E + + VL + N Q E +   +E   K  
Sbjct: 70  LRHQNLLKELQDLALQGAKERTHQQKKHSSYEDELSEVLEKPNDQAEPKEVTEEVSSKDA 129

Query: 416 REKADKEAKEKADREKADKDLQEKTP-----IKAEGDDFGLG-----------LPSVPTH 459
            EK D   + +   E +D D  + +P      K E D+   G           L S+P  
Sbjct: 130 AEKRDDSKEVEKSDEDSDGDRPQASPGLGPGPKVEEDNQAPGEEEEAPSNAHPLASLP-- 187

Query: 460 SVKLP-PKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETP 518
           S K P P+ +E  E   +G   +E G +    R+    + ++  + +    K   + E+P
Sbjct: 188 SPKYPGPQAKEDSEGPSQGPASREKGLSAEQGRQTEREEEEEKWEEAEAREKAVPEEESP 247

Query: 519 AIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKEL----QEQE 574
                K PP+  +K       + QR  P   + G G+      K  + + E     QE+E
Sbjct: 248 PTAAFKPPPSLGNK-------ETQRAAPGWPEDGAGKMGAEEAKPPEGKGEWAHSRQEEE 300

Query: 575 ENLRVAEIIQQSRMQSEDLQE----KAWDSYKEWKSL 607
           E  R  +++       E  QE    K W+  K W  +
Sbjct: 301 EMARAPQVLFHGGKSGEPKQEEQLSKEWEDAKRWSKM 337


>gi|182685128|ref|YP_001836875.1| choline binding protein A [Streptococcus pneumoniae CGSP14]
 gi|182630462|gb|ACB91410.1| choline binding protein A [Streptococcus pneumoniae CGSP14]
          Length = 720

 Score = 50.1 bits (118), Expect = 0.002,   Method: Composition-based stats.
 Identities = 56/235 (23%), Positives = 106/235 (45%), Gaps = 51/235 (21%)

Query: 395 ARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLP 454
           A+A  + EK    +  K K DREKA++EAK +AD ++ D+  + K+ +K  GD   LG  
Sbjct: 214 AKAKVESEKAEATRLKKIKTDREKAEEEAKRRADAKEQDESKRRKSRVK-RGD---LGEQ 269

Query: 455 SVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTK 514
           + P                    KK  +  ++++   EET      +   SL  GK    
Sbjct: 270 ATPD-------------------KKENDAKSSDSSVGEET------LPSPSLKPGKK--- 301

Query: 515 NETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLAS----DIGVGESDY----AGIKLTKK 566
                +  A+    +A K  +D+K +D+R  P  +    ++ + ESD     A ++L K+
Sbjct: 302 -----VAEAQKKVEEAKKKAKDQKEEDRRNYPTNTYKTLELEIAESDVKVKEAELELVKE 356

Query: 567 EKELQEQEENLRVAEI------IQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQR 615
           E +  + EE ++ A+        + +R+++     K  +   + K+   D++K++
Sbjct: 357 EAKESQNEEKIKQAKAKVESKKAEATRLENIKTDRKKAEEEAKRKAAEEDKVKEK 411


>gi|57999440|emb|CAI45931.1| hypothetical protein [Homo sapiens]
          Length = 2039

 Score = 49.7 bits (117), Expect = 0.003,   Method: Composition-based stats.
 Identities = 111/617 (17%), Positives = 252/617 (40%), Gaps = 79/617 (12%)

Query: 369  AETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKAD 428
             E RL Y       +FT +  Q          E+K   EQ+ K + +R   D +A +  +
Sbjct: 1369 GEWRLKYERAVREVDFTKKRLQQEF-------EDKLEVEQQNKRQLERRLGDLQA-DSEE 1420

Query: 429  REKADKDLQEKTP-IKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTE 487
             ++A + L++K   + AE  D  L L      + +L  K+   +    E  +  E    E
Sbjct: 1421 SQRALQQLKKKCQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDS---ELSQAHEEAQRE 1477

Query: 488  TDDREETERKNQDILDNSL-LAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKP 546
               RE+ +R+   +L  +  L  +   K+   A  T K    +A   +QD   Q+ +++ 
Sbjct: 1478 KLQREKLQREKDMLLAEAFSLKQQLEEKDMDIAGFTQKVVSLEAE--LQDISSQESKDEA 1535

Query: 547  LASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKS 606
              + +     D    K+  +E+EL EQ   +   ++++Q++++ E   E+   ++ +   
Sbjct: 1536 SLAKVKKQLRDLEA-KVKDQEEELDEQAGTI---QMLEQAKLRLEMEMERMRQTHSKEME 1591

Query: 607  LSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSP 666
               +E+++  Q   K   +    ++  Y+  Q+  +             ++     Q + 
Sbjct: 1592 SRDEEVEEARQSCQKKLKQMEVQLEEEYEDKQKVLREKRELEG------KLATLSDQVNR 1645

Query: 667  LGLMYEK---DELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGE----SSVR 719
                 EK    +L   +A+     ++  H ++N   +K  +  +   +E  E    ++V+
Sbjct: 1646 RDFESEKRLRKDLKRTKALLADAQLMLDH-LKNSAPSKREIAQLKNQLEESEFTCAAAVK 1704

Query: 720  ----------------------KHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKED-- 755
                                  K + E   S+ Q+    + N ++E      +L+K+   
Sbjct: 1705 ARKAMEVEIEDLHLQIDDIAKAKTALEEQLSRLQREKNEIQNRLEEDQEDMNKLMKKHKA 1764

Query: 756  --PKRGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLYTIISGSEKIL 813
               +  +  + ++D++++L++ NK   +++ KL+      +  ++     +++S  E  +
Sbjct: 1765 AVAQASRDLAQINDLQAQLEEANKEKQELQEKLQALQSQVEFLEQSMVDKSLVSRQEAKI 1824

Query: 814  QGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIK--EERYWTIYAFERSLKNQAH 871
            +          L+ + +F+ +  K  E        N  K  EER   I A  R  +    
Sbjct: 1825 R---------ELETRLEFERTQVKRLESLASRLKENMEKLTEERDQRIAAENREKEQNKR 1875

Query: 872  LNAEV----ERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIK 927
            L  ++    E + GLA++ ++++    EL+  L       E+ ++ + + ++  F+R I 
Sbjct: 1876 LQRQLRDTKEEMGGLARKEAEASRKKHELEMDLESL----EAANQSLQADLKLAFKR-IG 1930

Query: 928  ELKSVIEADAKENPNPN 944
            +L++ IE + + + N +
Sbjct: 1931 DLQAAIEDEMESDENED 1947


>gi|325911031|gb|ADZ45244.1| pneumococcal surface protein C [Streptococcus pneumoniae]
          Length = 713

 Score = 49.7 bits (117), Expect = 0.003,   Method: Composition-based stats.
 Identities = 57/224 (25%), Positives = 105/224 (46%), Gaps = 42/224 (18%)

Query: 386 SELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAE 445
           +EL+   V A+  +Q+E++ ++ EA+ ++ + +A +  K K DRE+A +    K     E
Sbjct: 192 AELELVKVKAK-ESQDEEKIKQAEAEVESKQAEATRLKKIKTDREEAKRKADAKLKEAVE 250

Query: 446 GDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQD----- 500
            +        V T          E ++ K   K+G   G   T D++E + K+ D     
Sbjct: 251 KN--------VAT---------SEQDKPKRRAKRGVS-GELATPDKKENDAKSSDSSVGE 292

Query: 501 --ILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLAS----DIGVG 554
             +   SL +GK         +  A+   A+A K  +D+K +D+R  P  +    D+ + 
Sbjct: 293 ETLPSPSLKSGKK--------VAEAEKKVAEAEKKAKDQKEEDRRNYPTNTYKTLDLEIA 344

Query: 555 ESDYAGIKLTKKEKEL-QEQEENLRVAEIIQQSRMQSEDLQEKA 597
           ESD   +K+ + E EL +E+ +  R  E I Q++ + E  + +A
Sbjct: 345 ESD---VKVKEAELELVKEEAKGSRNEEKINQAKAEVESKKAEA 385


>gi|154274049|ref|XP_001537876.1| hypothetical protein HCAG_07298 [Ajellomyces capsulatus NAm1]
 gi|150415484|gb|EDN10837.1| hypothetical protein HCAG_07298 [Ajellomyces capsulatus NAm1]
          Length = 790

 Score = 49.7 bits (117), Expect = 0.003,   Method: Composition-based stats.
 Identities = 49/241 (20%), Positives = 99/241 (41%), Gaps = 38/241 (15%)

Query: 379 ANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKA----DKEAKEKADREKADK 434
           AN  + +   KQAT LA + +   +++R+  +  +AD E+A    DK+     D +K + 
Sbjct: 20  ANAGSASLPKKQAT-LAFSTSSGSREKRQNGSATQADEEEALVNGDKDVDMNNDAKKKE- 77

Query: 435 DLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREET 494
                              P + +   + P  E    +     +K      ++  D ++ 
Sbjct: 78  -------------------PKIDSRGSETPAAESRESDSDSAAEKSLSHSDSDFPDSKKL 118

Query: 495 ERKNQDILDN--SLLAGKTHTKNETPAI--PTAKAPPAQAHKGIQDKKPQDQREKPLASD 550
           +R+   + D+  S +   T  +   P+      K P A  ++  + + P   REKP+A D
Sbjct: 119 KREKSPMEDSDESDVQPVTKRRKRAPSNRETAGKKPSASQNQNKRTRSPNKAREKPVAED 178

Query: 551 IGVGESDYAGIKLTKKEKELQEQEENL--RVAEIIQQSRMQSEDLQEKAWDSYKEWKSLS 608
                ++   I ++  + +L E++  +  +  E +QQ+   S +      D Y +WK+  
Sbjct: 179 KESSSAEQEDI-ISDNDDDLAEEKPKIAQKKRETVQQALKGSRE------DPYPDWKAGE 231

Query: 609 P 609
           P
Sbjct: 232 P 232


>gi|109080838|ref|XP_001108014.1| PREDICTED: microtubule-associated protein 1A isoform 2 [Macaca
            mulatta]
          Length = 3042

 Score = 49.7 bits (117), Expect = 0.004,   Method: Composition-based stats.
 Identities = 68/283 (24%), Positives = 118/283 (41%), Gaps = 32/283 (11%)

Query: 387  ELKQATVLARANAQEEKQRREQEAKEKADREKADK--EAKEKADREKADKDLQEKTPIKA 444
            ++K   V  +  A E+K R + E K+ A  E+ DK  E K+K D E+ DK L++K  I  
Sbjct: 1634 DIKNEAVKEQDKALEQKGR-DLEQKDTA-LEQKDKALEPKDK-DLEEKDKALEQKDKIPE 1690

Query: 445  EGDD-FGLGLPSVPTHSVKLPPKEEELEEVKDE--GKKGKEPGTTETDDREETERKNQDI 501
            E D        ++      L PK+++LE+ KD    KK K P   +    ++  R     
Sbjct: 1691 EKDKALEQKDTALEQKDKALEPKDKDLEQ-KDRVLEKKDKIPEEIDKALDQKVRRVEHKA 1749

Query: 502  LDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGI 561
             ++++   K     +T   P  K    +    I +KK Q   +K  A    +G+ D A  
Sbjct: 1750 PEDTVTEMKGRDLEQTDKAPEQKHQAQEQKDKISEKKDQALEQKYWA----LGQKDEA-- 1803

Query: 562  KLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAK 621
                        E+N++  E   Q++ Q   LQE      K  +  SP+++K   +K   
Sbjct: 1804 -----------LEQNIKALEEKDQTQEQESLLQEDKTRKPKMLEEKSPEKVKAMEEKLEA 1852

Query: 622  VFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQW 664
            +  ++ +       G +ES          +  Y+R  + + +W
Sbjct: 1853 LLEKTKA------LGLEESLVQEGKARKQEEKYWRGQDVVQEW 1889


>gi|116548|sp|P05059|CMGA_BOVIN RecName: Full=Chromogranin-A; Short=CgA; AltName: Full=Pituitary
           secretory protein I; Short=SP-I; Contains: RecName:
           Full=Vasostatin-1; Contains: RecName: Full=Chromostatin;
           Contains: RecName: Full=Chromacin; Contains: RecName:
           Full=Pancreastatin; Contains: RecName: Full=WE-14;
           Contains: RecName: Full=Catestatin; Flags: Precursor
          Length = 449

 Score = 49.3 bits (116), Expect = 0.004,   Method: Composition-based stats.
 Identities = 65/277 (23%), Positives = 107/277 (38%), Gaps = 39/277 (14%)

Query: 361 IRHGNRFKAETRLAYS-----TIANVANFTSELKQATVLARANAQEEKQRREQEAKEKAD 415
           +RH N  K    LA       T     + + E + + VL + N Q E +   +E   K  
Sbjct: 70  LRHQNLLKELQDLALQGAKERTHQQKKHSSYEDELSEVLEKPNDQAEPKEVTEEVSSKDA 129

Query: 416 REKADKEAKEKADREKADKDLQEKTP-----IKAEGDDFGLG-----------LPSVPTH 459
            EK D   + +   E +D D  + +P      K E D+   G           L S+P  
Sbjct: 130 AEKRDDFKEVEKSDEDSDGDRPQASPGLGPGPKVEEDNQAPGEEEEAPSNAHPLASLP-- 187

Query: 460 SVKLP-PKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETP 518
           S K P P+ +E  E   +G   +E G +    R+    + ++  + +    K   + E+P
Sbjct: 188 SPKYPGPQAKEDSEGPSQGPASREKGLSAEQGRQTEREEEEEKWEEAEAREKAVPEEESP 247

Query: 519 AIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKEL----QEQE 574
                K PP+  +K       + QR  P   + G G+      K  + + E     QE+E
Sbjct: 248 PTAAFKPPPSLGNK-------ETQRAAPGWPEDGAGKMGAEEAKPPEGKGEWAHSRQEEE 300

Query: 575 ENLRVAEIIQQSRMQSEDLQE----KAWDSYKEWKSL 607
           E  R  +++ +     E  QE    K W+  K W  +
Sbjct: 301 EMARAPQVLFRGGKSGEPEQEEQLSKEWEDAKRWSKM 337


>gi|68271041|gb|AAY89041.1| Gar [Bacillus cereus]
          Length = 588

 Score = 49.3 bits (116), Expect = 0.004,   Method: Composition-based stats.
 Identities = 54/238 (22%), Positives = 94/238 (39%), Gaps = 53/238 (22%)

Query: 334 LGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATV 393
           + G T   +  + D +++V AD +        +  A   + +  +A+ +N + E  Q T+
Sbjct: 93  MAGDTSGWLYDVNDKSAEVGADSY--------KLNAGDVVVFRFVADWSNMSQETLQQTL 144

Query: 394 LARANAQE-EKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLG 452
                 +  E+ + +   +EK +  K D   +EK +  K D   QEK P + + DD    
Sbjct: 145 DKFGTCKTVEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEK-PEEPKTDD---- 199

Query: 453 LPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTH 512
                       PK+E+ EE K +  K ++P   +TDD ++                   
Sbjct: 200 ------------PKQEKPEEPKTDDPKQEKPEEPKTDDPKQ------------------- 228

Query: 513 TKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKEL 570
            K E P     + P AQ +  I         EK L   I   ESD+  + L++  K +
Sbjct: 229 EKPEQPKQENIQVPAAQVNDAISKTS-----EKMLQDGI---ESDWVALGLSRSGKNV 278


>gi|30794306|ref|NP_851348.1| chromogranin-A [Bos taurus]
 gi|1890672|gb|AAC48700.1| chromogranin A [Bos taurus]
          Length = 449

 Score = 49.3 bits (116), Expect = 0.005,   Method: Composition-based stats.
 Identities = 65/277 (23%), Positives = 107/277 (38%), Gaps = 39/277 (14%)

Query: 361 IRHGNRFKAETRLAYS-----TIANVANFTSELKQATVLARANAQEEKQRREQEAKEKAD 415
           +RH N  K    LA       T     + + E + + VL + N Q E +   +E   K  
Sbjct: 70  LRHQNLLKELQDLALQGAKERTHQQKKHSSYEDELSEVLEKPNDQAEPKEVTEEVSSKDA 129

Query: 416 REKADKEAKEKADREKADKDLQEKTP-----IKAEGDDFGLG-----------LPSVPTH 459
            EK D   + +   E +D D  + +P      K E D+   G           L S+P  
Sbjct: 130 AEKRDDFKEVEKSDEDSDGDRPQASPGLGPGPKVEEDNQAPGEEEEAPSNAHPLASLP-- 187

Query: 460 SVKLP-PKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETP 518
           S K P P+ +E  E   +G   +E G +    R+    + ++  + +    K   + E+P
Sbjct: 188 SPKYPGPQAKEDSEGPSQGPASREKGLSAEQGRQTEREEEEEKWEEAEAREKAVPEEESP 247

Query: 519 AIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKEL----QEQE 574
                K PP+  +K       + QR  P   + G G+      K  + + E     QE+E
Sbjct: 248 PTAAFKPPPSLGNK-------ETQRAAPGWPEDGAGKMGAEEAKPPEGKGEWSHSRQEEE 300

Query: 575 ENLRVAEIIQQSRMQSEDLQE----KAWDSYKEWKSL 607
           E  R  +++ +     E  QE    K W+  K W  +
Sbjct: 301 EMARAPQVLFRGGKSGEPEQEEQLSKEWEDAKRWSKM 337


>gi|8163655|gb|AAF73785.1|AF154017_1 surface protein PspC [Streptococcus pneumoniae]
          Length = 699

 Score = 49.3 bits (116), Expect = 0.005,   Method: Composition-based stats.
 Identities = 59/235 (25%), Positives = 109/235 (46%), Gaps = 47/235 (20%)

Query: 395 ARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLP 454
           A+A  + E+    +  K K DREKA++EAK +AD ++ D+  + K+ +K  GD   LG P
Sbjct: 211 AKAKVESEQAEATRLKKIKTDREKAEEEAKRRADAKEQDESKRRKSRVK-RGD---LGEP 266

Query: 455 SVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTK 514
           + P                    KK  +  ++++   EET      +   SL  GK    
Sbjct: 267 ATPD-------------------KKDNDAKSSDSSVGEET------LPSPSLKPGKK--- 298

Query: 515 NETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLAS----DIGVGESDYAGIKLTKKEKEL 570
                +  A+    +A K  +D+K +D R  P  +    ++ + ESD   +++ K E EL
Sbjct: 299 -----VADAEKKVEEAEKKAKDQKEEDHRNYPTITYKTLELEIAESD---VEVKKAELEL 350

Query: 571 -QEQEENLRVAEIIQQSRMQSEDLQEKA--WDSYKEWKSLSPDEIKQRFQKYAKV 622
            +E+ +  R  E ++Q++ + E  + +A   +  K  +  + +E K++  +  KV
Sbjct: 351 VKEEAKGSRNEEKVKQAKAEVESKKAEATRLEKIKTDRKKAEEEAKRKAAEEDKV 405


>gi|8163678|gb|AAF73797.1|AF154028_1 surface protein PspC [Streptococcus pneumoniae]
          Length = 730

 Score = 48.9 bits (115), Expect = 0.005,   Method: Composition-based stats.
 Identities = 54/226 (23%), Positives = 107/226 (47%), Gaps = 27/226 (11%)

Query: 381 VANFTSELKQATV-LARANAQE---EKQRREQEAKEKADREKADKEAKEKADREKADKDL 436
           +A    E+K+A + L +  A+E   +++ ++ EAK ++ + +A +    K DREKA+++ 
Sbjct: 177 IAESDVEVKKAELELVKEEAKESRDDEKIKQAEAKVESKKAEATRLENIKTDREKAEEEA 236

Query: 437 QEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETER 496
           + +   K +              SV+      E ++ K   K+G  PG   T D++E + 
Sbjct: 237 KRRAEAKLK-------------ESVEKNVATSEQDKPKGRRKRGV-PGEQATPDKKENDA 282

Query: 497 KNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLAS----DIG 552
           K+ D             K E   +  A+   A+A K  + +K +D+R  P  +    ++ 
Sbjct: 283 KSSDSSVGEEALPSPSLKPEK-KVAEAEKKVAEAEKKAKAQKEEDRRNYPTNTYKTLELE 341

Query: 553 VGESDYAGIKLTKKEKEL-QEQEENLRVAEIIQQSRMQSEDLQEKA 597
           + ESD   +K+ + E EL +E+ +  R  E + Q++ + E  + +A
Sbjct: 342 IAESD---VKVKEAELELVKEEAKESRNEEKVNQAKAKVESKKAEA 384



 Score = 40.5 bits (93), Expect = 2.0,   Method: Composition-based stats.
 Identities = 39/184 (21%), Positives = 77/184 (41%), Gaps = 7/184 (3%)

Query: 396 RANAQEEKQRR-EQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGD----DFG 450
           R  A+EE +RR E + KE  ++  A  E  +   R K     ++ TP K E D    D  
Sbjct: 229 REKAEEEAKRRAEAKLKESVEKNVATSEQDKPKGRRKRGVPGEQATPDKKENDAKSSDSS 288

Query: 451 LGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGK 510
           +G  ++P+ S+K  P+++  E  K   +  K+    + +DR          L+  +    
Sbjct: 289 VGEEALPSPSLK--PEKKVAEAEKKVAEAEKKAKAQKEEDRRNYPTNTYKTLELEIAESD 346

Query: 511 THTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKEL 570
              K     +   +A  ++  + +   K + + +K  A+ +   ++D    +   K K  
Sbjct: 347 VKVKEAELELVKEEAKESRNEEKVNQAKAKVESKKAEATRLEKIKTDRKKAEEEAKRKAA 406

Query: 571 QEQE 574
           +E +
Sbjct: 407 EEDK 410


>gi|325911056|gb|ADZ45256.1| pneumococcal surface protein C [Streptococcus pneumoniae]
          Length = 700

 Score = 48.9 bits (115), Expect = 0.005,   Method: Composition-based stats.
 Identities = 56/235 (23%), Positives = 106/235 (45%), Gaps = 51/235 (21%)

Query: 395 ARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLP 454
           A+A  + EK    +  K K DREKA++EAK +AD ++ D+  + K+ +K  GD   LG  
Sbjct: 214 AKAKVESEKAEATRLKKIKTDREKAEEEAKRRADAKEQDESKRRKSRVK-RGD---LGEQ 269

Query: 455 SVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTK 514
           + P                    KK  +  ++++   EET      +   SL  GK    
Sbjct: 270 ATPD-------------------KKENDAKSSDSSVGEET------LPSPSLKPGKK--- 301

Query: 515 NETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLAS----DIGVGESDY----AGIKLTKK 566
                +  A+    +A K  +D+K +D+R  P  +    ++ + ESD     A ++L K+
Sbjct: 302 -----VAEAQKKVEEAKKKAKDQKEEDRRNYPTNTYKTLELEIAESDVKVKEAELELVKE 356

Query: 567 EKELQEQEENLRVAEI------IQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQR 615
           E +  + EE ++ A+        + +R+++     K  +   + K+   D++K++
Sbjct: 357 EAKESQNEEKIKQAKAKVESKKAEATRLENIKTDRKKAEEEAKRKAAEEDKVKEK 411


>gi|325911048|gb|ADZ45252.1| pneumococcal surface protein C [Streptococcus pneumoniae]
          Length = 700

 Score = 48.9 bits (115), Expect = 0.005,   Method: Composition-based stats.
 Identities = 56/235 (23%), Positives = 106/235 (45%), Gaps = 51/235 (21%)

Query: 395 ARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLP 454
           A+A  + EK    +  K K DREKA++EAK +AD ++ D+  + K+ +K  GD   LG  
Sbjct: 214 AKAKVESEKAEATRLKKIKTDREKAEEEAKRRADAKEQDESKRRKSRVK-RGD---LGEQ 269

Query: 455 SVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTK 514
           + P                    KK  +  ++++   EET      +   SL  GK    
Sbjct: 270 ATPD-------------------KKENDAKSSDSSVGEET------LPSPSLKPGKK--- 301

Query: 515 NETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLAS----DIGVGESDY----AGIKLTKK 566
                +  A+    +A K  +D+K +D+R  P  +    ++ + ESD     A ++L K+
Sbjct: 302 -----VAEAQKKVEEAKKKAKDQKEEDRRNYPTNTYKTLELEIAESDVKVKEAELELVKE 356

Query: 567 EKELQEQEENLRVAEI------IQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQR 615
           E +  + EE ++ A+        + +R+++     K  +   + K+   D++K++
Sbjct: 357 EAKESQNEEKIKQAKAKVESKKAEATRLENIKTDRKKAEEEAKRKAAEEDKVKEK 411


>gi|171915198|ref|ZP_02930668.1| 3-hydroxyisobutyrate dehydrogenase [Verrucomicrobium spinosum DSM
           4136]
          Length = 1014

 Score = 48.9 bits (115), Expect = 0.005,   Method: Composition-based stats.
 Identities = 48/175 (27%), Positives = 78/175 (44%), Gaps = 24/175 (13%)

Query: 386 SELKQA-TVLARANAQEEKQRREQEAKE--KADREKADKEAKEKADREKADKDLQEKTPI 442
           SE K A T  A    Q++ +++E++  E   A    A+K+  EK+  EKA K  ++    
Sbjct: 472 SESKDASTATAETKDQQKDEKKEKDVPEIKVAGDAPAEKKEGEKSAAEKAQKTARDSDEK 531

Query: 443 KAEGDDFGLGLPSVPTHS-VKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDI 501
           KAE        P  PT S +  PP       +   G K   PG+ +T+D  ++ +  +  
Sbjct: 532 KAE--------PDAPTPSGLPKPPA------IAKAGLKPSAPGSDKTEDIPDS-KLAEGT 576

Query: 502 LDNSLLAGKTHTKNETPAIPTAKAPP--AQAHKGIQ---DKKPQDQREKPLASDI 551
            D+S +   +    +T   P  K P   ++  +GI     K  QDQ   P+A D+
Sbjct: 577 ADSSKVEKPSSAPAQTEVAPAVKQPSFVSRLFRGITGRGKKDKQDQATPPVAKDV 631


>gi|324511487|gb|ADY44780.1| Negative elongation factor A [Ascaris suum]
          Length = 503

 Score = 48.9 bits (115), Expect = 0.006,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 50/97 (51%), Gaps = 9/97 (9%)

Query: 402 EKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAE----GDDFGLGLPSVP 457
           +++RREQEA+EKA +    +E K+K   EKA+++ +    IK E     D+     PSVP
Sbjct: 272 KQRRREQEAEEKAKKLLEKQELKKKHQAEKAEREARRSAAIKFEPTHINDESAKAGPSVP 331

Query: 458 THSVKLPPKEEELEEVKDEG---KKGKEPGTTETDDR 491
           T  V   P E+  E   ++    +  K+P   +  +R
Sbjct: 332 T--VSSAPNEQITEPTSEQATSPRPEKQPSYADVRER 366


>gi|332848164|ref|XP_511371.3| PREDICTED: myosin-XVIIIa [Pan troglodytes]
          Length = 1607

 Score = 48.2 bits (113), Expect = 0.009,   Method: Composition-based stats.
 Identities = 114/601 (18%), Positives = 246/601 (40%), Gaps = 68/601 (11%)

Query: 369  AETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKAD 428
             E RL Y       +FT +  Q          E+K   EQ+ K + +R   D +A +  +
Sbjct: 1046 GEWRLKYERAVREVDFTKKRLQQEF-------EDKLEVEQQNKRQLERRLGDLQA-DSEE 1097

Query: 429  REKADKDLQEKTP-IKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTE 487
             ++A + L++K   + AE  D  L L      + +L  K+   +    E  +  E    E
Sbjct: 1098 SQRALQQLKKKCQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDS---ELSQAHEEAQRE 1154

Query: 488  TDDREETERKNQDILDNSL-LAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKP 546
               RE+ +R+   +L  +  L  +   K+   A  T K    +A   +QD   Q+ +++ 
Sbjct: 1155 KLQREKLQREKDMLLAEAFSLKQQLEEKDMDIAGFTQKVVSLEAE--LQDISSQESKDEA 1212

Query: 547  LASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKS 606
              + +     D    K+  +E+EL EQ   +   ++++Q++++ E   E+   ++ +   
Sbjct: 1213 SLAKVKKQLRDLEA-KVKDQEEELDEQAGTI---QMLEQAKLRLEMEMERMRQTHSKEME 1268

Query: 607  LSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQ-------ESDKAINHFLDNDFGYYRIHN 659
               +E+++  Q   K   +    ++  Y+  Q       E +  +    D         N
Sbjct: 1269 SRDEEVEEARQSCQKKLKQMEVQLEEEYEDKQKVLREKRELEGKLATLSDQXXXXXXXXN 1328

Query: 660  FLSQW---SPLGLMYEKDELHGVE---AVYQKLDVLFRHCIENLRANKNAVDAMSKAVEA 713
             L +    +   L   +++L   E   A   K        IE+L      +D ++KA  A
Sbjct: 1329 HLKETVLPASERLPSSRNQLEESEFTCAAAVKARKAMEVEIEDLHLQ---IDDIAKAKTA 1385

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKED----PKRGKSESYLSDIR 769
             E  +         S+ Q+    + N ++E       L+K+      +  +  + ++D++
Sbjct: 1386 LEEQL---------SRLQREKNEIQNRLEEDQEDMNELMKKHKAAVAQASRDLAQINDLQ 1436

Query: 770  SELQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLYTIISGSEKILQGDYTFPPLSSLDVQS 829
            ++L++ NK   +++ KL+      +  ++     +++S  E  ++          L+ + 
Sbjct: 1437 AQLEEANKEKQELQEKLQALQSQVEFLEQSMVDKSLVSRQEAKIR---------ELETRL 1487

Query: 830  KFDSSYSKLFEIFYGDWTNNAIK--EERYWTIYAFERSLKNQAHLNAEV----ERLSGLA 883
            +F+ +  K  E        N  K  EER   I A  R  +    L  ++    E +  LA
Sbjct: 1488 EFERTQVKRLESLASRLKENMEKLTEERDQRIAAENREKEQNKRLQRQLRDTKEEMGELA 1547

Query: 884  QQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIKELKSVIEADAKENPNP 943
            ++ ++++    EL+  L       E+ ++ + + ++  F+R I +L++ IE + + + N 
Sbjct: 1548 RKEAEASRKKHELEMDLESL----EAANQSLQADLKLAFKR-IGDLQAAIEDEMESDENE 1602

Query: 944  N 944
            +
Sbjct: 1603 D 1603


>gi|46111823|ref|XP_382969.1| hypothetical protein FG02793.1 [Gibberella zeae PH-1]
          Length = 1139

 Score = 48.2 bits (113), Expect = 0.010,   Method: Composition-based stats.
 Identities = 69/316 (21%), Positives = 126/316 (39%), Gaps = 40/316 (12%)

Query: 345 LRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQE--- 401
           L++  S ++AD   A+    NRFK  T L    +         L+Q +   +A  +E   
Sbjct: 677 LKEKTSTLQADLGAAQQLAQNRFKDLTELR-EVLQKAQPELKSLRQESATLKATKEELAN 735

Query: 402 -EKQRREQEAKEKADREKADKEAKEKADREKADKDLQ----------------------- 437
             K+ R+ E +EK  +   ++  K  +DRE   K LQ                       
Sbjct: 736 KTKELRDMEKREKDLKRDVERAQKISSDRETEIKSLQEKLTVETNAKLRLEDAQRVSGRD 795

Query: 438 ------EKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDR 491
                 EK  I    D     L SV     KL PK +ELEE   + K+ K     E D +
Sbjct: 796 LRRSEAEKVEISGRADKAEQELQSVQEELSKLRPKVKELEEQMHKLKREKAASQEEADFK 855

Query: 492 EETERKNQDILD---NSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLA 548
            +     Q +L    +         K       + +   A+  + +Q++  + +  + L 
Sbjct: 856 TQQYSNAQGLLSSMRDQTAEMSVQLKESKSQAESLEEELAEVQRLLQERTREGETMRRLL 915

Query: 549 SDIGVGESDYAGIKLTKKEKELQEQEE-NLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSL 607
           +D+     +       + E  ++E++      A + ++   ++EDL++K  D  +E K+L
Sbjct: 916 ADVDERADNKVRDMRARMEAAVEERDRIEDESATLARRKTRETEDLKQKLKDLEREVKTL 975

Query: 608 S--PDEIKQRFQKYAK 621
           +   DE++QR +++ K
Sbjct: 976 THERDELEQREKEWRK 991


>gi|325911068|gb|ADZ45262.1| pneumococcal surface protein C [Streptococcus pneumoniae]
          Length = 729

 Score = 48.2 bits (113), Expect = 0.010,   Method: Composition-based stats.
 Identities = 55/233 (23%), Positives = 110/233 (47%), Gaps = 28/233 (12%)

Query: 375 YSTIA-NVANFTSELKQATV-LARANAQE---EKQRREQEAKEKADREKADKEAKEKADR 429
           Y T+   +A    E+K+A + L +  A+E   +++ ++ EAK ++ + +A +    K DR
Sbjct: 170 YKTLELEIAESDVEVKKAELELVKEEAKESRDDEKIKQAEAKVESKKAEATRLENIKTDR 229

Query: 430 EKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETD 489
           EKA+++ + +   K +              +V+      E ++ K   K+G  PG   T 
Sbjct: 230 EKAEEEAKRRAEAKLK-------------EAVEKNVATSEQDKPKGRRKRGV-PGEQATP 275

Query: 490 DREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLAS 549
           D++E + K+ D             K E   +  A+   A+A K  + +K +D+R  P  +
Sbjct: 276 DKKENDAKSSDSSVGEEALPSPSLKPEK-KVAEAEKKVAEAEKKAKAQKEEDRRNYPTNT 334

Query: 550 ----DIGVGESDYAGIKLTKKEKEL-QEQEENLRVAEIIQQSRMQSEDLQEKA 597
               ++ + ESD   +K+ + E EL +E+ +  R  E + Q++ + E  + +A
Sbjct: 335 YKTLELEIAESD---VKVKEAELELVKEEAKESRNEEKVNQAKAKVESKKAEA 384



 Score = 40.5 bits (93), Expect = 2.1,   Method: Composition-based stats.
 Identities = 39/184 (21%), Positives = 77/184 (41%), Gaps = 7/184 (3%)

Query: 396 RANAQEEKQRR-EQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGD----DFG 450
           R  A+EE +RR E + KE  ++  A  E  +   R K     ++ TP K E D    D  
Sbjct: 229 REKAEEEAKRRAEAKLKEAVEKNVATSEQDKPKGRRKRGVPGEQATPDKKENDAKSSDSS 288

Query: 451 LGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGK 510
           +G  ++P+ S+K  P+++  E  K   +  K+    + +DR          L+  +    
Sbjct: 289 VGEEALPSPSLK--PEKKVAEAEKKVAEAEKKAKAQKEEDRRNYPTNTYKTLELEIAESD 346

Query: 511 THTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKEL 570
              K     +   +A  ++  + +   K + + +K  A+ +   ++D    +   K K  
Sbjct: 347 VKVKEAELELVKEEAKESRNEEKVNQAKAKVESKKAEATRLEKIKTDRKKAEEEAKRKAA 406

Query: 571 QEQE 574
           +E +
Sbjct: 407 EEDK 410


>gi|269123209|ref|YP_003305786.1| binding-protein-dependent transport systems inner membrane
           component [Streptobacillus moniliformis DSM 12112]
 gi|268314535|gb|ACZ00909.1| binding-protein-dependent transport systems inner membrane
           component [Streptobacillus moniliformis DSM 12112]
          Length = 672

 Score = 48.2 bits (113), Expect = 0.010,   Method: Composition-based stats.
 Identities = 44/153 (28%), Positives = 79/153 (51%), Gaps = 20/153 (13%)

Query: 826 DVQSKFDSSYSKL-FEIFYGDWTN--NAIKEERYWTIYAFERSLKNQAHLNAEVERLSGL 882
           ++ SKFD   +KL  E+F  +  N   A KEE+    Y FE   K  A    +++RL  +
Sbjct: 64  ELLSKFDEKEAKLRIELFEAEKLNLFYAGKEEKS---YDFELESKKSA---IKIDRLPSI 117

Query: 883 AQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIKELKSVIEADAKENPN 942
            +  S+S  + KELQ +LS   ++ E  +E+I      EFE + ++LK++ +++  +  N
Sbjct: 118 IKLYSESIKEKKELQLKLSTLSRHDE--EEKI-----KEFESKKQDLKNIFKSEVDKLKN 170

Query: 943 PNK----NQKKLQKTREKLVAQLSSRLKELNID 971
            +     + K L+    +L  +L  +L+ L +D
Sbjct: 171 SHSEGLISGKALRTQISQLKMELKDKLEVLKLD 203


>gi|226293865|gb|EEH49285.1| DNA ligase [Paracoccidioides brasiliensis Pb18]
          Length = 912

 Score = 48.2 bits (113), Expect = 0.010,   Method: Composition-based stats.
 Identities = 52/232 (22%), Positives = 98/232 (42%), Gaps = 20/232 (8%)

Query: 382 ANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAK-EKADREKADKDLQEKT 440
           A   S LK+ + LA ++   +K+++E+ A E  D + ++ E   E +D E   +   +  
Sbjct: 30  AGSASVLKKQSTLAFSSGTRDKKKQEKTATETNDEKLSNGEKDVEMSDVEAGGESKGDSP 89

Query: 441 PIKA--EGDDFGLGLPSVP-THSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERK 497
           P  A  E  D   G   VP + S    P  ++L+  K   ++  E    E+D +  T+R+
Sbjct: 90  PPAAGKEESDANSGSEKVPDSRSENSSPGSKKLKRDKTHVEEESE----ESDIQPATKRR 145

Query: 498 NQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESD 557
            +   +    + K  T ++ P    AK          + K+P D+ ++  +++    + D
Sbjct: 146 KRSTPEKKRASPKPKTADKKPVASKAKGRSKSPQSPKKVKEPVDETKESTSAE----KDD 201

Query: 558 YAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSP 609
              +   +  +E  E  +  R  E +QQ       L+    D Y +WK   P
Sbjct: 202 VDSVNDDEIGEETPEVAQKDR--ETVQQV------LKSSGKDPYPDWKVGDP 245


>gi|225859960|ref|YP_002741470.1| choline binding protein A [Streptococcus pneumoniae 70585]
 gi|225720701|gb|ACO16555.1| choline binding protein A [Streptococcus pneumoniae 70585]
          Length = 692

 Score = 48.2 bits (113), Expect = 0.011,   Method: Composition-based stats.
 Identities = 84/346 (24%), Positives = 151/346 (43%), Gaps = 98/346 (28%)

Query: 330 RTEGLGGVTYDQIKQLRDLASKVKADYHWA-------EIRHGNRF----------KAETR 372
           +TE L G++  + K   +L SK+KA+   A        ++ G +           K E R
Sbjct: 96  KTEYLHGLSVSKEKSEAELPSKIKAELDAAFENFKKDTLKPGEKVAEAKKKAEDQKEEDR 155

Query: 373 LAYSTIA------NVANFTSELKQATV-LARANAQEEK-QRREQEAKEK----------- 413
             Y T         +A F  ++K+A + L +  A+E + + + ++AKEK           
Sbjct: 156 RNYPTNTYKTLELEIAEFDVKVKEAELELVKEEAKEPRDEEKIKQAKEKVESKKAEATRL 215

Query: 414 ----ADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEE 469
                DR+KA++EAK KAD +  + ++       A  D    G P               
Sbjct: 216 ENIKTDRKKAEEEAKRKADAKLKEANV-------ATSDQ---GNP--------------- 250

Query: 470 LEEVKDEGKKGKEPGTTETDDREETERKNQD-------ILDNSLLAGKTHTKNETPAIPT 522
               K  GK+G  PG   T D++E + K+ D       +  +SL +GK  T+ E      
Sbjct: 251 ----KGRGKRGV-PGELATPDKKENDAKSSDSSVGEETLPSSSLKSGKKVTEAEKKV--- 302

Query: 523 AKAPPAQAHKGIQDKKPQDQREKPLAS----DIGVGESDY----AGIKLTKKE-KELQEQ 573
                 +A K  +D+K +D+R  P  +    D+ + ESD     A ++L K+E KE +++
Sbjct: 303 -----EEAEKKAKDQKEEDRRNYPTNTYKTLDLEIAESDVKVKEAELELVKEEAKEPRDE 357

Query: 574 EENLRVAEIIQQSRMQSEDLQEKAWDSYK----EWKSLSPDEIKQR 615
           E+  +  E ++  + ++  L++   D  K    + K+   D++K++
Sbjct: 358 EKIKQAKEKVESKKAEATRLEKIKTDRKKAEEAKRKAAEEDKVKEK 403


>gi|332993884|gb|AEF03939.1| TolA-like protein [Alteromonas sp. SN2]
          Length = 259

 Score = 47.8 bits (112), Expect = 0.011,   Method: Composition-based stats.
 Identities = 22/46 (47%), Positives = 32/46 (69%)

Query: 386 SELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREK 431
           +E K+   L +  AQ+E+QR+E+EAK KAD E+  KEA E A+ E+
Sbjct: 104 AEFKRQKELEQLAAQKEQQRKEREAKAKADAERKKKEAAENAEMER 149


>gi|218440494|ref|YP_002378823.1| hypothetical protein PCC7424_3565 [Cyanothece sp. PCC 7424]
 gi|218173222|gb|ACK71955.1| protein of unknown function DUF323 [Cyanothece sp. PCC 7424]
          Length = 925

 Score = 47.8 bits (112), Expect = 0.011,   Method: Composition-based stats.
 Identities = 52/215 (24%), Positives = 101/215 (46%), Gaps = 40/215 (18%)

Query: 389 KQATVLARANAQEEKQRREQEAKEKA--DREKADKEAKEKA--DREKADKDLQEKTPIKA 444
           KQ    A+  A+ E+QRRE+EA+ +A  DR++ ++EA+ +A  DR++ +++ Q +  +  
Sbjct: 395 KQRQAEAKRQAKLERQRREEEAQRQAELDRQRREEEAQRQAELDRQRREEEAQRQAELDR 454

Query: 445 EGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDN 504
           +                    +EEE++  K    + K     E   REE E + Q  LD 
Sbjct: 455 Q-------------------RREEEIQ--KQRQAEAKRQAKLERQRREE-EAQRQAELDR 492

Query: 505 SLLAGKTHTKNETPAIPTAKAPPAQAHKGIQ-DKKPQDQREKPLASDIGVGESD-YAGIK 562
                    + E  A   A+    +  + IQ  ++ + +R+  L       E+   A + 
Sbjct: 493 Q--------RREEEAQRQAELDRQRREEEIQKQRQAEAKRQAKLERQRREEEAQRQAELD 544

Query: 563 LTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKA 597
             ++E+E+Q+Q    R AE  +Q++++ +  +E+A
Sbjct: 545 RQRREEEIQKQ----RQAEAKRQAKLERQRREEEA 575


>gi|228904075|ref|ZP_04068170.1| S-layer y domain protein [Bacillus thuringiensis IBL 4222]
 gi|228855160|gb|EEM99724.1| S-layer y domain protein [Bacillus thuringiensis IBL 4222]
          Length = 876

 Score = 47.8 bits (112), Expect = 0.012,   Method: Composition-based stats.
 Identities = 68/286 (23%), Positives = 128/286 (44%), Gaps = 30/286 (10%)

Query: 389 KQATVLARANAQ-EEKQRREQEAKEKADRE---KADKEAKEKADREKADKDLQEKTPIKA 444
           K+A + A+  A+ + KQ  E +AKE++D +   +A+ +AKE+AD  K  K+ ++K  + A
Sbjct: 178 KEAELKAKQEAELKAKQEAELKAKEESDSKAKVEAETKAKEEAD-AKVKKEAEDKAKLDA 236

Query: 445 EGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDN 504
           E                    +E EL+E +D+ +K K     ET  ++E+E K ++  + 
Sbjct: 237 ETK----------------AKQEAELKEKQDKEEKAKV--EAETKAKQESELKVKEEQEK 278

Query: 505 SLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGE-SDYAGIKL 563
                K     E  A   ++    Q  + ++ K+  + + K +A  +   + SD   IK 
Sbjct: 279 KDAETKAKADAELKAKEESELKAKQEAE-LKAKEEAELKAKSVAPQLASSQASDRPVIKR 337

Query: 564 TKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDE---IKQ-RFQKY 619
            K EK     EE    + I  +   Q+ ++ E+  D + + K+   D+   I+Q +  K 
Sbjct: 338 IKMEKNFLTYEEPSLSSPISCEYLPQTVNVVEEGKDGWVKIKTYFGDKWLLIEQTKRVKI 397

Query: 620 AKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFL-SQW 664
            +VFY    P   S   +  S + +    +   G+ +I  +   +W
Sbjct: 398 DRVFYTYNEPSLSSGISSGFSPQTVTVLEERPDGWMKIKTYFGDKW 443


>gi|156102160|ref|XP_001616773.1| hypothetical protein [Plasmodium vivax SaI-1]
 gi|148805647|gb|EDL47046.1| hypothetical protein, conserved [Plasmodium vivax]
          Length = 3546

 Score = 47.8 bits (112), Expect = 0.012,   Method: Composition-based stats.
 Identities = 33/127 (25%), Positives = 66/127 (51%), Gaps = 9/127 (7%)

Query: 387  ELKQATVLARANAQEEKQRREQEAKEKADRE---KADKEAKEKADRE---KADKDLQEKT 440
            E  QA   +    +E  Q+ ++EA +K+D E   K+D+EA +K+D E   K+D++  +K+
Sbjct: 1507 EFVQALAESEVTDEEASQKSDEEASQKSDEEASQKSDEEASQKSDEEASQKSDEEASQKS 1566

Query: 441  PIKA--EGDDFGLGL-PSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERK 497
              +A  + DD    L  + P+  +K+   +   ++V DE    +     E  ++E T  +
Sbjct: 1567 DEEASQKSDDQATQLGENTPSGGIKMMLNKSSKKKVPDEKPPQRSENEIEYINKEITILE 1626

Query: 498  NQDILDN 504
            ++++  N
Sbjct: 1627 DEELYGN 1633


>gi|8163674|gb|AAF73795.1|AF154026_1 surface protein PspC [Streptococcus pneumoniae]
          Length = 752

 Score = 47.8 bits (112), Expect = 0.013,   Method: Composition-based stats.
 Identities = 63/275 (22%), Positives = 121/275 (44%), Gaps = 56/275 (20%)

Query: 368 KAETRLAYSTI-----------ANVANFTSELKQATVLARANAQEEKQRREQEAKEKADR 416
           K E R  Y TI           ++V    +EL+   V A+ +  EEK ++ + A+ ++ +
Sbjct: 159 KEEDRRNYPTITYKTLELEIAESDVEVKKAELELVKVKAKGSRNEEKIKKAK-AEVESKK 217

Query: 417 EKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDE 476
            +A K  + K +R+KA+++ + K                            E  EEVKD+
Sbjct: 218 AEATKLEEIKTERKKAEEEAKRKA---------------------------EAEEEVKDK 250

Query: 477 GKKGKEPGT---TETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKG 533
            KK  + G      T D++E + K+ D             K E   +  A+   A+A K 
Sbjct: 251 LKKRTKRGALGEPATPDKKENDAKSSDSSVGEETLPSPSLKPEK-KVAEAEKKVAEAEKK 309

Query: 534 IQDKKPQDQREKPLAS----DIGVGESDY----AGIKLTKKEKELQEQEENLRVAEI-IQ 584
            +D+K +D+R  P  +    ++ + ESD     A ++L K+E +  + EE ++ A+  ++
Sbjct: 310 AKDQKEEDRRNYPTNTYKTLELEIAESDVKVKEAELELVKEEAKEPQNEEKIKQAKAKVE 369

Query: 585 QSRMQSEDLQEKAWDSYK----EWKSLSPDEIKQR 615
             + ++  L++   D  K    + K    D++K++
Sbjct: 370 SKKAEATRLEKIKTDRKKAEEAKRKVAEEDKVKEK 404


>gi|242021965|ref|XP_002431413.1| conserved hypothetical protein [Pediculus humanus corporis]
 gi|212516689|gb|EEB18675.1| conserved hypothetical protein [Pediculus humanus corporis]
          Length = 496

 Score = 47.8 bits (112), Expect = 0.013,   Method: Composition-based stats.
 Identities = 37/129 (28%), Positives = 59/129 (45%), Gaps = 23/129 (17%)

Query: 830 KFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAEVERLSGLAQQPSDS 889
           K DSSY  +   FY  W   + K+  YW              L+    R     Q P+  
Sbjct: 135 KSDSSYEDVVAPFYSYWMYYSTKKSYYW--------------LDPHDTR-----QAPNSK 175

Query: 890 TADLKELQTQLSRAKKYKESNDE--RIVSFIRSEFEREIKELKSVIEADAKENPNPNKNQ 947
            A L E + +  R K  KE N+E   +V+F+R   ++ ++E    +E  AKEN   ++ +
Sbjct: 176 IAKLIEKENKKVRDKAKKERNEEVRNLVAFVRKR-DKRVQEWNKKLEMKAKENQQKSE-E 233

Query: 948 KKLQKTREK 956
            +LQK +E+
Sbjct: 234 HRLQKIKER 242


>gi|8163646|gb|AAF73780.1|AF154013_1 surface protein PspC [Streptococcus pneumoniae]
          Length = 730

 Score = 47.8 bits (112), Expect = 0.013,   Method: Composition-based stats.
 Identities = 55/233 (23%), Positives = 109/233 (46%), Gaps = 28/233 (12%)

Query: 375 YSTIA-NVANFTSELKQATV-LARANAQE---EKQRREQEAKEKADREKADKEAKEKADR 429
           Y T+   +A    E+K+A + L +  A+E   +++ ++ EAK ++ + +A +    K DR
Sbjct: 170 YKTLELEIAESDVEVKKAELELVKEEAKESRDDEKIKQAEAKVESKKAEATRLENIKTDR 229

Query: 430 EKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETD 489
           EKA+++ + +   K +              +V+      E  + K   K+G  PG   T 
Sbjct: 230 EKAEEEAKRRAEAKLK-------------EAVEKNVATSEQGKPKGRAKRGV-PGEQATP 275

Query: 490 DREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLAS 549
           D++E + K+ D             K E   +  A+   A+A K  + +K +D+R  P  +
Sbjct: 276 DKKENDAKSSDSSVGEEALPSPSLKPEK-KVAEAEKKVAEAEKKAKAQKEEDRRNYPTNT 334

Query: 550 ----DIGVGESDYAGIKLTKKEKEL-QEQEENLRVAEIIQQSRMQSEDLQEKA 597
               ++ + ESD   +K+ + E EL +E+ +  R  E + Q++ + E  + +A
Sbjct: 335 YKTLELEIAESD---VKVKEAELELVKEEAKESRNEEKVNQAKAKVESKKAEA 384


>gi|325911060|gb|ADZ45258.1| pneumococcal surface protein C [Streptococcus pneumoniae]
          Length = 710

 Score = 47.8 bits (112), Expect = 0.014,   Method: Composition-based stats.
 Identities = 53/226 (23%), Positives = 107/226 (47%), Gaps = 27/226 (11%)

Query: 381 VANFTSELKQATV-LARANAQE---EKQRREQEAKEKADREKADKEAKEKADREKADKDL 436
           +A    E+K+A + L +  A+E   +++ ++ EAK ++ + +A +    K DREKA+++ 
Sbjct: 177 IAESDVEVKKAELELVKEEAKESRDDEKIKQAEAKVESKKAEATRLENIKTDREKAEEEA 236

Query: 437 QEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETER 496
           + +   K +              +V+      E ++ K   K+G  PG   T D++E + 
Sbjct: 237 KRRAEAKLK-------------EAVEKNVATSEQDKPKGRRKRGV-PGEQATPDKKENDA 282

Query: 497 KNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLAS----DIG 552
           K+ D             K E   +  A+   A+A K  + +K +D+R  P  +    ++ 
Sbjct: 283 KSSDSSVGEEALPSPSLKPEK-KVAEAEKKVAEAEKKAKAQKEEDRRNYPTNTYKTLELE 341

Query: 553 VGESDYAGIKLTKKEKEL-QEQEENLRVAEIIQQSRMQSEDLQEKA 597
           + ESD   +K+ + E EL +E+ +  R  E + Q++ + E  + +A
Sbjct: 342 IAESD---VKVKEAELELVKEEAKESRNEEKVNQAKAKVESKKAEA 384



 Score = 40.1 bits (92), Expect = 2.8,   Method: Composition-based stats.
 Identities = 39/184 (21%), Positives = 77/184 (41%), Gaps = 7/184 (3%)

Query: 396 RANAQEEKQRR-EQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGD----DFG 450
           R  A+EE +RR E + KE  ++  A  E  +   R K     ++ TP K E D    D  
Sbjct: 229 REKAEEEAKRRAEAKLKEAVEKNVATSEQDKPKGRRKRGVPGEQATPDKKENDAKSSDSS 288

Query: 451 LGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGK 510
           +G  ++P+ S+K  P+++  E  K   +  K+    + +DR          L+  +    
Sbjct: 289 VGEEALPSPSLK--PEKKVAEAEKKVAEAEKKAKAQKEEDRRNYPTNTYKTLELEIAESD 346

Query: 511 THTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKEL 570
              K     +   +A  ++  + +   K + + +K  A+ +   ++D    +   K K  
Sbjct: 347 VKVKEAELELVKEEAKESRNEEKVNQAKAKVESKKAEATRLEKIKTDRKKAEEEAKRKAA 406

Query: 571 QEQE 574
           +E +
Sbjct: 407 EEDK 410


>gi|325911076|gb|ADZ45266.1| pneumococcal surface protein C [Streptococcus pneumoniae]
          Length = 706

 Score = 47.4 bits (111), Expect = 0.014,   Method: Composition-based stats.
 Identities = 55/206 (26%), Positives = 89/206 (43%), Gaps = 25/206 (12%)

Query: 412 EKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPP----KE 467
           +KA+ E   +EAK   + EK  K   E    KAE       L  + T   K       K 
Sbjct: 186 KKAELELVKEEAKGSRNEEKIKKAKAEVESKKAEATK----LEEIKTERKKAEEEAKRKA 241

Query: 468 EELEEVKDEGKKGKEPGT---TETDDREETERKNQD------ILDNSLLAGKTHTKNETP 518
           E  EEVKD+ KK  + G      T D++E + K+ D       L +  L  +        
Sbjct: 242 EAEEEVKDKLKKRTKRGALGEPATPDKKENDAKSSDSSVGEETLPSPSLKSEKKVAEAEK 301

Query: 519 AIPTAKAPPAQAHKGIQDKKPQDQREKPLAS----DIGVGESDY----AGIKLTKKEKEL 570
            +  A+   A+A K  +D+K +D+R  P  +    ++ + ESD     A ++L K+E + 
Sbjct: 302 KVAEAEKKVAEAEKKAKDQKEEDRRNYPTNTYKTLELEIAESDVKVKEAELELVKEEAKE 361

Query: 571 QEQEENLRVAEIIQQSRMQSEDLQEK 596
            + EE ++ A+   +S+       EK
Sbjct: 362 PQNEEKIKQAKAKVESKKAEATRLEK 387


>gi|307111335|gb|EFN59569.1| hypothetical protein CHLNCDRAFT_132907 [Chlorella variabilis]
          Length = 2254

 Score = 47.4 bits (111), Expect = 0.014,   Method: Composition-based stats.
 Identities = 21/47 (44%), Positives = 33/47 (70%), Gaps = 1/47 (2%)

Query: 387  ELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKAD 433
            E +QA +  R   +E + RREQ+ ++KA+RE+AD+E  EKA  E+A+
Sbjct: 1384 EAEQARI-ERERQEEARARREQQQRDKAERERADRERAEKAKAERAE 1429



 Score = 43.2 bits (100), Expect = 0.32,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 39/67 (58%)

Query: 373  LAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKA 432
            LA   +A V +   + ++   L  A     ++ R++EA+ + ++++ DK  +E+ADRE+A
Sbjct: 1361 LAGDDLAVVKHMVKQARRMLALEEAEQARIERERQEEARARREQQQRDKAERERADRERA 1420

Query: 433  DKDLQEK 439
            +K   E+
Sbjct: 1421 EKAKAER 1427


>gi|145501258|ref|XP_001436611.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124403752|emb|CAK69214.1| unnamed protein product [Paramecium tetraurelia]
          Length = 3975

 Score = 47.4 bits (111), Expect = 0.015,   Method: Composition-based stats.
 Identities = 44/223 (19%), Positives = 98/223 (43%), Gaps = 28/223 (12%)

Query: 396 RANAQEEKQRREQEA---KEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLG 452
           R   +E+ ++++Q+    KE+  +++ D+ +  + D++K  +  Q+K   K +  D    
Sbjct: 559 RTQDKEQDKQKQQDRTSDKEQDKQKQQDRTSDNEQDKQKQQERTQDKEQNKQKQQD---- 614

Query: 453 LPSVPTHSVKLPPKEEELEEVKD---EGKKGKEPGTTETDDREETERKNQDILDNSLLAG 509
                    +   KE++ ++ +D   + ++ K+     T D+E+ ++K QD   ++    
Sbjct: 615 ---------RTSDKEQDKQKQQDRTSDNEQDKQKQQDRTQDKEQNKQKQQDRTSDN---- 661

Query: 510 KTHTKNETPAIPTAKAPPAQAHKGIQDKKPQD-QREKPLASDIGVGESDYAGIKLTKKEK 568
               K +       K    Q  +     K QD Q+++   SD    E D    +   ++K
Sbjct: 662 -EQDKQQQQDRTQDKEQDKQKQQDRTSDKEQDKQKQQDRTSD---NEQDKQKQQDRTQDK 717

Query: 569 ELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDE 611
           E  +Q++  R ++  Q  + Q +  Q+K  +  K+    S +E
Sbjct: 718 EQNKQKQQDRTSDNEQDKQQQQDRTQDKEQNKQKQQDRTSDNE 760



 Score = 43.9 bits (102), Expect = 0.19,   Method: Composition-based stats.
 Identities = 44/224 (19%), Positives = 98/224 (43%), Gaps = 22/224 (9%)

Query: 385 TSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKA 444
           TS+ +Q     +    + +Q ++++ +   D+E+  ++ +++   ++ DK  Q+      
Sbjct: 574 TSDKEQDKQKQQDRTSDNEQDKQKQQERTQDKEQNKQKQQDRTSDKEQDKQKQQDRTSDN 633

Query: 445 EGDDFGLGLPSVPTHSVKLPPKEEELEEVKD---EGKKGKEPGTTETDDREETERKNQDI 501
           E D              +   KE+  ++ +D   + ++ K+     T D+E+ ++K QD 
Sbjct: 634 EQDK--------QKQQDRTQDKEQNKQKQQDRTSDNEQDKQQQQDRTQDKEQDKQKQQDR 685

Query: 502 LDNSLLAGKTHTKNETPAIPTAKAPPAQAHKG-IQDKKPQDQREKPLASDIGVGESDYAG 560
             +     K   K +     +      Q  +   QDK+   Q+++   SD    E D   
Sbjct: 686 TSD-----KEQDKQKQQDRTSDNEQDKQKQQDRTQDKEQNKQKQQDRTSD---NEQDKQQ 737

Query: 561 IKLTKKEKELQEQEENLRVAEIIQQSRMQSED-LQEKAWDSYKE 603
            +   ++KE  +Q++  R ++  +Q R +S+D  Q+K  D  K+
Sbjct: 738 QQDRTQDKEQNKQKQQDRTSD-NEQDRQKSQDRTQDKEQDKQKQ 780



 Score = 40.5 bits (93), Expect = 2.1,   Method: Composition-based stats.
 Identities = 53/253 (20%), Positives = 103/253 (40%), Gaps = 65/253 (25%)

Query: 396 RANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPS 455
           +   Q+  Q +EQ+ +++ DR  +DKE  ++  +++   + Q+K   +    D       
Sbjct: 665 KQQQQDRTQDKEQDKQKQQDR-TSDKEQDKQKQQDRTSDNEQDKQKQQDRTQD------- 716

Query: 456 VPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQD-ILDNSLLAGKTHTK 514
                 K   K+++ +   D  ++ K+     T D+E+ ++K QD   DN     K+  +
Sbjct: 717 ------KEQNKQKQQDRTSDN-EQDKQQQQDRTQDKEQNKQKQQDRTSDNEQDRQKSQDR 769

Query: 515 NETPAIPTAKAPPAQAHKG-IQDKK-----------------PQDQREKPLASDI----G 552
            +       K    Q  +G  QDK+                 P D  E+P+  ++    G
Sbjct: 770 TQD------KEQDKQKQQGRTQDKEQEKEKEKEKQKSGPLEIPPDDDEEPVEGELVKTEG 823

Query: 553 VGESDYAGI---------------KLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKA 597
           +G S    I               K+++K+K   E+ EN   +E +Q +  +SE+     
Sbjct: 824 IGASSDGRIGNQQTQQQKQQLQNDKVSEKKKLRDEESENKLKSETLQNNDHESEE----- 878

Query: 598 WDSYKEWKSLSPD 610
            D Y++ +   PD
Sbjct: 879 -DVYEQDEVDEPD 890


>gi|255729336|ref|XP_002549593.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
 gi|240132662|gb|EER32219.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
          Length = 2136

 Score = 47.4 bits (111), Expect = 0.016,   Method: Composition-based stats.
 Identities = 248/1208 (20%), Positives = 471/1208 (38%), Gaps = 194/1208 (16%)

Query: 13   NNLDQDKIPSED----VAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYI-------V 61
            N L Q K+ SE+      K L  +   I+ L++ +     +    KD+   +       +
Sbjct: 959  NELKQSKLDSEEETAQTKKQLEEVNGKIEELQKSLDDVQLEKTQLKDKLANLENSTSEKI 1018

Query: 62   GPIEQRLKKVSERYERVVSRDLTLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLLC 121
              +E  L+ + +  + + S    LV E  L+ LK+  D   +   + E     K D L  
Sbjct: 1019 KSLESELESIKKSSKEISSEKSKLVEE--LEKLKQEVDAKDKKLASAEEESKSKIDDLNS 1076

Query: 122  RFMDM----VETEDEHKINKQVR----DALESAGFDLESTQENIRKVESALINNNMKDAF 173
            +  D+     E+ED H   K +     DAL+    + EST+ ++ +  SA    + K A 
Sbjct: 1077 KIQDLEAKLKESEDSHSSTKDLHSSLSDALDKLKTEYESTKTSLNEKLSAKTEEHSKVAS 1136

Query: 174  RFLELAQKSKETADSHIIEAIDVGTKLKENTPPTTFTSISKVLLKSNNMQDVVFTKIKEV 233
                  +      + H  E   +  K KE +  T   +++K L +S      V  +  E+
Sbjct: 1137 ELESKLKHILHLKEEHQKEKAQLEEKHKEVS--TNLENVTKELKQSEKNLSSVNQRHDEL 1194

Query: 234  VKKHVNAELGHRKLRGLAFDHTYFNDKLNQFLKEIKNHQKEYDESEKGSSKARYHAAYAH 293
                 N E    K+  L        +K  + +++I++ +KE  + EK             
Sbjct: 1195 SDTLKNHE---SKIEDLETTVEISKEKSKRLIQDIEDLKKEKIDLEK------------- 1238

Query: 294  IYWDLANDWVNGRVGDKSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVK 353
                         + D  D     ST +++   +I              K+L++L  +  
Sbjct: 1239 ------------TIKDHVDSLEAKSTEVSTAERKIEEVN----------KELKNLQEEKD 1276

Query: 354  ADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEK 413
            ++ +  +     + K   +L    + ++A  T++L    +    N + ++ +   E + +
Sbjct: 1277 SEINKMKELQNEKAKEVEKL----MKDLA--TAKLSTENITKEMNGKLKELQDANEIEVR 1330

Query: 414  ADREK-ADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEE 472
              + K + KE + K  + K D  L EK  I               + S  +   + E+++
Sbjct: 1331 ELKTKLSTKEDELKGIQAKFDIALAEKEEIDN-------------STSKTISSLKTEIDD 1377

Query: 473  VKDEGKKGKEPGTTETDDR-----EETERKNQ--DILDNSLLAGKTHTKNETPAIPTAKA 525
            +K +  K KE    E D++     EE ++K+   D  D  L   K      +  + + K+
Sbjct: 1378 LKKQIAKEKE-AKKEIDEKVKILSEEVDKKSNELDSKDKELQLTKDELSKLSNDLVSVKS 1436

Query: 526  PPAQAHKGIQDKKPQDQREKPLASDIGVGES--DYAGIKLTKKEKELQEQEENLR----- 578
                     +  K QD+R K L+ ++   +S  D     +   EKE  + E NL+     
Sbjct: 1437 ---------ELTKVQDER-KSLSEEVTKAKSVIDKKSALVVSLEKEKSDLESNLKSTKSE 1486

Query: 579  VAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAK---VFYRSYSPVDGSY- 634
            + E+  + + ++  L E+  +  KE  SLS  E+K R  +  K   +   +   V   Y 
Sbjct: 1487 LKELQNKYKKETATLNERISEKEKEISSLS-TELKDRISEVEKERAMLSENSETVIKEYG 1545

Query: 635  ---KGTQESDKAINHFLDNDFGYYRIHNFLSQWSPLGLMYEKDELHG-VEAVYQKLDVLF 690
               K  +E  K++      D   +       + S   L  E D     +E   Q+L+   
Sbjct: 1546 DKIKSLEEKIKSLKETHSKDTSKHNEEKSTLKSSIEKLTSEHDSTKSSLEEKEQELNKFK 1605

Query: 691  RHCIENLRANKNAVDAMSKAVEAGES---------SVRKHSFEVLSSKHQKSVIAVNNFI 741
                + +   K AVD   K ++   S         SV++       + ++K  +  + F 
Sbjct: 1606 AELKKTVDTAKEAVDEKEKKIDELSSEVKTLKSDISVKEEEIRKSEADYKKLSVEKSVFE 1665

Query: 742  KEITHHTRRLVKEDPKRGKSESYLSDI-------RSELQKVNKTVMDIRIKL-RLYGIFQ 793
            K++T++T  L +   K   +++ L+++        +EL  +  T      +L  L    +
Sbjct: 1666 KKLTNNTNELNETVKKLEDAKASLAEVGKLKDELTAELDTLKSTSSSTSTELNELKKEIK 1725

Query: 794  DIPQEQPPLYTIISGSEKILQGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDW-TNNAIK 852
            ++  E+  L    S S +I   D+        ++  KFD    KL E+ + +  +   + 
Sbjct: 1726 NLSNEKSEL----SSSLEIKTKDFDDQVTKHTELSGKFDELTKKL-ELKHSELESTKKMH 1780

Query: 853  EERYWTIYAFERSLKNQAHLNAEVERLSGLAQQPSDSTADLKE----LQTQLSRAKKYKE 908
             +    + A E+ L+    +NA+   +S   +  ++  A L +    L++Q S A K K 
Sbjct: 1781 SDTASKLKALEKELET---VNAKHSEVSDTVESKTNEIAKLNDQINSLKSQQSDANKEKS 1837

Query: 909  SNDERIVSFIRSEFEREIKELKSVIE--ADAKENPNPNKNQ-KKLQKTREKLVAQLSSRL 965
            S   ++   ++   E EIKE K  +E  AD        +++ K L ++++KL +QL    
Sbjct: 1838 STISKLQETVKL-LESEIKEKKVSLENYADLDNKLKEKESEVKTLGESKDKLQSQLDDLK 1896

Query: 966  KELN--------IDNAYGLWNEYKEDFKASFEY--PLGTYEPAILGAMKDMDRLHPIYSV 1015
            KEL         +D      +E + + K++ E    L   +  +   +  +++ H    +
Sbjct: 1897 KELEGALVYKKELDTTAAKLSESELELKSASEKVEQLSAAKSKVEEELASVEKKHS--EL 1954

Query: 1016 SKTIQKAGGDPSLMMDYEKVEPSDVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSF 1075
             K+++    D S  +  +  E    +A L D+LAK        K  H++    +IS    
Sbjct: 1955 VKSVEVNSSD-SAKVQSDLDEARKKVALLEDELAKV-------KSEHEIAKT-QISEKEK 2005

Query: 1076 EVSSYVNPKRMHADTESDIYFEEFKRSLSSWEDEPRIEVERDATLPRLAKDDGSKEDEYE 1135
              + + N ++   DTES +                   VE++       KDD SKE E E
Sbjct: 2006 VEAEFANLQKCQKDTESKLEV-----------------VEKE-------KDDISKELEKE 2041

Query: 1136 GGANERYV 1143
              ANE  V
Sbjct: 2042 KSANEESV 2049


>gi|229070768|ref|ZP_04203997.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           F65185]
 gi|229080534|ref|ZP_04213055.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           Rock4-2]
 gi|228702836|gb|EEL55301.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           Rock4-2]
 gi|228712347|gb|EEL64293.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           F65185]
          Length = 612

 Score = 47.4 bits (111), Expect = 0.017,   Method: Composition-based stats.
 Identities = 39/172 (22%), Positives = 76/172 (44%), Gaps = 30/172 (17%)

Query: 334 LGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATV 393
           + G T   +  + D +++V AD +        + K+   + +  +++ +N + E  + T+
Sbjct: 93  MAGATSAWLYDVNDKSAEVGADSY--------KLKSGDVVVFRFVSDWSNISQETLKETL 144

Query: 394 LARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGL 453
                      + E+    K +  K D   +EK +  K D   QEK P + + +D     
Sbjct: 145 DKFGTC-----KTEEPNGGKPEEPKTDDPKQEKPEEPKTDDPKQEK-PEEPKTND----- 193

Query: 454 PSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNS 505
                      PK+E+ EE K +G K ++P  T+T+D +  + K ++I D S
Sbjct: 194 -----------PKQEKPEEPKTDGSKQEKPDGTKTNDEKPEQPKQENIQDPS 234


>gi|281182964|ref|NP_001162435.1| microtubule-associated protein 1A [Papio anubis]
 gi|163781042|gb|ABY40809.1| microtubule-associated protein 1A (predicted) [Papio anubis]
          Length = 2818

 Score = 47.4 bits (111), Expect = 0.017,   Method: Composition-based stats.
 Identities = 61/283 (21%), Positives = 117/283 (41%), Gaps = 18/283 (6%)

Query: 387  ELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEG 446
            ++K   V  +  A E+K R  ++     +++    E K+K D E+ DK L++K  I  E 
Sbjct: 1396 DIKNEAVKQQDKALEQKGRDLEQKDTALEQKDKALEPKDK-DLEEKDKALEQKDKIPEEK 1454

Query: 447  DD-FGLGLPSVPTHSVKLPPKEEELEE---VKDEGKKGKEPGTTETDDREETERKNQDIL 502
            D        ++      L PK+++LE+   V ++  K  EP   + + ++    +    L
Sbjct: 1455 DKALEQKDTALEQKDKALEPKDKDLEQKDRVLEKKDKALEPKDKDLEQKDRIPEEIDKAL 1514

Query: 503  DNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDK-KPQDQREKPLASDIGVGESDYAGI 561
            D  +  G  H   E            Q  K  + K + Q+Q++K         E  Y   
Sbjct: 1515 DQKV-RGVEHKAPEDTVTEMKGRDLEQTDKAPEQKHQAQEQKDKISEKKDQALEQKYWA- 1572

Query: 562  KLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAK 621
             L +K++ L   E+N++  E   Q++ Q   LQ+      K  +  SP+++K   +K   
Sbjct: 1573 -LGQKDEAL---EQNIKALEEKDQTQEQESLLQQDKTRKPKMLEEKSPEKVKAMEEKLEA 1628

Query: 622  VFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQW 664
            +  ++ +       G +ES          +  Y+R  + + +W
Sbjct: 1629 LLEKTKA------LGLEESLVQEGKARKQEEKYWRGQDVVQEW 1665


>gi|310790909|gb|EFQ26442.1| hypothetical protein GLRG_01586 [Glomerella graminicola M1.001]
          Length = 826

 Score = 47.4 bits (111), Expect = 0.018,   Method: Composition-based stats.
 Identities = 54/227 (23%), Positives = 89/227 (39%), Gaps = 17/227 (7%)

Query: 364 GNRFKAETRLAYSTIANVANFTSELKQATVLARANAQE--EKQRREQEAKEKADREKADK 421
            N   AE   A ST     +      Q+T  A  + +   +K   E+ A E+AD EKAD 
Sbjct: 137 ANFVAAEATPAASTSVQATSTEGAPTQSTSEASDSKKPNPDKANPEKAAPEEADPEKADP 196

Query: 422 EAK--EKADREKADKDLQEKTPIKAEGD-DFGLGLPSVPTHSVKLPPKEEELEEVKDEGK 478
           E    E AD +K+D      TP+K          +   P+ S +    ++   E  D  K
Sbjct: 197 EKANPENADPQKSDN--AAPTPVKTTSAVSTSSNVTPTPSASPEKTNPDKANPEKADPEK 254

Query: 479 KGKEPGTTETDDREETERKNQDILDNSLL--AGKTHTKNETPAIPTA--KAPPAQAHKGI 534
              E    E  D E+ + +N D   ++ +       T +E    P+A  + PPA+     
Sbjct: 255 ADPEKADPEEADPEKADPQNSDTTASAPVKTTSAVSTSSEASLTPSAPVQTPPAKV---- 310

Query: 535 QDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAE 581
               P+DQ+    +  +G   S  +    T+     +  +   +V+E
Sbjct: 311 --SAPKDQKTTTSSDTVGKTSSSVSLPDATETTSTSEAPQSTSKVSE 355


>gi|332071271|gb|EGI81766.1| choline binding protein A [Streptococcus pneumoniae GA17545]
          Length = 529

 Score = 47.0 bits (110), Expect = 0.018,   Method: Composition-based stats.
 Identities = 52/220 (23%), Positives = 105/220 (47%), Gaps = 27/220 (12%)

Query: 387 ELKQATV-LARANAQE---EKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPI 442
           E+K+A + L +  A+E   +++ ++ EAK ++ + +A +    K DREKA+++ + +   
Sbjct: 2   EVKKAELELVKEEAKESRDDEKIKQAEAKVESKKAEATRLENIKTDREKAEEEAKRRAEA 61

Query: 443 KAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDIL 502
           K +              +V+      E ++ K   K+G  PG   T D++E + K+ D  
Sbjct: 62  KLK-------------EAVEKNVATSEQDKPKGRRKRGV-PGEQATPDKKENDAKSSDSS 107

Query: 503 DNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLAS----DIGVGESDY 558
                      K E   +  A+   A+A K  + +K +D+R  P  +    ++ + ESD 
Sbjct: 108 VGEEALPSPSLKPEK-KVAEAEKKVAEAEKKAKAQKEEDRRNYPTNTYKTLELEIAESD- 165

Query: 559 AGIKLTKKEKEL-QEQEENLRVAEIIQQSRMQSEDLQEKA 597
             +K+ + E EL +E+ +  R  E + Q++ + E  + +A
Sbjct: 166 --VKVKEAELELVKEEAKESRNEEKVNQAKAKVESKKAEA 203



 Score = 40.1 bits (92), Expect = 2.7,   Method: Composition-based stats.
 Identities = 39/184 (21%), Positives = 77/184 (41%), Gaps = 7/184 (3%)

Query: 396 RANAQEEKQRR-EQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGD----DFG 450
           R  A+EE +RR E + KE  ++  A  E  +   R K     ++ TP K E D    D  
Sbjct: 48  REKAEEEAKRRAEAKLKEAVEKNVATSEQDKPKGRRKRGVPGEQATPDKKENDAKSSDSS 107

Query: 451 LGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGK 510
           +G  ++P+ S+K  P+++  E  K   +  K+    + +DR          L+  +    
Sbjct: 108 VGEEALPSPSLK--PEKKVAEAEKKVAEAEKKAKAQKEEDRRNYPTNTYKTLELEIAESD 165

Query: 511 THTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKEL 570
              K     +   +A  ++  + +   K + + +K  A+ +   ++D    +   K K  
Sbjct: 166 VKVKEAELELVKEEAKESRNEEKVNQAKAKVESKKAEATRLEKIKTDRKKAEEEAKRKAA 225

Query: 571 QEQE 574
           +E +
Sbjct: 226 EEDK 229


>gi|56693334|ref|NP_001008633.1| phakinin [Danio rerio]
 gi|56270577|gb|AAH86849.1| Zgc:103750 [Danio rerio]
 gi|182890044|gb|AAI65202.1| Zgc:103750 protein [Danio rerio]
          Length = 438

 Score = 47.0 bits (110), Expect = 0.018,   Method: Composition-based stats.
 Identities = 73/349 (20%), Positives = 140/349 (40%), Gaps = 50/349 (14%)

Query: 669 LMYEKDELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGESSVRKHSFEVLSS 728
           L+  +D++H +E + ++L+   RHC++             KAV AG  +  K  +E +  
Sbjct: 95  LLEYRDKVHALEQLNKQLEEQIRHCLDR------------KAVSAGTWTGLKQDWEDVYI 142

Query: 729 KHQKSV-------IAVNNFIKEITHHTRRLVKEDPKRGKSESYLSDIRSELQKVNKTVMD 781
           +  +++       +   N          R   E P R   E  ++ +   +   N T MD
Sbjct: 143 QVSEAILYNARLMLQTENVQANAEDFKERYENEQPFRKAVEEEINSLYKVIDDANLTRMD 202

Query: 782 IR-----IKLRLYGIFQDIPQEQPPLYTIISGSEKILQGDYTFPPLSSLDVQSKFDSSYS 836
           +      +K  L  + Q   ++   LY  +SG E + + D   P  +SLD    F  S+ 
Sbjct: 203 LENEIESMKTELINVEQSHMEDVKMLYKQMSGRE-VDEPDA--PTETSLDPILSFIRSH- 258

Query: 837 KLFEIFYGDWTNNAIKEERYWTIYAFE--RSLKNQAHLNAEVERLSGLAQQPSDSTADLK 894
                    W    +++ R  T   FE  ++    + L+ E E +  L  + +D+   ++
Sbjct: 259 ---------W-ERVVEKNRAETYAYFECKQAGSLNSKLSQEEEEMECLKTECNDAGCKIQ 308

Query: 895 ELQTQLSRAKKYKESNDERIVSFIRSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTR 954
            LQ +    +  K    E  ++  +   + E++ L SVI    K     N  +  +++ R
Sbjct: 309 NLQAETESIRALKRGL-ENALNDAKHWHDIELQNLGSVI---GKLEAELNDIRGDIEQQR 364

Query: 955 EKLVAQLSSRLK-ELNIDNAYGLWNE-----YKEDFKASFEYPLGTYEP 997
                 L++++K E+ I   +G+ +      Y   F A    P G  +P
Sbjct: 365 RDYETLLNNKMKVEMEIGTYHGILDGEESRFYTSTFPAGCSVPEGPTDP 413


>gi|125987842|sp|Q9JMH9|MY18A_MOUSE RecName: Full=Myosin-XVIIIa; AltName: Full=Molecule associated with
            JAK3 N-terminus; Short=MAJN; AltName: Full=Myosin
            containing a PDZ domain
 gi|56205924|emb|CAI24426.1| myosin XVIIIa [Mus musculus]
          Length = 2050

 Score = 47.0 bits (110), Expect = 0.020,   Method: Composition-based stats.
 Identities = 117/632 (18%), Positives = 262/632 (41%), Gaps = 77/632 (12%)

Query: 369  AETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKAD 428
             E RL Y       +FT +  Q  +       E+K   EQ+++ + +R   D +A +  +
Sbjct: 1365 GEWRLKYERAVREVDFTKKRLQQEL-------EDKMEVEQQSRRQLERRLGDLQA-DSDE 1416

Query: 429  REKADKDLQEKTP-IKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTE 487
             ++A + L++K   + AE  D  L L      + +L  K+   +    E  +  E    E
Sbjct: 1417 SQRALQQLKKKCQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDS---ELSQAHEETQRE 1473

Query: 488  TDDREETERKNQDILDNSL-LAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKP 546
               RE+ +R+   +L  +  L  +   K+   A  T K    +A   +QD   Q+ +++ 
Sbjct: 1474 KLQREKLQREKDMLLAEAFSLKQQMEEKDLDIAGFTQKVVSLEAE--LQDISSQESKDEA 1531

Query: 547  LASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKS 606
              + +     D    K+  +E+EL EQ  ++   ++++Q++++ E   E+   ++ +   
Sbjct: 1532 SLAKVKKQLRDLEA-KVKDQEEELDEQAGSI---QMLEQAKLRLEMEMERMRQTHSKEME 1587

Query: 607  LSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSP 666
               +E+++  Q   K   +    ++  Y+  Q   KA+    + +     + + ++Q   
Sbjct: 1588 SRDEEVEEARQSCQKKLKQMEVQLEEEYEDKQ---KALREKRELESKLSTLSDQVNQRDF 1644

Query: 667  LGLMYEKDELHGVEAVYQKLDVLFRHCIENLRAN------KNAVD-------AMSKAVEA 713
                  + +L   +A+     ++  H   N  +       KN ++       A  KA +A
Sbjct: 1645 ESEKRLRKDLKRTKALLADAQIMLDHLKNNAPSKREIAQLKNQLEESEFTCAAAVKARKA 1704

Query: 714  GESSVR------------KHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKED----PK 757
             E  +             K + E   S+ Q+    + N ++E       L+K+      +
Sbjct: 1705 MEVEMEDLHLQIDDIAKAKTALEEQLSRLQREKNEIQNRLEEDQEDMNELMKKHKAAVAQ 1764

Query: 758  RGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLYTIISGSEKILQGDY 817
              +  + ++D+++++++ NK   +++ KL+      +  ++     +++S  E  ++   
Sbjct: 1765 ASRDMAQMNDLQAQIEESNKEKQELQEKLQALQSQVEFLEQSMVDKSLVSRQEAKIR--- 1821

Query: 818  TFPPLSSLDVQSKFDSSYSKLFEIFYGDW--TNNAIKEERYWTIYAFERSLKNQAHLNAE 875
                   L+ + +F+ +  K  E        T   + EER     A  R  +    L  +
Sbjct: 1822 ------ELETRLEFEKTQVKRLENLASRLKETMEKLTEERDQRAAAENREKEQNKRLQRQ 1875

Query: 876  V----ERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIKELKS 931
            +    E +S LA++ ++++    EL+  L       E+ ++ + + ++  F+R I +L++
Sbjct: 1876 LRDTKEEMSELARKEAEASRKKHELEMDLESL----EAANQSLQADLKLAFKR-IGDLQA 1930

Query: 932  VIEADAKENPNP---NKNQ---KKLQKTREKL 957
             IE + + + N    N  Q    K QK + KL
Sbjct: 1931 AIEDEMESDENEDLINSLQDMVTKYQKKKNKL 1962


>gi|4006911|emb|CAB16841.1| trichohyalin like protein [Arabidopsis thaliana]
 gi|7270600|emb|CAB80318.1| trichohyalin like protein [Arabidopsis thaliana]
          Length = 1432

 Score = 47.0 bits (110), Expect = 0.020,   Method: Composition-based stats.
 Identities = 52/224 (23%), Positives = 105/224 (46%), Gaps = 21/224 (9%)

Query: 394 LARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQE-----KTPIKAEGDD 448
           L  A  QEEK+R+ +EA+EKA+ E+   EA+EKA++E+  K+ QE     K   + E ++
Sbjct: 664 LKAALEQEEKERKIKEAREKAENERRAVEAREKAEQERKMKEQQELELQLKEAFEKEEEN 723

Query: 449 F----GLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKE-----PGTTETDDREETERKNQ 499
                   L       +K   ++EE E    E ++  E       T E +++E   ++ Q
Sbjct: 724 RRMREAFALEQEKERRIKEAREKEENERRIKEAREKAELEQRLKATLEQEEKERQIKERQ 783

Query: 500 DILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESD-- 557
           +  +N   A +   + E            +  + +++ + +++ +K L   I + E +  
Sbjct: 784 EREENERRAKEVLEQAENERKLKEALEQKENERRLKETREKEENKKKLREAIELEEKEKR 843

Query: 558 ----YAGIKLTKKEKELQEQEE-NLRVAEIIQQSRMQSEDLQEK 596
               +   ++ ++ KE  EQEE  +R+ E  ++ R+  E+ + +
Sbjct: 844 LIEAFERAEIERRLKEDLEQEEMRMRLQEAKERERLHRENQEHQ 887



 Score = 42.8 bits (99), Expect = 0.35,   Method: Composition-based stats.
 Identities = 59/274 (21%), Positives = 121/274 (44%), Gaps = 28/274 (10%)

Query: 363 HGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKE 422
           +GN  K E R    T  N       +++ T +  A  +EE  RRE+ A EKA+ EK  K 
Sbjct: 609 NGNGKKMEMRSQSETKLNEP--LKRMEEETRIKEARLREENDRRERVAVEKAENEKRLKA 666

Query: 423 AKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEE------ELEEVKDE 476
           A E+ ++E+  K+ +E    KAE +   +          K+  ++E      E  E ++E
Sbjct: 667 ALEQEEKERKIKEARE----KAENERRAVEAREKAEQERKMKEQQELELQLKEAFEKEEE 722

Query: 477 GKKGKEPGTTETD---------DREETERKNQDILDNSLLAGK---THTKNETPAIPTAK 524
            ++ +E    E +         ++EE ER+ ++  + + L  +   T  + E       +
Sbjct: 723 NRRMREAFALEQEKERRIKEAREKEENERRIKEAREKAELEQRLKATLEQEEKERQIKER 782

Query: 525 APPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQ 584
               +  +  ++   Q + E+ L   +   E++    +  K+ +E +E ++ LR A  ++
Sbjct: 783 QEREENERRAKEVLEQAENERKLKEALEQKENE----RRLKETREKEENKKKLREAIELE 838

Query: 585 QSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQK 618
           +   +  +  E+A    +  + L  +E++ R Q+
Sbjct: 839 EKEKRLIEAFERAEIERRLKEDLEQEEMRMRLQE 872


>gi|213406047|ref|XP_002173795.1| transcription regulatory protein SWI3 [Schizosaccharomyces
           japonicus yFS275]
 gi|212001842|gb|EEB07502.1| transcription regulatory protein SWI3 [Schizosaccharomyces
           japonicus yFS275]
          Length = 584

 Score = 47.0 bits (110), Expect = 0.021,   Method: Composition-based stats.
 Identities = 43/169 (25%), Positives = 79/169 (46%), Gaps = 26/169 (15%)

Query: 458 THSVKLPPKEEELEEVKDEGKKGKEPGTTETD----DREETER--KNQDILDNSLLAGKT 511
           T S K P KEE  +EVK E +   +  + E D    + EET    K +   + ++ + + 
Sbjct: 391 TESAKFP-KEENGQEVKHELEGSTQDSSMEIDSEQANNEETSSKVKTEATDETTVESERE 449

Query: 512 HTKNETPAIPTAKAPPAQAHKGIQDKKPQ----DQREKPLASDIGV----------GESD 557
             + E P+I     PP +     +DKK +    ++R  P  +D G            E +
Sbjct: 450 QAQPEKPSISVQNVPPEKGDLMQEDKKTEVNKDEERNSP--NDAGTKKEGEKKTLSSEDE 507

Query: 558 YAGIKLTKKEKELQEQEENLRVA---EIIQQSRMQSEDLQEKAWDSYKE 603
            + I+L +K  + Q ++  LR++   ++ Q  R++S++L++   D Y E
Sbjct: 508 KSIIELNRKLVQKQIEKLTLRLSHFEKLEQHLRLESQELEKMRQDVYYE 556


>gi|90020697|ref|YP_526524.1| hypothetical protein Sde_1050 [Saccharophagus degradans 2-40]
 gi|89950297|gb|ABD80312.1| hypothetical protein Sde_1050 [Saccharophagus degradans 2-40]
          Length = 1246

 Score = 47.0 bits (110), Expect = 0.021,   Method: Composition-based stats.
 Identities = 52/220 (23%), Positives = 85/220 (38%), Gaps = 43/220 (19%)

Query: 394 LARANAQEEKQRRE-QEAKEKADRE---KADKEAKEKADRE---KADKDLQEKTPIKAEG 446
           ++R    EE Q +E +E + K DRE     DKE + K DRE     DK+LQ K       
Sbjct: 76  ISRKAPNEEPQLKEDKELQRKEDRELQRTEDKELQRKGDRELQRAEDKELQRK------- 128

Query: 447 DDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSL 506
                              + EEL+  +D+  + KE    +  + +E +RK +DI   S 
Sbjct: 129 -------------------ENEELQRKEDKELQRKEDENLQRKEDKELQRKEEDIQRASQ 169

Query: 507 ----LAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIG------VGES 556
               LA K   + E       +    Q  +   +++ + QR+   + D G      +  +
Sbjct: 170 PDKELARKPEQEQEPKIARKPQVEEQQLQRKAHEQQEEIQRKAEGSPDAGSNVTAEIRSA 229

Query: 557 DYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEK 596
              G  L    +   E   N   + +   S  QS +L +K
Sbjct: 230 MAGGDPLPLSVRRFMEPRFNADFSNVKVHSNTQSANLNKK 269


>gi|89098184|ref|ZP_01171069.1| hypothetical protein B14911_10497 [Bacillus sp. NRRL B-14911]
 gi|89087041|gb|EAR66157.1| hypothetical protein B14911_10497 [Bacillus sp. NRRL B-14911]
          Length = 334

 Score = 47.0 bits (110), Expect = 0.021,   Method: Composition-based stats.
 Identities = 50/169 (29%), Positives = 76/169 (44%), Gaps = 28/169 (16%)

Query: 396 RANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPS 455
           R   QEE  ++ +EA EKA +E   K A +KA  E+A  ++ E+T I+  G+       S
Sbjct: 35  RKAKQEELHQKAKEASEKAKQESDQKVAAKKA--EEAKFEVNEETIIRHYGE-------S 85

Query: 456 VPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKT---H 512
           +   S   P   EEL E     KKG +P     +     +R  +D  +  L+AG T   +
Sbjct: 86  IEITSYFTP---EELAEGLLVTKKGSDPERKPLEPEILRKRMEKDFPE--LVAGHTEIIY 140

Query: 513 TKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGI 561
            K +   IPT KA           KK  +  EK L++D     S ++ +
Sbjct: 141 LKEKNIVIPTMKA-----------KKKGNCMEKVLSTDSAFSNSLFSSL 178


>gi|224076429|ref|XP_002195240.1| PREDICTED: similar to rCG33450 [Taeniopygia guttata]
          Length = 2001

 Score = 47.0 bits (110), Expect = 0.021,   Method: Composition-based stats.
 Identities = 60/259 (23%), Positives = 115/259 (44%), Gaps = 24/259 (9%)

Query: 369  AETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKAD 428
             E RL Y       +FT +  Q  +       E+K   EQ+ K + +R+ AD +A +  +
Sbjct: 1312 GEWRLKYERAVREIDFTKKRLQQEL-------EDKLEVEQQGKRQLERKLADLQA-DSEE 1363

Query: 429  REKADKDLQEKTP-IKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTE 487
             ++A + L++K   + AE  D  L L      +  L  K+   +    E  +  E    E
Sbjct: 1364 SQRALQQLKKKCQRLAAELQDTKLHLEGQQGRNHDLEKKQRRFDS---ELSQAHEEAQRE 1420

Query: 488  TDDREETERKNQDILDNSLLAGKTHTKNETPAIP--TAKAPPAQAHKGIQDKKPQDQREK 545
               RE+  R+ +D+L   +   K   ++    I   T KA   +A   +QD   Q+ +++
Sbjct: 1421 RLQREKLSRE-KDVLVAEVFGLKQLLEDRDSDIAGLTQKAEALEAE--LQDISSQESKDE 1477

Query: 546  PLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYK--- 602
               + +     D    K+  +E+EL EQ   +   ++++Q++++ E   E+   ++    
Sbjct: 1478 ASLAKVKKQLRDLEA-KVKDQEEELDEQAGTI---QMLEQAKLRLEMEMERLRQTHAKEV 1533

Query: 603  EWKSLSPDEIKQRFQKYAK 621
            E +    +EI+Q +QK  K
Sbjct: 1534 ESRDEEVEEIRQSYQKKLK 1552


>gi|113367010|gb|ABI34558.1| CbpA [Streptococcus pneumoniae]
          Length = 630

 Score = 47.0 bits (110), Expect = 0.022,   Method: Composition-based stats.
 Identities = 53/203 (26%), Positives = 97/203 (47%), Gaps = 13/203 (6%)

Query: 400 QEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTH 459
           + E +  ++EAKE  + EK  K+AK K + EKA+    E+  IK + ++      +    
Sbjct: 185 EAELELVKEEAKESRNEEKV-KQAKAKVESEKAEAIRLEE--IKTDREEAKRKADAKLKE 241

Query: 460 SVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPA 519
           +V+      E  E K   K+G   G   T D++E + K+ D             K E   
Sbjct: 242 AVENNAATSEQGEPKRRVKRGVL-GEPATPDKKENDAKSSDSSVGEETLPSPSLKPEK-K 299

Query: 520 IPTAKAPPAQAHKGIQDKKPQDQREKPLAS----DIGVGESDYAGIKLTKKEKEL-QEQE 574
           +  A+   A+A K  +D+K +D+R  P  +    ++ + ESD   +K+ + E EL +E+ 
Sbjct: 300 VAEAEKKVAEAEKKAKDQKEEDRRNYPTNTYKTLELEIAESD---VKVKEAELELVKEEA 356

Query: 575 ENLRVAEIIQQSRMQSEDLQEKA 597
           +  R  E ++Q++ + E  + +A
Sbjct: 357 KESRNEEKVKQAKAKVESKKAEA 379


>gi|147899609|ref|NP_001080033.1| putative sodium-coupled neutral amino acid transporter 10 [Xenopus
           laevis]
 gi|82187049|sp|Q6PCF9|S38AA_XENLA RecName: Full=Putative sodium-coupled neutral amino acid
           transporter 10
 gi|37589396|gb|AAH59341.1| Slc38a10 protein [Xenopus laevis]
          Length = 1045

 Score = 47.0 bits (110), Expect = 0.023,   Method: Composition-based stats.
 Identities = 53/196 (27%), Positives = 89/196 (45%), Gaps = 37/196 (18%)

Query: 401 EEKQRREQEAKEKAD-REKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTH 459
           EE  + + E  E+ D +E+ D E   + + +K+D    EK  ++  GD+           
Sbjct: 396 EEPTQIKSELLERIDLKEEKDPE---QINSQKSD----EKAKVEQPGDN---------RD 439

Query: 460 SVKLPPKEEELEEVKD--EGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNET 517
             KLPPK  E E++K   EG + ++    +T  +EE +    D  D ++  G+ H     
Sbjct: 440 KPKLPPKNPEEEQIKGPIEGPQKEK----DTKKQEEVQLDRPDQGDIAVPVGEAH--RHE 493

Query: 518 PAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGES---DYAGIKLTKKEKELQEQ- 573
           P IP       Q    + +KK Q +RE+   S + +  +   D   I L +KE E+++Q 
Sbjct: 494 PPIP-------QDEVAVDEKKDQGEREEKKESVVDINSTEKKDKQQINL-EKEPEIKDQA 545

Query: 574 EENLRVAEIIQQSRMQ 589
           E N  + E + Q   Q
Sbjct: 546 EANKGINEPVPQKPPQ 561


>gi|158289702|ref|XP_311372.4| AGAP010655-PA [Anopheles gambiae str. PEST]
 gi|157018454|gb|EAA07010.5| AGAP010655-PA [Anopheles gambiae str. PEST]
          Length = 3043

 Score = 47.0 bits (110), Expect = 0.023,   Method: Composition-based stats.
 Identities = 89/422 (21%), Positives = 163/422 (38%), Gaps = 87/422 (20%)

Query: 562  KLTKKEKELQEQEENLRVA-EIIQQSRMQ-------SEDLQEKAWDSYKEWKSLSPDEIK 613
            +L ++  ++Q++E  LRVA E ++Q  ++        E ++ +A D+ KE  +L  ++ +
Sbjct: 2204 RLDQQAHDMQQKEAELRVALEQVRQKEIELGEVNSRYEKVRTEAEDATKEASALRGEQQR 2263

Query: 614  QRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSPLGLMYEK 673
            Q+ +            VD   +  +  +K I H              +S+        EK
Sbjct: 2264 QKLE------------VDTLRQQVESLNKTIGH----------KDELMSK-------LEK 2294

Query: 674  DELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGESSVRKHSFEVLSSKHQKS 733
            D L+     Y K +  +   + +L A +  +  M      G    R H  E+L+  ++  
Sbjct: 2295 DLLN-----YSKNEEKYLEQLRSLDAKETELKIMQ-----GNYKDRLHEIEILNEDNRFL 2344

Query: 734  VIAVNNFIKEITHHTRRLVKEDPKRGKSESYLSDIRSELQKVN-----KTVMDIRIKLRL 788
               +N    EI      L          +   + +  ELQ+       K +   R+++ L
Sbjct: 2345 TEDINRLKNEIARSNNSLSSNSSYVQTLKQNCTKLEEELQETKVLLTEKMLALERVRIDL 2404

Query: 789  YGIFQDIPQEQPPLYTIISGSEKILQ-----GDYTFPPLSSLDVQSKFDSSYSKLFEIFY 843
             G      QE   L + +   E I+Q     G+     LS  ++Q K       L     
Sbjct: 2405 TGC----QQEMEDLRSTLKEKEMIIQQIGADGNSLHEALS--NIQEKMQEKNVTL----- 2453

Query: 844  GDWTNNAIKEERYWTIYAFERSLKNQAHLNAEVERLSGLAQQPSDSTA----DLKELQTQ 899
                N  ++EE+       ER+    A L +EVERL    Q+  +S++     ++E+  Q
Sbjct: 2454 ----NGKLREEQ-------ERN----AQLQSEVERLKQQLQRSDNSSSPKPFSVEEIAEQ 2498

Query: 900  LSRAKKYKESNDERIVSFIRSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVA 959
            L R   Y    D  I+  I S+      + +      A   P P++    L + R+KL  
Sbjct: 2499 LERELNYSAQLDSSILKAIESDDMNTDDDRQGSSSGAAGRKPGPSRKPSDLDELRQKLQL 2558

Query: 960  QL 961
            ++
Sbjct: 2559 EM 2560


>gi|228928368|ref|ZP_04091409.1| LPXTG-motif cell wall anchor domain protein [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228831415|gb|EEM77011.1| LPXTG-motif cell wall anchor domain protein [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
          Length = 617

 Score = 47.0 bits (110), Expect = 0.024,   Method: Composition-based stats.
 Identities = 50/238 (21%), Positives = 94/238 (39%), Gaps = 60/238 (25%)

Query: 334 LGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATV 393
           + G T   +  + D +++V AD +        +  A   + +  +A+ +N + E  Q T+
Sbjct: 103 MAGATSGWLYDVNDKSAEVGADSY--------KLNAGDVVVFRFVADWSNMSQETLQQTL 154

Query: 394 LARANAQE-EKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLG 452
                 +  E+ + +   +EK +  K D   +EK +  K D   QEK P + + DD    
Sbjct: 155 DKFGTCKTAEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEK-PEEPKTDD---- 209

Query: 453 LPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTH 512
                       PK+E+ EE K +  K + P  T+T ++ + E                 
Sbjct: 210 ------------PKQEKPEEPKTDDSKQENPDGTKTPEQPKQENI--------------- 242

Query: 513 TKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKEL 570
              + PA+    A    + K +QD               G+ ESD+  + L++  K++
Sbjct: 243 ---QVPAVQVNDAISKTSEKMLQD---------------GI-ESDWVALGLSRSGKDI 281


>gi|126034351|gb|ABN71694.1| CbpA [Streptococcus pneumoniae]
          Length = 699

 Score = 47.0 bits (110), Expect = 0.024,   Method: Composition-based stats.
 Identities = 55/200 (27%), Positives = 88/200 (44%), Gaps = 20/200 (10%)

Query: 412 EKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPP----KE 467
           +KA+ E   +EAK   + EK  K   E    KAE       L  + T   K       K 
Sbjct: 186 KKAELELVKEEAKGSRNEEKIKKAKAEVESKKAEATK----LEEIKTERKKAEEEAKRKA 241

Query: 468 EELEEVKDEGKKGKEPGT---TETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAK 524
           E  EEVKD+ KK  + G      T D++E + K+ D             K+E   +  A+
Sbjct: 242 EAEEEVKDKLKKRTKRGALGEPATPDKKENDAKSSDSSVGEETLPSPSLKSEK-KVAEAE 300

Query: 525 APPAQAHKGIQDKKPQDQREKPLAS----DIGVGESDY----AGIKLTKKEKELQEQEEN 576
              A+A K  +D+K +D+R  P  +    ++ + ESD     A ++L K+E +  + EE 
Sbjct: 301 KKVAEAEKKAKDQKEEDRRNYPTNTYKTLELEIAESDVKVKEAELELVKEEAKEPQNEEK 360

Query: 577 LRVAEIIQQSRMQSEDLQEK 596
           ++ A+   +S+       EK
Sbjct: 361 IKQAKAKVESKKAEATRLEK 380


>gi|73999893|ref|XP_859857.1| PREDICTED: similar to Microtubule-associated protein 1A (MAP 1A)
            (Proliferation-related protein p80) isoform 2 [Canis
            familiaris]
          Length = 3018

 Score = 46.6 bits (109), Expect = 0.024,   Method: Composition-based stats.
 Identities = 53/222 (23%), Positives = 94/222 (42%), Gaps = 33/222 (14%)

Query: 407  EQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPK 466
            EQ+ K  A+ +K  +E  E  +++  D + ++KTP     +D       VP    K   +
Sbjct: 1661 EQKDKVLAEEDKIPEEKDETLEQKVRDIEYKDKTP-----ED------KVPELKGKALGQ 1709

Query: 467  EEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAI------ 520
             +E+ E KD+    K+    + D   E + K Q   D +L       + +  A+      
Sbjct: 1710 TDEVLEQKDKAHALKDKTLEQKDTDLEQKGKAQGQEDEALEKKDEALEQKYWALGQKDEA 1769

Query: 521  --PTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVG--------ESDYAGIKLTKKEKEL 570
              P  KA   Q  K ++DK    ++E P+  D  +         +S      + +KE+ +
Sbjct: 1770 LEPNIKA-VEQKDKALEDKDKTQEQESPVQEDKTMKPKEKVLEEKSPEKAEAVQQKEEAV 1828

Query: 571  QEQEENLRVAEIIQQSRMQSEDLQEKAWDS---YKEWKSLSP 609
             E+ + L + E   Q ++Q  D +EK W      +EW+  SP
Sbjct: 1829 LEKTKALGLEESPAQDKVQ--DQEEKYWKEQGVVQEWQETSP 1868


>gi|325911070|gb|ADZ45263.1| pneumococcal surface protein C [Streptococcus pneumoniae]
          Length = 699

 Score = 46.6 bits (109), Expect = 0.024,   Method: Composition-based stats.
 Identities = 59/235 (25%), Positives = 108/235 (45%), Gaps = 47/235 (20%)

Query: 395 ARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLP 454
           A+A  + E+    +  K K DREKA++EAK +AD ++ D+  + K+ +K  GD   LG P
Sbjct: 211 AKAKVESEQAEATRLKKIKTDREKAEEEAKRRADAKEQDESKRRKSRVK-RGD---LGEP 266

Query: 455 SVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTK 514
           + P                    KK  +  ++++   EET      +   SL  GK   +
Sbjct: 267 ATPD-------------------KKENDAKSSDSSVGEET------LPSPSLKPGKKVAE 301

Query: 515 NETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLAS----DIGVGESDYAGIKLTKKEKEL 570
            E            +A K  +D+K +D R  P  +    ++ + ESD   +++ K E EL
Sbjct: 302 AEKKV--------EEAEKKAKDQKEEDHRNYPTITYKTLELEIAESD---VEVKKAELEL 350

Query: 571 -QEQEENLRVAEIIQQSRMQSEDLQEKA--WDSYKEWKSLSPDEIKQRFQKYAKV 622
            +E+ +  R  E ++Q++ + E  + +A   +  K  +  + +E K++  +  KV
Sbjct: 351 VKEEAKGSRNEEKVKQAKAEVESKKAEATRLEKIKTDRKKAEEEAKRKAAEEDKV 405


>gi|228940367|ref|ZP_04102938.1| LPXTG-motif cell wall anchor domain protein [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|228973284|ref|ZP_04133873.1| LPXTG-motif cell wall anchor domain protein [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228786480|gb|EEM34470.1| LPXTG-motif cell wall anchor domain protein [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228819493|gb|EEM65547.1| LPXTG-motif cell wall anchor domain protein [Bacillus thuringiensis
           serovar berliner ATCC 10792]
          Length = 612

 Score = 46.6 bits (109), Expect = 0.024,   Method: Composition-based stats.
 Identities = 40/170 (23%), Positives = 76/170 (44%), Gaps = 34/170 (20%)

Query: 336 GVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLA 395
           G TYD    + D +++V AD +        + ++   + +  +++ +N + E  + T+  
Sbjct: 99  GWTYD----VNDTSAQVGADSY--------KLESGDVVVFRFVSDWSNMSQETLKETLDK 146

Query: 396 RANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPS 455
                    + E+    K +  K D   +EK +  K D   QEK P + + +D       
Sbjct: 147 FGTC-----KTEEPNGGKPEEPKTDDPKQEKPEEPKTDDPKQEK-PEEPKTND------- 193

Query: 456 VPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNS 505
                    PK+E+ EE K +G K ++P  T+T+D +  + K ++I D S
Sbjct: 194 ---------PKQEKPEEPKTDGSKQEKPDGTKTNDEKPEQPKQENIQDPS 234


>gi|228959506|ref|ZP_04121193.1| LPXTG-motif cell wall anchor domain protein [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228800186|gb|EEM47116.1| LPXTG-motif cell wall anchor domain protein [Bacillus thuringiensis
           serovar pakistani str. T13001]
          Length = 600

 Score = 46.6 bits (109), Expect = 0.025,   Method: Composition-based stats.
 Identities = 53/238 (22%), Positives = 97/238 (40%), Gaps = 70/238 (29%)

Query: 336 GVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLA 395
           G TYD    + D +++V AD +        + ++   + +  +++ +N + E  + T+  
Sbjct: 87  GWTYD----VNDTSAQVGADSY--------KLESGDVVVFRFVSDWSNMSQETLKETLDK 134

Query: 396 RANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPS 455
               + E+    +  + K D  K +K  + K D  K +K  + KT      +D       
Sbjct: 135 FGTCKPEEPNGGKPEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKT------ND------- 181

Query: 456 VPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKN 515
                    PK+E+ EE K +G K ++P  T+T+D +  + K ++I D            
Sbjct: 182 ---------PKQEKPEEPKTDGSKQEKPDGTKTNDEKPEQPKQENIQD------------ 220

Query: 516 ETPAIPTAKAPPAQAHKGI---QDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKEL 570
                     P AQ ++ I    DK  QD          G+ ESD+  I L++  K +
Sbjct: 221 ----------PSAQLNEAISKTSDKMLQD----------GI-ESDWVAIALSRSGKNV 257


>gi|322367864|ref|ZP_08042434.1| Patched family protein [Haladaptatus paucihalophilus DX253]
 gi|320552571|gb|EFW94215.1| Patched family protein [Haladaptatus paucihalophilus DX253]
          Length = 1255

 Score = 46.6 bits (109), Expect = 0.025,   Method: Composition-based stats.
 Identities = 54/278 (19%), Positives = 113/278 (40%), Gaps = 30/278 (10%)

Query: 387 ELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKAD---------REKADKDLQ 437
           +LK+     +A  ++ +QR ++  + K D ++  +E KE+           ++++D+  +
Sbjct: 177 QLKERGEELQARGEKLQQRSDELNRSKQDLQQRGEELKEEGQELKQRGQTLQQRSDELNE 236

Query: 438 EKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERK 497
            K  ++A+G +       +     +L  + EEL++   E          E+    E  + 
Sbjct: 237 SKAQLQAKGQELQAQAKQLNESKAQLRNQSEELKQRAQE--------LNESRAELEQRQA 288

Query: 498 NQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHK-GIQDKKPQDQR-------EKPLAS 549
           N ++    L   +        ++   +A   +AH+ G  +    +QR       +  L +
Sbjct: 289 NLEVRAQELNQTQRELAARNESLQERRATIEEAHQNGTINDTEYEQRLDSLREEQAELKA 348

Query: 550 DIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQS---RMQSEDLQEKAWDSYKEWKS 606
           D     ++ A ++  ++E E+  Q+   R AE+         QSE LQE A     E   
Sbjct: 349 DQAQLANESAALQQDRQELEVDAQQLEQRAAELESDKAELEQQSEQLQESAGQLQAERAE 408

Query: 607 LSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAI 644
           L  ++     Q+  K   +++S +    K  QE   A+
Sbjct: 409 L--EQRSAELQQEGKELQQAFSELQQDKKELQEKQAAL 444



 Score = 42.8 bits (99), Expect = 0.36,   Method: Composition-based stats.
 Identities = 29/133 (21%), Positives = 69/133 (51%), Gaps = 6/133 (4%)

Query: 379 ANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADK-DLQ 437
           A +AN ++ L+Q       +AQ+ +QR  +   +KA+ E+  ++ +E A + +A++ +L+
Sbjct: 351 AQLANESAALQQDRQELEVDAQQLEQRAAELESDKAELEQQSEQLQESAGQLQAERAELE 410

Query: 438 EKTP-IKAEGDDFGLGLPSVPTHSVKLPPKEEELE----EVKDEGKKGKEPGTTETDDRE 492
           +++  ++ EG +       +     +L  K+  LE    ++K+ G + KE      +D +
Sbjct: 411 QRSAELQQEGKELQQAFSELQQDKKELQEKQAALEADSQQLKERGAQLKEDSQRLQEDSQ 470

Query: 493 ETERKNQDILDNS 505
           E +    ++ ++S
Sbjct: 471 ELKEAQAELENDS 483


>gi|163728|gb|AAA30765.1| chromogranin A [Bos taurus]
 gi|296475160|gb|DAA17275.1| chromogranin-A [Bos taurus]
          Length = 449

 Score = 46.6 bits (109), Expect = 0.026,   Method: Composition-based stats.
 Identities = 64/277 (23%), Positives = 106/277 (38%), Gaps = 39/277 (14%)

Query: 361 IRHGNRFKAETRLAYS-----TIANVANFTSELKQATVLARANAQEEKQRREQEAKEKAD 415
           +RH N  K    LA       T     + + E + + VL +   Q E +   +E   K  
Sbjct: 70  LRHQNLLKELQDLALQGAKERTHQQKKHSSYEDELSEVLEKPTDQAEPKEVTEEVSSKDA 129

Query: 416 REKADKEAKEKADREKADKDLQEKTP-----IKAEGDDFGLG-----------LPSVPTH 459
            EK D   + +   E +D D  + +P      K E D+   G           L S+P  
Sbjct: 130 AEKRDDFKEVEKSDEDSDGDRPQASPGLGPGPKVEEDNQAPGEEEEAPSNAHPLASLP-- 187

Query: 460 SVKLP-PKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETP 518
           S K P P+ +E  E   +G   +E G +    R+    + ++  + +    K   + E+P
Sbjct: 188 SPKYPGPQAKEDSEGPSQGPASREKGLSAEQGRQTEREEEEEKWEEAEAREKAVPEEESP 247

Query: 519 AIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKEL----QEQE 574
                K PP+  +K       + QR  P   + G G+      K  + + E     QE+E
Sbjct: 248 PTAAFKPPPSLGNK-------ETQRAAPGWPEDGAGKMGAEEAKPPEGKGEWAHSRQEEE 300

Query: 575 ENLRVAEIIQQSRMQSEDLQE----KAWDSYKEWKSL 607
           E  R  +++ +     E  QE    K W+  K W  +
Sbjct: 301 EMARAPQVLFRGGKSGEPEQEEQLSKEWEDAKRWSKM 337


>gi|228979847|ref|ZP_04140168.1| LPXTG-motif cell wall anchor domain protein [Bacillus thuringiensis
           Bt407]
 gi|228779862|gb|EEM28108.1| LPXTG-motif cell wall anchor domain protein [Bacillus thuringiensis
           Bt407]
          Length = 600

 Score = 46.6 bits (109), Expect = 0.027,   Method: Composition-based stats.
 Identities = 40/170 (23%), Positives = 76/170 (44%), Gaps = 34/170 (20%)

Query: 336 GVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLA 395
           G TYD    + D +++V AD +        + ++   + +  +++ +N + E  + T+  
Sbjct: 87  GWTYD----VNDTSAQVGADSY--------KLESGDVVVFRFVSDWSNMSQETLKETLDK 134

Query: 396 RANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPS 455
                    + E+    K +  K D   +EK +  K D   QEK P + + +D       
Sbjct: 135 FGTC-----KTEEPNGGKPEEPKTDDPKQEKPEEPKTDDPKQEK-PEEPKTND------- 181

Query: 456 VPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNS 505
                    PK+E+ EE K +G K ++P  T+T+D +  + K ++I D S
Sbjct: 182 ---------PKQEKPEEPKTDGSKQEKPDGTKTNDEKPEQPKQENIQDPS 222


>gi|241888510|ref|ZP_04775818.1| lpxtg-motif cell wall anchor domain protein [Gemella haemolysans
           ATCC 10379]
 gi|241864777|gb|EER69151.1| lpxtg-motif cell wall anchor domain protein [Gemella haemolysans
           ATCC 10379]
          Length = 511

 Score = 46.6 bits (109), Expect = 0.027,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 60/111 (54%), Gaps = 5/111 (4%)

Query: 346 RDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQR 405
           R+  +K KA+    E     + KAE     +          E  +A  LA+  A++E+  
Sbjct: 285 RERLAKEKAEKERIERERLAKEKAEKERIEAERLAKEKAEKEHIEAERLAKEKAEKERIE 344

Query: 406 REQEAKEKADREKADKE--AKEKADREKADKDLQEKTPIKAEGDDFGLGLP 454
           +E+ AKEKA++E+ +KE  AKEK ++E+ ++   EK P+ A+G+   L +P
Sbjct: 345 KERLAKEKAEKERIEKERLAKEKTEKERLER---EKAPVTAKGEAAILEVP 392



 Score = 43.6 bits (101), Expect = 0.24,   Method: Composition-based stats.
 Identities = 41/142 (28%), Positives = 72/142 (50%), Gaps = 29/142 (20%)

Query: 394 LARANAQEEKQRREQEAKEKADREKADKE--AKEKADREKAD-----KDLQEKTPIKAEG 446
           LA+  A++E+  RE+ AKEKA++E+ ++E  AKEKA++E+ +     K+  EK  I+AE 
Sbjct: 258 LAKEKAEKERIERERLAKEKAEKERIERERLAKEKAEKERIERERLAKEKAEKERIEAE- 316

Query: 447 DDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREE--TERKNQDILDN 504
                          +L  ++ E E ++ E +  KE    E  ++E    E+  ++ ++ 
Sbjct: 317 ---------------RLAKEKAEKEHIEAE-RLAKEKAEKERIEKERLAKEKAEKERIEK 360

Query: 505 SLLAGKTHTKNETPAIPTAKAP 526
             LA +   K E   +   KAP
Sbjct: 361 ERLAKE---KTEKERLEREKAP 379



 Score = 41.2 bits (95), Expect = 1.1,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 38/54 (70%), Gaps = 2/54 (3%)

Query: 394 LARANAQEEKQRREQEAKEKADREKADKE--AKEKADREKADKDLQEKTPIKAE 445
           LA+  A++E+  RE+ AKEKA++E+ ++E  AKEKA++E+ +++   K   + E
Sbjct: 243 LAKEKAEKERIEREKLAKEKAEKERIERERLAKEKAEKERIERERLAKEKAEKE 296


>gi|145522792|ref|XP_001447240.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124414740|emb|CAK79843.1| unnamed protein product [Paramecium tetraurelia]
          Length = 644

 Score = 46.6 bits (109), Expect = 0.027,   Method: Composition-based stats.
 Identities = 52/215 (24%), Positives = 100/215 (46%), Gaps = 25/215 (11%)

Query: 387 ELKQATVLARANAQEEKQRREQEA-KEKADREKADKE---AKEKADREKADKDLQEKTPI 442
           +LKQA    R  A++EKQ+ E++A KEK +R+KA+KE   A++ A +EK ++   E+  I
Sbjct: 377 KLKQAEE-ERLKAEQEKQKAEEDARKEKQERQKAEKERQKAEQDAIKEKQERQKAEQDAI 435

Query: 443 KAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDIL 502
           K + +                  K EE  +  +E ++ +E    E   R E +R+ Q   
Sbjct: 436 KEKQER----------------QKAEEERQRTEEKRRAEENRWAEEKRRAEQDRQRQQTE 479

Query: 503 DNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIK 562
            +S L  +   + E   +        Q     Q K+ Q + ++ L         +    +
Sbjct: 480 IDS-LNRQYKLQEEKIRMQQRNLEEQQTKMENQQKQMQQESKRNLEEQ---QRREIENKQ 535

Query: 563 LTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKA 597
           + ++E+   EQE+  ++ +  +++++ SE +  KA
Sbjct: 536 IQERERLKIEQEQKHQLIKKEREAKVISESVLYKA 570


>gi|168491721|ref|ZP_02715864.1| surface protein PspC [Streptococcus pneumoniae CDC0288-04]
 gi|183574094|gb|EDT94622.1| surface protein PspC [Streptococcus pneumoniae CDC0288-04]
          Length = 685

 Score = 46.6 bits (109), Expect = 0.028,   Method: Composition-based stats.
 Identities = 48/196 (24%), Positives = 86/196 (43%), Gaps = 18/196 (9%)

Query: 395 ARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADK-----------DLQEK-TPI 442
           A+A  + EK    +  K K DREKA++EAK +AD ++ D+           DL E+ TP 
Sbjct: 214 AKAKVESEKAEATRLKKIKTDREKAEEEAKRRADAKEQDESKRRKSRVKRGDLGEQATPD 273

Query: 443 KAEGD----DFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKN 498
           K E D    D  +G  ++P+ S+K  P ++  E  K   +  K+    + +DR       
Sbjct: 274 KKENDAKSSDSSVGEETLPSPSLK--PGKKVAEAQKKVEEAKKKAKDQKEEDRRNYSTNT 331

Query: 499 QDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDY 558
              L+  +       K     +   +A  +Q  + I+  K + + +K  A+ +   ++D 
Sbjct: 332 YKTLELEIAESDVKVKEAELELVKEEAKESQNEEKIKQAKAKVESKKAEATRLENIKTDR 391

Query: 559 AGIKLTKKEKELQEQE 574
              +   K K  +E +
Sbjct: 392 KKAEEEAKRKAAEEDK 407



 Score = 41.6 bits (96), Expect = 0.93,   Method: Composition-based stats.
 Identities = 60/268 (22%), Positives = 120/268 (44%), Gaps = 55/268 (20%)

Query: 373 LAYSTIA-NVANFTSELKQATV-LARANAQEEKQRRE-QEAKEKADREKAD--KEAKEKA 427
           + Y T+   +A F  ++K+A + L +  A E +      +AK K + EKA+  +  K K 
Sbjct: 174 ITYKTLELEIAEFDVKVKEAELELVKKEADESRNEGTINQAKAKVESEKAEATRLKKIKT 233

Query: 428 DREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTE 487
           DREKA+++ + +   K                      +++E +  K   K+G + G   
Sbjct: 234 DREKAEEEAKRRADAK----------------------EQDESKRRKSRVKRG-DLGEQA 270

Query: 488 TDDREETERKNQDILDNSLLAGKTHTKNETPAI-PTAKAPPAQAHKGIQDKKPQDQREKP 546
           T D++E + K+ D    S +  +T     +P++ P  K   AQ       KK +DQ+E+ 
Sbjct: 271 TPDKKENDAKSSD----SSVGEETLP---SPSLKPGKKVAEAQKKVEEAKKKAKDQKEED 323

Query: 547 LAS---------DIGVGESDY----AGIKLTKKEKELQEQEENLRVAEI------IQQSR 587
             +         ++ + ESD     A ++L K+E +  + EE ++ A+        + +R
Sbjct: 324 RRNYSTNTYKTLELEIAESDVKVKEAELELVKEEAKESQNEEKIKQAKAKVESKKAEATR 383

Query: 588 MQSEDLQEKAWDSYKEWKSLSPDEIKQR 615
           +++     K  +   + K+   D++K++
Sbjct: 384 LENIKTDRKKAEEEAKRKAAEEDKVKEK 411


>gi|218904456|ref|YP_002452290.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus AH820]
 gi|218536875|gb|ACK89273.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus AH820]
          Length = 607

 Score = 46.6 bits (109), Expect = 0.028,   Method: Composition-based stats.
 Identities = 50/238 (21%), Positives = 94/238 (39%), Gaps = 60/238 (25%)

Query: 334 LGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATV 393
           + G T   +  + D +++V AD +        +  A   + +  +A+ +N + E  Q T+
Sbjct: 93  MAGATSGWLYDVNDKSAEVGADSY--------KLNAGDVVVFRFVADWSNMSQETLQQTL 144

Query: 394 LARANAQE-EKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLG 452
                 +  E+ + +   +EK +  K D   +EK +  K D   QEK P + + DD    
Sbjct: 145 DKFGTCKTAEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEK-PEEPKTDD---- 199

Query: 453 LPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTH 512
                       PK+E+ EE K +  K + P  T+T ++ + E                 
Sbjct: 200 ------------PKQEKPEEPKTDDSKQENPDGTKTPEQPKQENI--------------- 232

Query: 513 TKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKEL 570
              + PA+    A    + K +QD               G+ ESD+  + L++  K++
Sbjct: 233 ---QVPAVQVNDAISKTSEKMLQD---------------GI-ESDWVALGLSRSGKDI 271


>gi|228936802|ref|ZP_04099588.1| LPXTG-motif cell wall anchor domain protein [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228822847|gb|EEM68693.1| LPXTG-motif cell wall anchor domain protein [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
          Length = 607

 Score = 46.6 bits (109), Expect = 0.028,   Method: Composition-based stats.
 Identities = 50/238 (21%), Positives = 94/238 (39%), Gaps = 60/238 (25%)

Query: 334 LGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATV 393
           + G T   +  + D +++V AD +        +  A   + +  +A+ +N + E  Q T+
Sbjct: 93  MAGATSGWLYDVNDKSAEVGADSY--------KLNAGDVVVFRFVADWSNMSQETLQQTL 144

Query: 394 LARANAQE-EKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLG 452
                 +  E+ + +   +EK +  K D   +EK +  K D   QEK P + + DD    
Sbjct: 145 DKFGTCKTAEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEK-PEEPKTDD---- 199

Query: 453 LPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTH 512
                       PK+E+ EE K +  K + P  T+T ++ + E                 
Sbjct: 200 ------------PKQEKPEEPKTDDSKQENPDGTKTPEQPKQENI--------------- 232

Query: 513 TKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKEL 570
              + PA+    A    + K +QD               G+ ESD+  + L++  K++
Sbjct: 233 ---QVPAVQVNDAISKTSEKMLQD---------------GI-ESDWVALGLSRSGKDI 271


>gi|302832245|ref|XP_002947687.1| hypothetical protein VOLCADRAFT_103592 [Volvox carteri f.
           nagariensis]
 gi|300267035|gb|EFJ51220.1| hypothetical protein VOLCADRAFT_103592 [Volvox carteri f.
           nagariensis]
          Length = 231

 Score = 46.6 bits (109), Expect = 0.029,   Method: Composition-based stats.
 Identities = 38/115 (33%), Positives = 52/115 (45%), Gaps = 21/115 (18%)

Query: 330 RTEGLGGVTYDQIKQL--RDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSE 387
           R E  G +  D ++     D  +  KAD    E+   N+  AE + A            E
Sbjct: 118 RGEKSGTIFSDLLEAFGAADTGATGKAD----EVDKANKENAEVKDA------------E 161

Query: 388 LKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADR---EKADKDLQEK 439
            K A   A  NA EE ++   E  EK+  EKA+K A EKA++   EKA+K   EK
Sbjct: 162 TKSADETAEKNADEEAEKSADEKAEKSADEKAEKSADEKAEKSADEKAEKSADEK 216


>gi|240256182|ref|NP_195370.5| heat shock protein binding [Arabidopsis thaliana]
 gi|332661266|gb|AEE86666.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana]
          Length = 1422

 Score = 46.6 bits (109), Expect = 0.029,   Method: Composition-based stats.
 Identities = 52/224 (23%), Positives = 105/224 (46%), Gaps = 21/224 (9%)

Query: 394 LARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQE-----KTPIKAEGDD 448
           L  A  QEEK+R+ +EA+EKA+ E+   EA+EKA++E+  K+ QE     K   + E ++
Sbjct: 664 LKAALEQEEKERKIKEAREKAENERRAVEAREKAEQERKMKEQQELELQLKEAFEKEEEN 723

Query: 449 F----GLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKE-----PGTTETDDREETERKNQ 499
                   L       +K   ++EE E    E ++  E       T E +++E   ++ Q
Sbjct: 724 RRMREAFALEQEKERRIKEAREKEENERRIKEAREKAELEQRLKATLEQEEKERQIKERQ 783

Query: 500 DILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESD-- 557
           +  +N   A +   + E            +  + +++ + +++ +K L   I + E +  
Sbjct: 784 EREENERRAKEVLEQAENERKLKEALEQKENERRLKETREKEENKKKLREAIELEEKEKR 843

Query: 558 ----YAGIKLTKKEKELQEQEE-NLRVAEIIQQSRMQSEDLQEK 596
               +   ++ ++ KE  EQEE  +R+ E  ++ R+  E+ + +
Sbjct: 844 LIEAFERAEIERRLKEDLEQEEMRMRLQEAKERERLHRENQEHQ 887



 Score = 42.4 bits (98), Expect = 0.52,   Method: Composition-based stats.
 Identities = 59/274 (21%), Positives = 121/274 (44%), Gaps = 28/274 (10%)

Query: 363 HGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKE 422
           +GN  K E R    T  N       +++ T +  A  +EE  RRE+ A EKA+ EK  K 
Sbjct: 609 NGNGKKMEMRSQSETKLNEP--LKRMEEETRIKEARLREENDRRERVAVEKAENEKRLKA 666

Query: 423 AKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEE------ELEEVKDE 476
           A E+ ++E+  K+ +E    KAE +   +          K+  ++E      E  E ++E
Sbjct: 667 ALEQEEKERKIKEARE----KAENERRAVEAREKAEQERKMKEQQELELQLKEAFEKEEE 722

Query: 477 GKKGKEPGTTETD---------DREETERKNQDILDNSLLAGK---THTKNETPAIPTAK 524
            ++ +E    E +         ++EE ER+ ++  + + L  +   T  + E       +
Sbjct: 723 NRRMREAFALEQEKERRIKEAREKEENERRIKEAREKAELEQRLKATLEQEEKERQIKER 782

Query: 525 APPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQ 584
               +  +  ++   Q + E+ L   +   E++    +  K+ +E +E ++ LR A  ++
Sbjct: 783 QEREENERRAKEVLEQAENERKLKEALEQKENE----RRLKETREKEENKKKLREAIELE 838

Query: 585 QSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQK 618
           +   +  +  E+A    +  + L  +E++ R Q+
Sbjct: 839 EKEKRLIEAFERAEIERRLKEDLEQEEMRMRLQE 872


>gi|229122849|ref|ZP_04252058.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           95/8201]
 gi|228660713|gb|EEL16344.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           95/8201]
          Length = 607

 Score = 46.6 bits (109), Expect = 0.030,   Method: Composition-based stats.
 Identities = 50/238 (21%), Positives = 94/238 (39%), Gaps = 60/238 (25%)

Query: 334 LGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATV 393
           + G T   +  + D +++V AD +        +  A   + +  +A+ +N + E  Q T+
Sbjct: 93  MAGATSGWLYDVNDKSAEVGADNY--------KLNAGDVVVFRFVADWSNMSQETLQQTL 144

Query: 394 LARANAQE-EKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLG 452
                 +  E+ + +   +EK +  K D   +EK +  K D   QEK P + + DD    
Sbjct: 145 DKFGTCKTAEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEK-PEEPKTDD---- 199

Query: 453 LPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTH 512
                       PK+E+ EE K +  K + P  T+T ++ + E                 
Sbjct: 200 ------------PKQEKPEEPKTDDSKQENPDGTKTPEQPKQENI--------------- 232

Query: 513 TKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKEL 570
              + PA+    A    + K +QD               G+ ESD+  + L++  K++
Sbjct: 233 ---QVPAVQVNDAISKTSEKMLQD---------------GI-ESDWVALGLSRSGKDI 271


>gi|47210534|emb|CAF90653.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 1252

 Score = 46.6 bits (109), Expect = 0.031,   Method: Composition-based stats.
 Identities = 40/155 (25%), Positives = 63/155 (40%), Gaps = 7/155 (4%)

Query: 404  QRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFG-LGLPSVPTHSVK 462
            QRR Q  +   D++  +K  +E    + A      K  + A  D+   +G  S P  S K
Sbjct: 937  QRRLQPVRCPTDQQTVEKNLEEAGTPKDAVSRPAHKQTLSARADENARVGSESSPHRSGK 996

Query: 463  LPPKEEELE----EVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETP 518
                E   E    E KD+  K + PG      RE    K   + +   + G    + E  
Sbjct: 997  ESGSERRCEAAANEDKDKSSKKEAPGKAAPRPREGRVEKKGPLQEAPSVTGNKENEMEE- 1055

Query: 519  AIPTAKAP-PAQAHKGIQDKKPQDQREKPLASDIG 552
            A+P  +AP P+ A +G+ +  P+  R    AS + 
Sbjct: 1056 AVPEKQAPAPSPAAQGVAEPLPKTPRTPSKASSLA 1090


>gi|116513517|ref|YP_812423.1| ATP-dependent Zn protease [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
 gi|116092832|gb|ABJ57985.1| membrane protease FtsH catalytic subunit [Lactobacillus delbrueckii
           subsp. bulgaricus ATCC BAA-365]
          Length = 690

 Score = 46.6 bits (109), Expect = 0.031,   Method: Composition-based stats.
 Identities = 40/148 (27%), Positives = 62/148 (41%), Gaps = 22/148 (14%)

Query: 362 RHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADK 421
           R  +R  AE  L Y T+        + KQ   L +     EK   E  ++ KA   +  K
Sbjct: 551 REKHRIIAEALLKYETL--------DEKQIYSLYKTGKMPEKSSEEFPSEAKALSYEEAK 602

Query: 422 EAKEKADREKADKDLQEK----TP----IKAEGDDFGLGLPSV------PTHSVKLPPKE 467
           EA +K   EKA++D  EK    TP    +K E D   L  P        P  S+  P + 
Sbjct: 603 EAAQKRAEEKAEEDTAEKQALATPSEDAVKPETDAAKLAEPDASASQEDPADSLPTPSES 662

Query: 468 EELEEVKDEGKKGKEPGTTETDDREETE 495
           +  ++++ +        T +TDD ++ E
Sbjct: 663 DLSKDLEKDDNDAPSQKTEQTDDSDKDE 690


>gi|330793226|ref|XP_003284686.1| hypothetical protein DICPUDRAFT_53111 [Dictyostelium purpureum]
 gi|325085384|gb|EGC38792.1| hypothetical protein DICPUDRAFT_53111 [Dictyostelium purpureum]
          Length = 2666

 Score = 46.3 bits (108), Expect = 0.031,   Method: Composition-based stats.
 Identities = 40/157 (25%), Positives = 72/157 (45%), Gaps = 32/157 (20%)

Query: 398  NAQEEKQRREQEAKEKADREKA-------------DKEAKEKADRE-------------- 430
            N  E K++ ++  K++ D+EK              DK A+EK D+E              
Sbjct: 1618 NVDENKEKVDETKKQEQDKEKLCEDKPVEDKSNKDDKPAEEKLDQEDKPVEDKPIENKED 1677

Query: 431  KADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDD 490
            KA+  +++K+ + A  +D  L +        K    +++L E  +E  K  +   T  +D
Sbjct: 1678 KAEDKVEDKSSVTA-AEDKPLDVKEQEAAEEKQSSSQDKLNEKSNEDSKPSDKSVTTNED 1736

Query: 491  REETERKNQDILDNSLLAGKTHT---KNETPAIPTAK 524
            ++  E K++  +D++  A K  T   K+ETPA+P  K
Sbjct: 1737 QKPEESKDKMDVDSN-DANKLSTEPIKSETPAVPPPK 1772


>gi|262371460|ref|ZP_06064776.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
 gi|262313599|gb|EEY94650.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
          Length = 353

 Score = 46.3 bits (108), Expect = 0.031,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 40/69 (57%), Gaps = 3/69 (4%)

Query: 370 ETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREK---ADKEAKEK 426
           + +L   T A  A  T +L +  VLA   A E+K +RE EAK KA+ E+   A KEA+ K
Sbjct: 174 QQKLQARTEAEKAAATKKLAEQKVLAEKQALEDKAKREAEAKRKAEDERKSEAKKEAERK 233

Query: 427 ADREKADKD 435
           AD EK  +D
Sbjct: 234 ADAEKKAED 242


>gi|253747178|gb|EET02031.1| Coiled-coil protein [Giardia intestinalis ATCC 50581]
          Length = 1650

 Score = 46.3 bits (108), Expect = 0.032,   Method: Composition-based stats.
 Identities = 39/125 (31%), Positives = 63/125 (50%), Gaps = 11/125 (8%)

Query: 850 AIKEERYWTIYAFERSLKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKES 909
            +KEE        ER +K +A L  EV  L+GLA   +  T ++++L+ +L   +K K S
Sbjct: 547 GLKEELKRNNPEVERLVKQRAALQDEVMELTGLANSSTALTTEVRDLEQELHSLRK-KSS 605

Query: 910 NDERIVSFI--RSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSS---- 963
           N   +V  +  R   +REIK+ K  +E+ +       K+Q+ L   +EK    LS+    
Sbjct: 606 N---VVELLEKRDNIQREIKQFKIYLESPSTLLGELVKSQEDLALMKEKNAETLSAMSNL 662

Query: 964 -RLKE 967
            RL+E
Sbjct: 663 ERLRE 667


>gi|119613012|gb|EAW92606.1| microtubule-associated protein 1A, isoform CRA_a [Homo sapiens]
          Length = 3027

 Score = 46.3 bits (108), Expect = 0.032,   Method: Composition-based stats.
 Identities = 63/268 (23%), Positives = 113/268 (42%), Gaps = 31/268 (11%)

Query: 402  EKQRREQEAKEKADREKADK--EAKEKADREKADKDLQEKTPIKAEGDD-FGLGLPSVPT 458
            E++ R+ E K+ A  E+ DK  E K+K D E+ DK L++K  I  E D        ++  
Sbjct: 1633 EQKGRDLEQKDTA-LEQKDKALEPKDK-DLEEKDKALEQKDKIPEEKDKALEQKDTALEQ 1690

Query: 459  HSVKLPPKEEELEEVKDEGKKGKEPGTTETDDR--EETERKNQDILDNSLLAGKTHTKNE 516
                L PK+++LE+ KD   + KE    E D    ++         ++++   K     +
Sbjct: 1691 KDKALEPKDKDLEQ-KDRVLEQKEKIPEEKDKALDQKVRSVEHKAPEDTVAEMKDRDLEQ 1749

Query: 517  TPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEEN 576
            T   P  K    +    + +KK Q   +K  A    +G+ D A       E+ +Q  EEN
Sbjct: 1750 TDKAPEQKHQAQEQKDKVSEKKDQALEQKYWA----LGQKDEA------LEQNIQALEEN 1799

Query: 577  LRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSYKG 636
                    Q++ Q   +QE      K  +  SP+++K   +K   +  ++ +       G
Sbjct: 1800 -------HQTQEQESLVQEDKTRKPKMLEEKSPEKVKAMEEKLEALLEKTKA------LG 1846

Query: 637  TQESDKAINHFLDNDFGYYRIHNFLSQW 664
             +ES        + +  Y+R  + + +W
Sbjct: 1847 LEESLVQEGRAREQEEKYWRGQDVVQEW 1874


>gi|300718577|ref|YP_003743380.1| translation initiation factor IF-2 [Erwinia billingiae Eb661]
 gi|299064413|emb|CAX61533.1| Translation initiation factor IF-2 [Erwinia billingiae Eb661]
          Length = 895

 Score = 46.3 bits (108), Expect = 0.033,   Method: Composition-based stats.
 Identities = 46/164 (28%), Positives = 73/164 (44%), Gaps = 22/164 (13%)

Query: 405 RREQEAKEKADRE---KADKEAKEKADREKADKDLQEKTP----IKAEGDDFGLGLPSVP 457
           + ++EA++KA RE   +A +EA +KA RE A+KD     P    I+A   D         
Sbjct: 124 KAKREAQDKAKREAEEQAKREAADKAKREAAEKDKVSNQPTDEVIRATQSDKARREAEAA 183

Query: 458 THSVKLPPK-----EEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTH 512
               K   +     EEE + V +E +K  E   TE  + +E E  +   +  S  A    
Sbjct: 184 ELKRKAEEEAHRKIEEEAKRVAEEARKMAEEKGTEWTEVKEVEDTSDYHVTTSTHARAAE 243

Query: 513 TKNE--------TPAIPTAKAPPAQAHKGIQDKKPQDQREKPLA 548
            +N+        T A+  AKAP  ++ KG +  + +  RE+  A
Sbjct: 244 DENDAKVEGDRRTRAVRPAKAP--RSKKGNKHSEAKTDREEARA 285


>gi|119571567|gb|EAW51182.1| hCG27198, isoform CRA_g [Homo sapiens]
          Length = 1248

 Score = 46.3 bits (108), Expect = 0.033,   Method: Composition-based stats.
 Identities = 115/594 (19%), Positives = 241/594 (40%), Gaps = 70/594 (11%)

Query: 369  AETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKAD 428
             E RL Y       +FT +  Q          E+K   EQ+ K + +R   D +A +  +
Sbjct: 615  GEWRLKYERAVREVDFTKKRLQQEF-------EDKLEVEQQNKRQLERRLGDLQA-DSEE 666

Query: 429  REKADKDLQEKTP-IKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTE 487
             ++A + L++K   + AE  D  L L      + +L  K+   +    E  +  E    E
Sbjct: 667  SQRALQQLKKKCQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDS---ELSQAHEEAQRE 723

Query: 488  TDDREETERKNQDILDNSL-LAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKP 546
               RE+ +R+   +L  +  L  +   K+   A  T K    +A   +QD   Q+ +++ 
Sbjct: 724  KLQREKLQREKDMLLAEAFSLKQQLEEKDMDIAGFTQKVVSLEAE--LQDISSQESKDEA 781

Query: 547  LASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKS 606
              + +     D    K+  +E+EL EQ   +++ E ++Q  +Q E+  E      +E + 
Sbjct: 782  SLAKVKKQLRDLEA-KVKDQEEELDEQAGTIQMLEQLKQMEVQLEEEYEDKQKVLREKRE 840

Query: 607  LS------PDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNF 660
            L        D++ +R  +  K   +            Q     ++H  ++      I   
Sbjct: 841  LEGKLATLSDQVNRRDFESEKRLRKDLKRTKALLADAQ---LMLDHLKNSAPSKREIAQL 897

Query: 661  LSQWSPLGLMYEKDELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGESSVRK 720
             +Q        E+ E     AV  +  +     IE+L      +D ++KA  A E  +  
Sbjct: 898  KNQ-------LEESEFTCAAAVKARKAMEVE--IEDLHLQ---IDDIAKAKTALEEQL-- 943

Query: 721  HSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKED----PKRGKSESYLSDIRSELQKVN 776
                   S+ Q+    + N ++E       L+K+      +  +  + ++D++++L++ N
Sbjct: 944  -------SRLQREKNEIQNRLEEDQEDMNELMKKHKAAVAQASRDLAQINDLQAQLEEAN 996

Query: 777  KTVMDIRIKLRLYGIFQDIPQEQPPLYTIISGSEKILQGDYTFPPLSSLDVQSKFDSSYS 836
            K   +++ KL+      +  ++     +++S  E  ++          L+ + +F+ +  
Sbjct: 997  KEKQELQEKLQALQSQVEFLEQSMVDKSLVSRQEAKIR---------ELETRLEFERTQV 1047

Query: 837  KLFEIFYGDWTNNAIK--EERYWTIYAFERSLKNQAHLNAEV----ERLSGLAQQPSDST 890
            K  E        N  K  EER   I A  R  +    L  ++    E +  LA++ ++++
Sbjct: 1048 KRLESLASRLKENMEKLTEERDQRIAAENREKEQNKRLQRQLRDTKEEMGELARKEAEAS 1107

Query: 891  ADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIKELKSVIEADAKENPNPN 944
                EL+  L       E+ ++ + + ++  F+R I +L++ IE + + + N +
Sbjct: 1108 RKKHELEMDLESL----EAANQSLQADLKLAFKR-IGDLQAAIEDEMESDENED 1156


>gi|170036547|ref|XP_001846125.1| conserved hypothetical protein [Culex quinquefasciatus]
 gi|167879193|gb|EDS42576.1| conserved hypothetical protein [Culex quinquefasciatus]
          Length = 1254

 Score = 46.3 bits (108), Expect = 0.033,   Method: Composition-based stats.
 Identities = 88/405 (21%), Positives = 168/405 (41%), Gaps = 62/405 (15%)

Query: 10  YQTNNLDQDKIPSE--------DVAKT---LTSIQDNIKHLREFIIAWSSDLN---PHKD 55
           Y+ N +++D + S         D+A+T   LTSI++N     + +IA   DL+     K 
Sbjct: 613 YKLNMIERDLMASHKENAMLKADLAETRHKLTSIENNSFGSNDMVIALRQDLDDAEQTKL 672

Query: 56  RYDYIVGPIEQRL-----------KKVSERYERVVSRDLTLVIEAGLKDLKEVGDTLKRL 104
                +  +E+ L           K V+E   +  S  + L ++   K L E   T+  +
Sbjct: 673 ELQEQIASLEKELENAAEAGLELNKMVAELLNQSGSDSIALTVDELQKQLNEQQQTILSM 732

Query: 105 AETG----------EVILSDKSDRLLCRFMDMVETEDEHKINKQVRDALESAGFDLESTQ 154
             T           ++ L+++S +    F ++ +  ++ K+ K   +   +     +STQ
Sbjct: 733 NTTLADKSRENSELQITLANQSAKYGQEFDELQQAFNDLKLEKSNIEIELTNLKTGQSTQ 792

Query: 155 -ENIRK---VESALINNNMKDAFRFLELAQKSKETADSHIIEAIDVGTK--LKENTPPTT 208
            E++RK    E A +N  +K      E ++K++ +A++ + EA+    K   + NT  T 
Sbjct: 793 LESLRKETSSEIAKLNKEVKSFQSKWEDSKKAQNSAEAKV-EALQECIKDIKRGNTNGTV 851

Query: 209 FTSISKVLLKSNNMQDVVFTKIKEVVKKHVNAELGHRKLRGLAFDHTYFNDKLNQFLKEI 268
              I    LK+   Q  V  K K  ++  +  E+  R+L          +D +     EI
Sbjct: 852 DGLIDSAELKA---QLAVLKKEKNNLQDRLQGEVVARQL---------LDDHVKIINDEI 899

Query: 269 KNHQKEYDESEKGSSKARYHAAYAHIYWDLANDWVNGRVGDKSDEWARTSTNIASWIGRI 328
            N +KEY ++EK   +A         Y+      +   +  K   W +      S + RI
Sbjct: 900 SNLKKEYSQAEKDKLEAETRLEVLSSYFKDKETQLQKELSIKEAMWMQQQGETTSTVERI 959

Query: 329 TRTEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRF-KAETR 372
              +       D+++QL+    K++A+    +  H  ++ K ET+
Sbjct: 960 RFLQ-------DEVQQLKSQNEKLRAEIQTLDTAHKAQYTKLETQ 997


>gi|328867855|gb|EGG16236.1| myosin [Dictyostelium fasciculatum]
          Length = 1707

 Score = 46.3 bits (108), Expect = 0.034,   Method: Composition-based stats.
 Identities = 53/222 (23%), Positives = 92/222 (41%), Gaps = 23/222 (10%)

Query: 330  RTEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELK 389
            +T   G   +   K + +  S++K  Y   +++   R   + R    +++      ++LK
Sbjct: 928  QTHARGCAVHQHFKDMLNATSRIKRQY---KVKMARRMLQQLRAEAKSLSRAVEEQNKLK 984

Query: 390  -QATVL-ARANAQE-EKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEG 446
             QA  + AR  A++ EKQR E+E ++ A R + +KE  E   +E A +  +EK  ++ E 
Sbjct: 985  KQAEEMNARLEAEKLEKQRMEEERQQTAKRMQEEKEQAELEKQEIAKRMQEEKERVEQEK 1044

Query: 447  DDFGLGLPSVPTHSVKLPPKEEELEEVKDE---GKKGKEPGTTETDDREETERKNQDILD 503
             +    +        KL       E+ KDE    K   E   TE  + + T    QD ++
Sbjct: 1045 QEMAARIEQEKLEMAKLA------EQAKDELDVTKNKFERSQTEIVELKSTIDDMQDTIN 1098

Query: 504  NSLLAGKTHTKNETPAIP-----TAKAPPAQAHKGIQDKKPQ 540
                  K   +  TP+ P     T+  PP       +D  P 
Sbjct: 1099 QLNQ--KLQQQPSTPSKPLVATMTSVTPPPTTQPQ-EDNNPH 1137


>gi|50308363|ref|XP_454183.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49643318|emb|CAG99270.1| KLLA0E05281p [Kluyveromyces lactis]
          Length = 1755

 Score = 46.3 bits (108), Expect = 0.034,   Method: Composition-based stats.
 Identities = 136/645 (21%), Positives = 253/645 (39%), Gaps = 122/645 (18%)

Query: 370  ETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADR 429
            +T++A  ++ N +    ELKQ    A A  QE+  + +++      + K   E+K KA+ 
Sbjct: 765  DTKIALESVNNKSQKLEELKQKNTKAIAVNQEQIDKYKEKINGLQQKVKEISESKLKAE- 823

Query: 430  EKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEEL-EEVKDEGKKGKEPGTTET 488
            +  +K  +E   +  E       L S   HS KL  +E++   E  +  K+ KE GT   
Sbjct: 824  DGINKMSRELFTLTKENGKLKEDLKS---HSKKLEIQEKKYSSETANLEKQLKERGTEVQ 880

Query: 489  DDRE---------ETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKP 539
            + RE         +T  KN  IL N  +  +T   N+T  IP       +  KG+ +   
Sbjct: 881  ELRERISEDIKRIDTLEKNVTILSNQKIELETKLSNQTSLIPKL----TEKLKGLANNYK 936

Query: 540  QDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWD 599
              + E+                  T  +K L+++E N        ++ MQ+ + + ++ +
Sbjct: 937  DLENERD-----------------TLAKKILEKEEAN--------KTIMQNLNSEIESLN 971

Query: 600  SYKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDN---DFGYYR 656
              +E   L      +  QK  + F      +        ES  ++   LD        Y+
Sbjct: 972  KEREEMRLDLQYAAEYHQKEKENFDAHTQKLTSENNSKSESIISLQTKLDECERQIKEYK 1031

Query: 657  IHNFLSQWSPLGLMYEKDELHGVEAVYQKLDVLFRHCIE---NLRANKNAVDAMSKAVEA 713
              N                    E +   L  L   CIE   +L + K + D   + +E 
Sbjct: 1032 TTN--------------------EELKNSLHALNVKCIELESSLESAKQSTDNSDETIE- 1070

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKEDPKRGKSESYLSDIRSELQ 773
                           +   SVIA+N+ ++ +      L+K++ K  +    L + + ELQ
Sbjct: 1071 ---------------ELNDSVIAINDELQSVLAEKDELLKQNNKINEE---LCNYQQELQ 1112

Query: 774  KVNKTVMDIRIKL-RLYGIFQDIPQEQPPLYTIISGS--EKILQGDYTFPPLSSL----- 825
            +   +   ++ K+  L      I +E      ++  S  EK+ +       +S++     
Sbjct: 1113 EKADSCQGLQDKISSLNNEIMQISEESNDKIKLLEASNEEKVAEIKDLKSEISNIKQNAD 1172

Query: 826  ----DVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAEVERLSG 881
                 ++S+ D+  S++ ++     T N + E    TI   E++   +  L   ++    
Sbjct: 1173 TKAEKLKSEIDALKSRISDLESLLETKNKLYENSQTTITELEQA---KEKLQRTIQEQYK 1229

Query: 882  LAQQPSDS----TADLKELQTQLSRAK-----KYKESN--DERIVSFIRSEFEREIK--- 927
             AQ   DS       +K L++QL + K     K KE++  DE I S +++E E  +K   
Sbjct: 1230 EAQYSEDSLLAGENKIKHLESQLEKLKLSSVSKEKEAHLKDEEIKS-VKAEIEDNVKLVQ 1288

Query: 928  ----ELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL 968
                EL  + + ++  N   NK ++K +  + KL   L++   EL
Sbjct: 1289 AKSTELDELKKQNSVLNSKLNKEKEKAKIEQHKLRESLATARDEL 1333


>gi|240282287|gb|EER45790.1| DNA ligase [Ajellomyces capsulatus H143]
          Length = 899

 Score = 46.3 bits (108), Expect = 0.034,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 98/239 (41%), Gaps = 34/239 (14%)

Query: 379 ANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKA----DKEAKEKADREKADK 434
           AN  + +   KQAT LA +     +++R+  +  +A+ ++A    DK+     D  K + 
Sbjct: 20  ANAGSASLPKKQAT-LAFSTGSGSREKRQNGSATQANEDEALVNGDKDVDMNNDATKKE- 77

Query: 435 DLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREET 494
                              P + +   + P  E    +     +K      ++  D ++ 
Sbjct: 78  -------------------PKIDSRRSETPAVESRESDSDSAAEKSLSHSDSDFPDSKKL 118

Query: 495 ERKNQDILDN--SLLAGKTHTKNETPA--IPTAKAPPAQAHKGIQDKKPQDQREKPLASD 550
           +R+   + D+  S +   T  +   P+      K P A  ++  + + P++ REKP+A D
Sbjct: 119 KREKSPMEDSDESNVQPVTKRRKRAPSNRKTAGKKPSASPNQNKRTRSPKNAREKPVAED 178

Query: 551 IGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSP 609
               ES  A  +    E +    EE  ++A+  +++  Q+  L+    D Y +WK+  P
Sbjct: 179 ---KESSSAEQEDNISENDDDLAEEKPKIAQKKRETVQQA--LKGSRKDPYPDWKAGEP 232


>gi|73999891|ref|XP_535449.2| PREDICTED: similar to Microtubule-associated protein 1A (MAP 1A)
            (Proliferation-related protein p80) isoform 1 [Canis
            familiaris]
          Length = 2794

 Score = 46.3 bits (108), Expect = 0.036,   Method: Composition-based stats.
 Identities = 53/222 (23%), Positives = 94/222 (42%), Gaps = 33/222 (14%)

Query: 407  EQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPK 466
            EQ+ K  A+ +K  +E  E  +++  D + ++KTP     +D       VP    K   +
Sbjct: 1437 EQKDKVLAEEDKIPEEKDETLEQKVRDIEYKDKTP-----ED------KVPELKGKALGQ 1485

Query: 467  EEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAI------ 520
             +E+ E KD+    K+    + D   E + K Q   D +L       + +  A+      
Sbjct: 1486 TDEVLEQKDKAHALKDKTLEQKDTDLEQKGKAQGQEDEALEKKDEALEQKYWALGQKDEA 1545

Query: 521  --PTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVG--------ESDYAGIKLTKKEKEL 570
              P  KA   Q  K ++DK    ++E P+  D  +         +S      + +KE+ +
Sbjct: 1546 LEPNIKA-VEQKDKALEDKDKTQEQESPVQEDKTMKPKEKVLEEKSPEKAEAVQQKEEAV 1604

Query: 571  QEQEENLRVAEIIQQSRMQSEDLQEKAWDS---YKEWKSLSP 609
             E+ + L + E   Q ++Q  D +EK W      +EW+  SP
Sbjct: 1605 LEKTKALGLEESPAQDKVQ--DQEEKYWKEQGVVQEWQETSP 1644


>gi|328351032|emb|CCA37432.1| DNA repair protein RAD50 [Pichia pastoris CBS 7435]
          Length = 1342

 Score = 46.3 bits (108), Expect = 0.038,   Method: Composition-based stats.
 Identities = 68/314 (21%), Positives = 134/314 (42%), Gaps = 31/314 (9%)

Query: 679 VEAVYQKLDVLFRHCIENLRANKNAVDAM--SKAVEAGESSVRKHSFEVLSSKHQKSVIA 736
           +E    K  VLF  C + L       D       +E G++  +      L  + ++S   
Sbjct: 435 IEEASSKASVLFSTCKKKLDLQTEHYDTRIHDLNLEIGQAESK------LGKEEERSSYL 488

Query: 737 VNNFIKEITHHTRRLVKEDPKRGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIP 796
            N+ I  +    + L K       +ES  ++ + +++++ K + D+R + +L  I  D+ 
Sbjct: 489 KND-INSLKKRNQALQKSINDINSNESEFNETKEDIERLTKQLEDLRSENKLASINNDLK 547

Query: 797 QEQPPLYTIISG----SEKILQGDYTFPPLSSLDV----QSKFDSSYSKLFEIF---YGD 845
           Q Q  +  + +     +++I+  +     L+ L +      K +SS SKL E +   + +
Sbjct: 548 QNQDKILVLENELDQINKQIITSNRQGEVLAKLHLLKENTKKGNSSISKLVESYGEQFKE 607

Query: 846 WTNNAIKEERYWTIYAFERSLKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKK 905
           +T   +  E    ++  E   K Q   + + + ++   Q   +S  D   L+ +L +++ 
Sbjct: 608 FTGEDLNPEDCLPVF-LEVLKKRQEDTDLKRKEVASFKQNEYESNHDRSLLEKKLEQSRS 666

Query: 906 YKESNDERIVSFIR----SEFEREIKELKSVIE---ADAKEN-PNPNKNQKKLQKTREKL 957
             +    RIVS +      E+E  +K+L+S  E    ++K N    N N+  L+  +E  
Sbjct: 667 QLQECRSRIVSILEDEPIEEYESIVKDLESDYEIALQNSKLNWATKNFNETALKIAKEHQ 726

Query: 958 VAQLSSRLKELNID 971
              L  R  ELN D
Sbjct: 727 YCILCKR--ELNHD 738


>gi|311268646|ref|XP_003132147.1| PREDICTED: TPR and ankyrin repeat-containing protein 1-like, partial
            [Sus scrofa]
          Length = 1435

 Score = 46.3 bits (108), Expect = 0.038,   Method: Composition-based stats.
 Identities = 30/113 (26%), Positives = 56/113 (49%), Gaps = 10/113 (8%)

Query: 533  GIQDKKPQDQREKPLA-----SDIGVGESDYAGIKLTKKEKEL----QEQEENLRVAEII 583
            G Q +  +++  +P A     +D+   + D  G+K T+  +      Q  EE    A+ +
Sbjct: 1207 GAQTEHSREEGREPGAGNFKKADVDRTQCDLCGVKFTRGPENYFGPDQAFEEAASEADAL 1266

Query: 584  QQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQR-FQKYAKVFYRSYSPVDGSYK 635
             ++ ++ ED QEK  +SY++   L   + +QR +QKY++ F+    P  G  K
Sbjct: 1267 SRAELEDEDGQEKNSESYEQHIRLEDHQRQQRAYQKYSEFFHEKVEPAIGEGK 1319


>gi|22094119|ref|NP_035716.1| myosin-XVIIIa [Mus musculus]
 gi|7416032|dbj|BAA93660.1| myosin containing PDZ domain [Mus musculus]
 gi|56205923|emb|CAI24425.1| myosin XVIIIa [Mus musculus]
 gi|148680948|gb|EDL12895.1| myosin XVIIIa [Mus musculus]
          Length = 2035

 Score = 46.3 bits (108), Expect = 0.039,   Method: Composition-based stats.
 Identities = 110/613 (17%), Positives = 255/613 (41%), Gaps = 71/613 (11%)

Query: 369  AETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKAD 428
             E RL Y       +FT +  Q  +       E+K   EQ+++ + +R   D +A +  +
Sbjct: 1365 GEWRLKYERAVREVDFTKKRLQQEL-------EDKMEVEQQSRRQLERRLGDLQA-DSDE 1416

Query: 429  REKADKDLQEKTP-IKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTE 487
             ++A + L++K   + AE  D  L L      + +L  K+   +    E  +  E    E
Sbjct: 1417 SQRALQQLKKKCQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDS---ELSQAHEETQRE 1473

Query: 488  TDDREETERKNQDILDNSL-LAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKP 546
               RE+ +R+   +L  +  L  +   K+   A  T K    +A   +QD   Q+ +++ 
Sbjct: 1474 KLQREKLQREKDMLLAEAFSLKQQMEEKDLDIAGFTQKVVSLEAE--LQDISSQESKDEA 1531

Query: 547  LASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKS 606
              + +     D    K+  +E+EL EQ  ++   ++++Q++++ E   E+   ++ +   
Sbjct: 1532 SLAKVKKQLRDLEA-KVKDQEEELDEQAGSI---QMLEQAKLRLEMEMERMRQTHSKEME 1587

Query: 607  LSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSP 666
               +E+++  Q   K   +    ++  Y+  Q   KA+    + +     + + ++Q   
Sbjct: 1588 SRDEEVEEARQSCQKKLKQMEVQLEEEYEDKQ---KALREKRELESKLSTLSDQVNQRDF 1644

Query: 667  LGLMYEKDELHGVEAVYQKLDVLFRHCIENLRAN------KNAVD-------AMSKAVEA 713
                  + +L   +A+     ++  H   N  +       KN ++       A  KA +A
Sbjct: 1645 ESEKRLRKDLKRTKALLADAQIMLDHLKNNAPSKREIAQLKNQLEESEFTCAAAVKARKA 1704

Query: 714  GESSVR------------KHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKED----PK 757
             E  +             K + E   S+ Q+    + N ++E       L+K+      +
Sbjct: 1705 MEVEMEDLHLQIDDIAKAKTALEEQLSRLQREKNEIQNRLEEDQEDMNELMKKHKAAVAQ 1764

Query: 758  RGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLYTIISGSEKILQGDY 817
              +  + ++D+++++++ NK   +++ KL+      +  ++     +++S  E  ++   
Sbjct: 1765 ASRDMAQMNDLQAQIEESNKEKQELQEKLQALQSQVEFLEQSMVDKSLVSRQEAKIR--- 1821

Query: 818  TFPPLSSLDVQSKFDSSYSKLFEIFYGDW--TNNAIKEERYWTIYAFERSLKNQAHLNAE 875
                   L+ + +F+ +  K  E        T   + EER     A  R  +    L  +
Sbjct: 1822 ------ELETRLEFEKTQVKRLENLASRLKETMEKLTEERDQRAAAENREKEQNKRLQRQ 1875

Query: 876  V----ERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIKELKS 931
            +    E +S LA++ ++++    EL+  L       E+ ++ + + ++  F+R I +L++
Sbjct: 1876 LRDTKEEMSELARKEAEASRKKHELEMDLESL----EAANQSLQADLKLAFKR-IGDLQA 1930

Query: 932  VIEADAKENPNPN 944
             IE + + + N +
Sbjct: 1931 AIEDEMESDENED 1943


>gi|187951929|gb|AAI38367.1| Myo18a protein [Mus musculus]
          Length = 2047

 Score = 46.3 bits (108), Expect = 0.039,   Method: Composition-based stats.
 Identities = 110/613 (17%), Positives = 255/613 (41%), Gaps = 71/613 (11%)

Query: 369  AETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKAD 428
             E RL Y       +FT +  Q  +       E+K   EQ+++ + +R   D +A +  +
Sbjct: 1377 GEWRLKYERAVREVDFTKKRLQQEL-------EDKMEVEQQSRRQLERRLGDLQA-DSDE 1428

Query: 429  REKADKDLQEKTP-IKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTE 487
             ++A + L++K   + AE  D  L L      + +L  K+   +    E  +  E    E
Sbjct: 1429 SQRALQQLKKKCQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDS---ELSQAHEETQRE 1485

Query: 488  TDDREETERKNQDILDNSL-LAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKP 546
               RE+ +R+   +L  +  L  +   K+   A  T K    +A   +QD   Q+ +++ 
Sbjct: 1486 KLQREKLQREKDMLLAEAFSLKQQMEEKDLDIAGFTQKVVSLEAE--LQDISSQESKDEA 1543

Query: 547  LASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKS 606
              + +     D    K+  +E+EL EQ  ++   ++++Q++++ E   E+   ++ +   
Sbjct: 1544 SLAKVKKQLRDLEA-KVKDQEEELDEQAGSI---QMLEQAKLRLEMEMERMRQTHSKEME 1599

Query: 607  LSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSP 666
               +E+++  Q   K   +    ++  Y+  Q   KA+    + +     + + ++Q   
Sbjct: 1600 SRDEEVEEARQSCQKKLKQMEVQLEEEYEDKQ---KALREKRELESKLSTLSDQVNQRDF 1656

Query: 667  LGLMYEKDELHGVEAVYQKLDVLFRHCIENLRAN------KNAVD-------AMSKAVEA 713
                  + +L   +A+     ++  H   N  +       KN ++       A  KA +A
Sbjct: 1657 ESEKRLRKDLKRTKALLADAQIMLDHLKNNAPSKREIAQLKNQLEESEFTCAAAVKARKA 1716

Query: 714  GESSVR------------KHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKED----PK 757
             E  +             K + E   S+ Q+    + N ++E       L+K+      +
Sbjct: 1717 MEVEMEDLHLQIDDIAKAKTALEEQLSRLQREKNEIQNRLEEDQEDMNELMKKHKAAVAQ 1776

Query: 758  RGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLYTIISGSEKILQGDY 817
              +  + ++D+++++++ NK   +++ KL+      +  ++     +++S  E  ++   
Sbjct: 1777 ASRDMAQMNDLQAQIEESNKEKQELQEKLQALQSQVEFLEQSMVDKSLVSRQEAKIR--- 1833

Query: 818  TFPPLSSLDVQSKFDSSYSKLFEIFYGDW--TNNAIKEERYWTIYAFERSLKNQAHLNAE 875
                   L+ + +F+ +  K  E        T   + EER     A  R  +    L  +
Sbjct: 1834 ------ELETRLEFEKTQVKRLENLASRLKETMEKLTEERDQRAAAENREKEQNKRLQRQ 1887

Query: 876  V----ERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIKELKS 931
            +    E +S LA++ ++++    EL+  L       E+ ++ + + ++  F+R I +L++
Sbjct: 1888 LRDTKEEMSELARKEAEASRKKHELEMDLESL----EAANQSLQADLKLAFKR-IGDLQA 1942

Query: 932  VIEADAKENPNPN 944
             IE + + + N +
Sbjct: 1943 AIEDEMESDENED 1955


>gi|254673626|emb|CBA09169.1| IgA-specific serine endopeptidase [Neisseria meningitidis alpha275]
          Length = 1545

 Score = 46.3 bits (108), Expect = 0.040,   Method: Composition-based stats.
 Identities = 59/228 (25%), Positives = 92/228 (40%), Gaps = 26/228 (11%)

Query: 381  VANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKT 440
            VA  + +  QA    R  A+ E+ +R+Q   EK  R+KA KEAK + D     +  QE+ 
Sbjct: 1012 VAPPSPQANQAEEAKRQQAKAEQVKRQQAEAEKVARQKA-KEAKRQQDALARQQAEQERQ 1070

Query: 441  PIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQD 500
             ++AE     +          K   +  EL   ++E +K  E    +   + ETERK  +
Sbjct: 1071 RLEAERQAAEIAKQKAEAEEAK--RQAAELARQQEEARKAAELAAKQ---KAETERKAAE 1125

Query: 501  ILDNSLLAGKTHT-----KNETPAIPTAKAPPAQAH-KGIQDKKPQDQREKPL---ASDI 551
            I +    A +        K E      A++ P + + + I  +   D   + L   A + 
Sbjct: 1126 IAEQKAEAEREAAELAKQKAEEEGRQAAQSQPKRRNRRAIPPELSSDATTRALPRIARNS 1185

Query: 552  GVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSED---LQEK 596
                SDY  I L   E E         V+E +  S  Q +D   L EK
Sbjct: 1186 NPDASDYEEIPLDALEDE--------DVSESVDTSDKQPQDNTELHEK 1225


>gi|153008083|ref|YP_001369298.1| translation initiation factor IF-2 [Ochrobactrum anthropi ATCC
           49188]
 gi|166232567|sp|A6WWW5|IF2_OCHA4 RecName: Full=Translation initiation factor IF-2
 gi|151559971|gb|ABS13469.1| translation initiation factor IF-2 [Ochrobactrum anthropi ATCC
           49188]
          Length = 964

 Score = 45.9 bits (107), Expect = 0.041,   Method: Composition-based stats.
 Identities = 53/234 (22%), Positives = 95/234 (40%), Gaps = 27/234 (11%)

Query: 389 KQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDD 448
           ++A   A+    EE+ R  +EAK +A  E+  + AKE+   E A +  +E+  +KAE D 
Sbjct: 162 RRALEEAQVREVEERARAVEEAKRRA--EEDARRAKER--EESARRQAEEEARLKAEAD- 216

Query: 449 FGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLA 508
                      + K  P+ E   E +D+ +   +    +   R +  R  Q         
Sbjct: 217 ---ARRKAEEEAAKRMPQPEARTERRDDARPAPQGNRPQQAGRPQGNRPPQ--------G 265

Query: 509 GKTHTKNETPAIPT-AKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKE 567
           G+       PA P+ A A P           PQ Q  K +ASD    + D  G  LT   
Sbjct: 266 GRPQQGGPRPAAPSLADAAPIPG-----KPLPQSQLRKTVASD----DDDRRGGGLTAAR 316

Query: 568 KELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAK 621
           +    + E +R  ++++    +       + +   E +S S   +++R +K+ +
Sbjct: 317 RGAPAKPE-VRAPKVVKTEDDRRRGKLTISSNLEDEGRSRSLSAMRRRQEKFKR 369


>gi|119571569|gb|EAW51184.1| hCG27198, isoform CRA_i [Homo sapiens]
          Length = 2057

 Score = 45.9 bits (107), Expect = 0.042,   Method: Composition-based stats.
 Identities = 117/636 (18%), Positives = 257/636 (40%), Gaps = 85/636 (13%)

Query: 369  AETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKAD 428
             E RL Y       +FT +  Q          E+K   EQ+ K + +R   D +A +  +
Sbjct: 1372 GEWRLKYERAVREVDFTKKRLQQEF-------EDKLEVEQQNKRQLERRLGDLQA-DSEE 1423

Query: 429  REKADKDLQEKTP-IKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTE 487
             ++A + L++K   + AE  D  L L      + +L  K+   +    E  +  E    E
Sbjct: 1424 SQRALQQLKKKCQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDS---ELSQAHEEAQRE 1480

Query: 488  TDDREETERKNQDILDNSL-LAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKP 546
               RE+ +R+   +L  +  L  +   K+   A  T K    +A   +QD   Q+ +++ 
Sbjct: 1481 KLQREKLQREKDMLLAEAFSLKQQLEEKDMDIAGFTQKVVSLEAE--LQDISSQESKDEA 1538

Query: 547  LASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKS 606
              + +     D    K+  +E+EL EQ   +   ++++Q++++ E   E+   ++ +   
Sbjct: 1539 SLAKVKKQLRDLEA-KVKDQEEELDEQAGTI---QMLEQAKLRLEMEMERMRQTHSKEME 1594

Query: 607  LSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSP 666
               +E+++  Q   K   +    ++  Y+  Q+  +             ++     Q + 
Sbjct: 1595 SRDEEVEEARQSCQKKLKQMEVQLEEEYEDKQKVLREKRELEG------KLATLSDQVNR 1648

Query: 667  LGLMYEK---DELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGE----SSVR 719
                 EK    +L   +A+     ++  H ++N   +K  +  +   +E  E    ++V+
Sbjct: 1649 RDFESEKRLRKDLKRTKALLADAQLMLDH-LKNSAPSKREIAQLKNQLEESEFTCAAAVK 1707

Query: 720  ----------------------KHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKED-- 755
                                  K + E   S+ Q+    + N ++E       L+K+   
Sbjct: 1708 ARKAMEVEIEDLHLQIDDIAKAKTALEEQLSRLQREKNEIQNRLEEDQEDMNELMKKHKA 1767

Query: 756  --PKRGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLYTIISGSEKIL 813
               +  +  + ++D++++L++ NK   +++ KL+      +  ++     +++S  E  +
Sbjct: 1768 AVAQASRDLAQINDLQAQLEEANKEKQELQEKLQALQSQVEFLEQSMVDKSLVSRQEAKI 1827

Query: 814  QGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIK--EERYWTIYAFERSLKNQAH 871
            +          L+ + +F+ +  K  E        N  K  EER   I A  R  +    
Sbjct: 1828 R---------ELETRLEFERTQVKRLESLASRLKENMEKLTEERDQRIAAENREKEQNKR 1878

Query: 872  LNAEV----ERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIK 927
            L  ++    E +  LA++ ++++    EL+  L       E+ ++ + + ++  F+R I 
Sbjct: 1879 LQRQLRDTKEEMGELARKEAEASRKKHELEMDLESL----EAANQSLQADLKLAFKR-IG 1933

Query: 928  ELKSVIEADAKENPNP---NKNQ---KKLQKTREKL 957
            +L++ IE + + + N    N  Q    K QK + KL
Sbjct: 1934 DLQAAIEDEMESDENEDLINSLQDMVTKYQKRKNKL 1969


>gi|225855684|ref|YP_002737196.1| surface protein PspC [Streptococcus pneumoniae JJA]
 gi|225723367|gb|ACO19220.1| surface protein PspC [Streptococcus pneumoniae JJA]
          Length = 599

 Score = 45.9 bits (107), Expect = 0.042,   Method: Composition-based stats.
 Identities = 59/235 (25%), Positives = 108/235 (45%), Gaps = 47/235 (20%)

Query: 395 ARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLP 454
           A+A  + E+    +  K K DREKA++EAK +AD ++ D+  + K+ +K  GD   LG P
Sbjct: 111 AKAKVESEQAEATRLKKIKTDREKAEEEAKRRADAKEQDESKRRKSRVK-RGD---LGEP 166

Query: 455 SVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTK 514
           + P                    KK  +  ++++   EET      +   SL  GK   +
Sbjct: 167 ATPD-------------------KKENDAKSSDSSVGEET------LPSPSLKPGKKVAE 201

Query: 515 NETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLAS----DIGVGESDYAGIKLTKKEKEL 570
            E            +A K  +D+K +D R  P  +    ++ + ESD   +++ K E EL
Sbjct: 202 AEKKV--------EEAEKKAKDQKEEDHRNYPTITYKTLELEIAESD---VEVKKAELEL 250

Query: 571 -QEQEENLRVAEIIQQSRMQSEDLQEKA--WDSYKEWKSLSPDEIKQRFQKYAKV 622
            +E+ +  R  E ++Q++ + E  + +A   +  K  +  + +E K++  +  KV
Sbjct: 251 VKEEAKGSRNEEKVKQAKAEVESKKAEATRLEKIKTDRKKAEEEAKRKAAEEDKV 305


>gi|119613013|gb|EAW92607.1| microtubule-associated protein 1A, isoform CRA_b [Homo sapiens]
          Length = 2984

 Score = 45.9 bits (107), Expect = 0.042,   Method: Composition-based stats.
 Identities = 63/268 (23%), Positives = 113/268 (42%), Gaps = 31/268 (11%)

Query: 402  EKQRREQEAKEKADREKADK--EAKEKADREKADKDLQEKTPIKAEGDD-FGLGLPSVPT 458
            E++ R+ E K+ A  E+ DK  E K+K D E+ DK L++K  I  E D        ++  
Sbjct: 1633 EQKGRDLEQKDTA-LEQKDKALEPKDK-DLEEKDKALEQKDKIPEEKDKALEQKDTALEQ 1690

Query: 459  HSVKLPPKEEELEEVKDEGKKGKEPGTTETDDR--EETERKNQDILDNSLLAGKTHTKNE 516
                L PK+++LE+ KD   + KE    E D    ++         ++++   K     +
Sbjct: 1691 KDKALEPKDKDLEQ-KDRVLEQKEKIPEEKDKALDQKVRSVEHKAPEDTVAEMKDRDLEQ 1749

Query: 517  TPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEEN 576
            T   P  K    +    + +KK Q   +K  A    +G+ D A       E+ +Q  EEN
Sbjct: 1750 TDKAPEQKHQAQEQKDKVSEKKDQALEQKYWA----LGQKDEA------LEQNIQALEEN 1799

Query: 577  LRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSYKG 636
                    Q++ Q   +QE      K  +  SP+++K   +K   +  ++ +       G
Sbjct: 1800 -------HQTQEQESLVQEDKTRKPKMLEEKSPEKVKAMEEKLEALLEKTKA------LG 1846

Query: 637  TQESDKAINHFLDNDFGYYRIHNFLSQW 664
             +ES        + +  Y+R  + + +W
Sbjct: 1847 LEESLVQEGRAREQEEKYWRGQDVVQEW 1874


>gi|38566922|emb|CAE76225.1| related to putative cytoplasmic structural protein [Neurospora
            crassa]
          Length = 2556

 Score = 45.9 bits (107), Expect = 0.043,   Method: Composition-based stats.
 Identities = 51/210 (24%), Positives = 93/210 (44%), Gaps = 20/210 (9%)

Query: 390  QATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKD--LQEKTPIKAEGD 447
            Q   L     + E+   E+  +E+  REKA++  +EKA+REKA+++    EK   KAE +
Sbjct: 1547 QEDQLKAQKVETERLEHEKAEQERVAREKAERAEREKAEREKAEREQVALEKAREKAEQE 1606

Query: 448  DFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLL 507
                        + +   + E+ E  + E +K +E    E   RE+ E +  +     + 
Sbjct: 1607 -----------KAEREKAEREKAERERVEREKAREKLEQERIAREKAELEKAE--RERIA 1653

Query: 508  AGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKE 567
            A +   K E       KA   +       KK + ++ +   +++   E +    +  +K+
Sbjct: 1654 AEEARKKAELEKAELEKAERERIAAEKARKKAELEKAELEKAELEKAERERVAAEKARKK 1713

Query: 568  KELQEQEENLRVAEIIQQSRMQSEDLQEKA 597
             E QE+ E  RV    ++ + Q + LQEKA
Sbjct: 1714 AE-QEKAEQERV----EREKAQEKALQEKA 1738



 Score = 40.1 bits (92), Expect = 2.3,   Method: Composition-based stats.
 Identities = 56/236 (23%), Positives = 99/236 (41%), Gaps = 31/236 (13%)

Query: 380 NVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKE-----------KAD 428
           NVA      ++  VL     Q  + +   E + KA+RE AD++  E           K D
Sbjct: 614 NVAKTPDNPEKPEVLEARGEQAPEYKTLAEERRKAEREDADRKPAEQTVKGEEEETAKND 673

Query: 429 REKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTET 488
            +   K L+E+   K E +D  L      T       ++EE  +  ++ K+ +     E 
Sbjct: 674 GDVKPKTLEEQQKAKQEEEDRKLAQQIAKT-------QQEEAAKASEDAKRRQ---AEEA 723

Query: 489 DD-REETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPL 547
           DD  + TE +    L   + A +     E   I  A+A  A+A +  + +K    + K  
Sbjct: 724 DDLAKSTEAEKDKALGERIKAAEAEMLKE---IGHARAKVAEAERLTKTEK---NKVKTA 777

Query: 548 ASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKE 603
            S++ V   D   ++  +++     QE   + AE ++  R ++ +L EKA  + KE
Sbjct: 778 NSEMSVARIDAEALEEKRRKA---AQEGKAKDAEALEDRRRKALELAEKAAVAEKE 830



 Score = 38.9 bits (89), Expect = 6.2,   Method: Composition-based stats.
 Identities = 44/151 (29%), Positives = 70/151 (46%), Gaps = 13/151 (8%)

Query: 359  AEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRRE----QEAKEKA 414
            AE     R KAE   A            +L+Q  + AR  A+ EK  RE    +EA++KA
Sbjct: 1603 AEQEKAEREKAEREKAERERVEREKAREKLEQERI-AREKAELEKAERERIAAEEARKKA 1661

Query: 415  DREKADKEAKEKADREK--ADKDLQEKTPIKAEGDDFGLGLPS---VPTHSVKLPPKEEE 469
            + EKA+ E   KA+RE+  A+K  ++    KAE +   L       V     +   ++E+
Sbjct: 1662 ELEKAELE---KAERERIAAEKARKKAELEKAELEKAELEKAERERVAAEKARKKAEQEK 1718

Query: 470  LEEVKDEGKKGKEPGTTETDDREETERKNQD 500
             E+ + E +K +E    E  ++E   RK  +
Sbjct: 1719 AEQERVEREKAQEKALQEKAEQERIARKKAE 1749


>gi|224094819|ref|XP_002310250.1| predicted protein [Populus trichocarpa]
 gi|222853153|gb|EEE90700.1| predicted protein [Populus trichocarpa]
          Length = 1234

 Score = 45.9 bits (107), Expect = 0.044,   Method: Composition-based stats.
 Identities = 40/141 (28%), Positives = 74/141 (52%), Gaps = 22/141 (15%)

Query: 394 LARANAQEEKQRREQEAKEKADREKADKEAKE----KADREKADKDLQEKTPIKAEGDDF 449
           L  A+ +EEK+RR +EA+++ + EK  KEA E    K  RE  +K+  EK   K   ++ 
Sbjct: 651 LREAHQREEKERRLKEARQREENEKRLKEAIEHENKKKQREANEKEGNEKK-CKEVFENE 709

Query: 450 GLGLPSVPTHSVKLPPKEEELEEVKDEGKKGK----------EPGTTETDDREETERKNQ 499
           G+G       +++    E++LEE  ++ + GK          EPGT  +++  +  ++  
Sbjct: 710 GIG------DTLEQETTEKQLEETNEQDESGKLRETPEGEVSEPGTCTSEEMGDASKETC 763

Query: 500 DILDNSLLAGKTHTKNETPAI 520
           + L+N+ +  K  ++N+ P I
Sbjct: 764 N-LENTEVKLKDGSENDKPGI 783


>gi|221485442|gb|EEE23723.1| conserved hypothetical protein [Toxoplasma gondii GT1]
          Length = 3699

 Score = 45.9 bits (107), Expect = 0.044,   Method: Composition-based stats.
 Identities = 42/147 (28%), Positives = 65/147 (44%), Gaps = 34/147 (23%)

Query: 402  EKQRREQEAKEKADREKADKEAKEKADREKADKDLQ---EKTPIKAEGDDFGLGLPSVPT 458
            E++ +EQE K + DRE  ++E K + DRE+ ++  +   E+   K E D           
Sbjct: 3434 EREGKEQERKAETDRE--EQERKTETDREEQERKTETDREEQERKTETD----------- 3480

Query: 459  HSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETP 518
                      E +E K E  + ++   TET DREE ERK +   D      KT T  E  
Sbjct: 3481 ---------REEQERKTETDREEQERKTET-DREEQERKTET--DREEQKRKTETDREEQ 3528

Query: 519  AIPTAKAPPAQAHKGIQDKKPQDQREK 545
               T      +  +G Q++K +  RE+
Sbjct: 3529 ERKT------KTDRGEQERKTETDREE 3549



 Score = 44.7 bits (104), Expect = 0.11,   Method: Composition-based stats.
 Identities = 55/212 (25%), Positives = 85/212 (40%), Gaps = 44/212 (20%)

Query: 387  ELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQ---EKTPIK 443
            E K  T       + E  R EQE K + DRE  ++E K + DRE+ ++  +   E+   K
Sbjct: 3441 ERKAETDREEQERKTETDREEQERKTETDRE--EQERKTETDREEQERKTETDREEQERK 3498

Query: 444  AEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILD 503
             E D                     E +E K E  + ++   TET DREE ERK +   D
Sbjct: 3499 TETD--------------------REEQERKTETDREEQKRKTET-DREEQERKTKT--D 3535

Query: 504  NSLLAGKTHT-------KNETPAIPTAKA--PPAQAHKGIQDKKPQDQREKPLASDIGVG 554
                  KT T       K ET  +   +      +  KG + K  + ++ K  A D   G
Sbjct: 3536 RGEQERKTETDREEQERKAETERLQDWRETRKSEKTAKGSEQKSSRQRKLKTDAKDPRAG 3595

Query: 555  ESDYAGIKLTKKEKELQEQEENLRVAEIIQQS 586
              +         EK  + ++EN R   ++++S
Sbjct: 3596 REE-------DTEKGKEGRKENARCRLVMRES 3620


>gi|195121632|ref|XP_002005324.1| GI20420 [Drosophila mojavensis]
 gi|193910392|gb|EDW09259.1| GI20420 [Drosophila mojavensis]
          Length = 4529

 Score = 45.9 bits (107), Expect = 0.044,   Method: Composition-based stats.
 Identities = 61/262 (23%), Positives = 118/262 (45%), Gaps = 29/262 (11%)

Query: 378  IANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREK-ADKEAKE-KADREKADKD 435
            I NV+    +L    +      +E  + ++ +AKEK   EK A+K+A++ +  +  A+K 
Sbjct: 3607 ILNVSEKLQQLNTDIIAENLIGKESIEEQKLDAKEKKQAEKVAEKKAQQGEISQVVAEKL 3666

Query: 436  LQEKTPIKAEGDDFGLGLPSVPTHSVKLPP-KEEELEEVKDEGKKGKEPGTTETDDREET 494
             +EK P   + D     +    T S K    ++E +EE K + K+ K+ G       +E 
Sbjct: 3667 SEEKVPETKKPD-----VKEAETESQKAKKLQKESVEEKKSDAKQKKQTG-------KEA 3714

Query: 495  ERKNQDILDNSLLAGK-THTKNETPAIPTAKAPPAQAHKGIQ-----------DKKPQDQ 542
            E+K+Q    + ++A K +  K      P  K   A++ K  Q           D K + Q
Sbjct: 3715 EKKSQQGEISEIVAEKVSEEKVPESKKPDVKEAEAESQKAKQLQKESVEEQQLDAKQKKQ 3774

Query: 543  REKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQ--SRMQSEDLQEKAWDS 600
             EK   +    GE     ++   +EK  + ++  ++ AE   Q   ++Q E ++E+  D+
Sbjct: 3775 AEKEAEAKAQKGEVSEVAVEKVSEEKVSESKKPEVKEAETESQKAKKLQKESVEEQQLDA 3834

Query: 601  YKEWKSLSPDEIKQRFQKYAKV 622
             ++ ++    E K +  + ++V
Sbjct: 3835 KQKKQTGKEAEKKSQQGEISEV 3856



 Score = 41.2 bits (95), Expect = 1.2,   Method: Composition-based stats.
 Identities = 65/263 (24%), Positives = 114/263 (43%), Gaps = 39/263 (14%)

Query: 386  SELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAE 445
            +E K+A VL + +A+E+K     +AK+K   ++A+KEA+ KA + +  + + EK   +  
Sbjct: 2899 AESKKAKVLEKESAEEQKL----DAKQK---DQAEKEAEAKAQKGEVSEVIAEKVSEE-- 2949

Query: 446  GDDFGLGLPSVPTHSVKLPPKEEELEEV------KDEGKKGKEPGTTETDDREETERKNQ 499
                     SVP  S+K   KE E E        K+  ++ K     E   ++E E K Q
Sbjct: 2950 ---------SVP-ESMKPVVKESEAESQKAKVLEKESAEEQKLDAKPEKPAQKEAEAKAQ 2999

Query: 500  DILDNSLLAGK-THTKNETPAIPTAKAPPAQAHKG-----------IQDKKPQDQREKPL 547
                + ++A K +  K      P  K   A++ K              D K +DQ EK  
Sbjct: 3000 KGEVSEVIAEKVSEEKVPESKKPETKESEAESQKAKVLDKESAEEQTLDAKQKDQAEKEA 3059

Query: 548  ASDIGVGESDYAGIKLTKKEK--ELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWK 605
             +++  GE      +   +EK  E ++ E     AE  +   ++ E  +E+  D+ K+ +
Sbjct: 3060 EANVQKGEVSEVIAEKASEEKVPESKKPETKETEAESQKAKVLEKESAEEQKLDAKKKDQ 3119

Query: 606  SLSPDEIKQRFQKYAKVFYRSYS 628
            S    E K +  + ++V     S
Sbjct: 3120 SQKEAEAKAQKGEVSEVMTEKAS 3142



 Score = 40.1 bits (92), Expect = 2.3,   Method: Composition-based stats.
 Identities = 46/220 (20%), Positives = 102/220 (46%), Gaps = 25/220 (11%)

Query: 386  SELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKA-----DREKADKDLQEKT 440
            S++K+A   ++   + +K+  E++  +   +++A++EA++K+         A+K  +EK 
Sbjct: 4067 SQVKEAETESQKAKKLQKESVEEQQLDAKQKKQAEQEAEKKSQLGEISEVAAEKVSEEKV 4126

Query: 441  PIKAEGDDFGLGLPSVPTHSVKLPP-KEEELEEVKDEGKKGKEPGTTETDDREETERKNQ 499
            P   + +     +    T S K    ++E +EE K   K+ K+        +++ E+K Q
Sbjct: 4127 PESKKPE-----VKEAETESQKAKTLQKESVEEQKLNVKQKKQA-------QKDAEKKAQ 4174

Query: 500  DILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLAS---DIGVGES 556
             +  + ++A K   K     IP +K P  Q     Q K+ + + +K        + V E+
Sbjct: 4175 QVEVSDVVAEKVSEKK----IPESKKPEEQKLNAKQKKQAEQETDKKAQQGDVSVAVAEN 4230

Query: 557  DYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEK 596
                     K+ E++E E   + A+++++  + ++ L  K
Sbjct: 4231 VSEEKVPESKKPEIKEAETESQKAKVLEKDLVDAQKLDTK 4270


>gi|225871438|ref|YP_002747385.1| cell surface-anchored protein [Streptococcus equi subsp. equi 4047]
 gi|225700842|emb|CAW95564.1| putative cell surface-anchored protein [Streptococcus equi subsp.
           equi 4047]
          Length = 626

 Score = 45.9 bits (107), Expect = 0.044,   Method: Composition-based stats.
 Identities = 56/221 (25%), Positives = 105/221 (47%), Gaps = 25/221 (11%)

Query: 387 ELKQATVLA--RANAQEEKQRREQEAKEKADRE-KADKEAKEKADREKADKDLQEKTPIK 443
           +L+QA   A  RAN  E+ ++  +  KEK ++E K   EAK KA  E+  KDLQ+     
Sbjct: 247 QLEQANQQANQRANLAEKSKKDLETQKEKLEQEIKEATEAKNKA--EQKLKDLQDSA--- 301

Query: 444 AEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILD 503
           ++G +           S +L  ++EEL     E +K  E  TTE       E+  Q++  
Sbjct: 302 SQGSEL----------SKQLLKEKEELTTKLQELQKQAEEKTTEI------EKLKQELEA 345

Query: 504 NSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKL 563
           N   +G+   + +       K       K ++ K+ Q+Q ++      G G+SD +  ++
Sbjct: 346 NKQNSGQLGQQEQKLQEQLNKVQKELKQKEMELKQAQEQLKQEQKPHEGGGDSDASKARI 405

Query: 564 TKKEKELQE-QEENLRVAEIIQQSRMQSEDLQEKAWDSYKE 603
           T+ EK++Q   +E   ++  ++ ++ Q  + Q +  ++ K+
Sbjct: 406 TELEKQVQTLTKEKADLSSTLESTKAQLSETQARLSEAQKQ 446


>gi|74188498|dbj|BAE28009.1| unnamed protein product [Mus musculus]
          Length = 1722

 Score = 45.9 bits (107), Expect = 0.046,   Method: Composition-based stats.
 Identities = 110/613 (17%), Positives = 255/613 (41%), Gaps = 71/613 (11%)

Query: 369  AETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKAD 428
             E RL Y       +FT +  Q  +       E+K   EQ+++ + +R   D +A +  +
Sbjct: 1052 GEWRLKYERAVREVDFTKKRLQQEL-------EDKMEVEQQSRRQLERRLGDLQA-DSDE 1103

Query: 429  REKADKDLQEKTP-IKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTE 487
             ++A + L++K   + AE  D  L L      + +L  K+   +    E  +  E    E
Sbjct: 1104 SQRALQQLKKKCQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDS---ELSQAHEETQRE 1160

Query: 488  TDDREETERKNQDILDNSL-LAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKP 546
               RE+ +R+   +L  +  L  +   K+   A  T K    +A   +QD   Q+ +++ 
Sbjct: 1161 KLQREKLQREKDMLLAEAFSLKQQMEEKDLDIAGFTQKVVSLEAE--LQDISSQESKDEA 1218

Query: 547  LASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKS 606
              + +     D    K+  +E+EL EQ  ++   ++++Q++++ E   E+   ++ +   
Sbjct: 1219 SLAKVKKQLRDLEA-KVKDQEEELDEQAGSI---QMLEQAKLRLEMEMERMRQTHSKEME 1274

Query: 607  LSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSP 666
               +E+++  Q   K   +    ++  Y+  Q   KA+    + +     + + ++Q   
Sbjct: 1275 SRDEEVEEARQSCQKKLKQMEVQLEEEYEDKQ---KALREKRELESKLSTLSDQVNQRDF 1331

Query: 667  LGLMYEKDELHGVEAVYQKLDVLFRHCIENLRAN------KNAVD-------AMSKAVEA 713
                  + +L   +A+     ++  H   N  +       KN ++       A  KA +A
Sbjct: 1332 ESEKRLRKDLRRTKALLADAQIMLDHLKNNAPSKREIAQLKNQLEESEFTCAAAVKARKA 1391

Query: 714  GESSVR------------KHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKED----PK 757
             E  +             K + E   S+ Q+    + N ++E       L+K+      +
Sbjct: 1392 MEVEMEDLHLQIDDIAKAKTALEEQLSRLQREKNEIQNRLEEDQEDMNELMKKHKAAVAQ 1451

Query: 758  RGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLYTIISGSEKILQGDY 817
              +  + ++D+++++++ NK   +++ KL+      +  ++     +++S  E  ++   
Sbjct: 1452 ASRDMAQMNDLQAQIEESNKEKQELQEKLQALQSQVEFLEQSMVDKSLVSRQEAKIR--- 1508

Query: 818  TFPPLSSLDVQSKFDSSYSKLFEIFYGDW--TNNAIKEERYWTIYAFERSLKNQAHLNAE 875
                   L+ + +F+ +  K  E        T   + EER     A  R  +    L  +
Sbjct: 1509 ------ELETRLEFEKTQVKRLENLASRLKETMEKLTEERDQRAAAENREKEQNKRLQRQ 1562

Query: 876  V----ERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIKELKS 931
            +    E +S LA++ ++++    EL+  L       E+ ++ + + ++  F+R I +L++
Sbjct: 1563 LRDTKEEMSELARKEAEASRKKHELEMDLESL----EAANQSLQADLKLAFKR-IGDLQA 1617

Query: 932  VIEADAKENPNPN 944
             IE + + + N +
Sbjct: 1618 AIEDEMESDENED 1630


>gi|189237519|ref|XP_973030.2| PREDICTED: similar to CG8092 CG8092-PA [Tribolium castaneum]
 gi|270007705|gb|EFA04153.1| hypothetical protein TcasGA2_TC014398 [Tribolium castaneum]
          Length = 1496

 Score = 45.9 bits (107), Expect = 0.046,   Method: Composition-based stats.
 Identities = 53/239 (22%), Positives = 98/239 (41%), Gaps = 61/239 (25%)

Query: 402  EKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPI------------KAEGDDF 449
            EKQ+  QE K +  +E   ++  E+   E  DK+ QE  P             K + +D 
Sbjct: 1226 EKQKEVQEDKSQVGQEDHQEKGTEEETSEVVDKE-QEDHPEKEIEEEASEVGGKGQEEDQ 1284

Query: 450  GLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPG-----TTETDDREETERKNQDILDN 504
            G  +             EEE  EV D+G++ ++       T+E  D+E+ +++ ++I   
Sbjct: 1285 GKEI-------------EEETSEVVDKGQEDQQEKEIAEETSEVVDKEQEDQQEKNI--- 1328

Query: 505  SLLAGKTHTKNETPAIPTAKAPPAQAHKGIQ-------DKKPQDQREKPLASD--IGVGE 555
                     + ET  I   KAP  Q  K ++       DK  +D  E+   ++  +  G+
Sbjct: 1329 ---------EKETSEI--VKAPEDQEEKNVEEETSEVIDKVQEDPHEEEEKTNDIVDKGQ 1377

Query: 556  SDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQ 614
             D+       + +E++E    ++  E +QQ   + +           E K +  +EIK+
Sbjct: 1378 EDH-------RNEEVEETTSGIKEQEDVQQKEAEDDSGIVDNKSENDEVKCVEEEEIKE 1429


>gi|296196872|ref|XP_002806716.1| PREDICTED: LOW QUALITY PROTEIN: biorientation of chromosomes in
           cell division protein 1-like [Callithrix jacchus]
          Length = 3047

 Score = 45.9 bits (107), Expect = 0.047,   Method: Composition-based stats.
 Identities = 55/224 (24%), Positives = 98/224 (43%), Gaps = 22/224 (9%)

Query: 403 KQRREQEAKEKAD---REKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTH 459
           +QRR+  AKEK +   R + ++E  E+  ++KA+K    KT  + +G    L   S  + 
Sbjct: 495 EQRRQSIAKEKEERLLRRRINREKLEEKRKQKAEKTKGSKTKSQGKG-SVDLEESSTKSL 553

Query: 460 SVKLPPKEEELEEVKDEGKKGKEPGTTETDDR--EETERKNQDILDNSLLAGKTHTKNET 517
             K P  +E L+E K   KK       + D R  EE  +K Q   ++S    KT    E 
Sbjct: 554 EPKAPRIKEVLKERKVLEKKVALSKKRKKDSRNVEENSKKKQQSEEDSKETLKTSEHCEK 613

Query: 518 PAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKE-------- 569
             I ++K P     K +  K    +  + L+  + V + +    K+ ++ K         
Sbjct: 614 EKISSSKEP-----KHVHAKSEPSKPARRLSESLHVVDENKNESKIEREHKRRTSTPVVM 668

Query: 570 --LQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDE 611
              QE+ +   V   +++S + +E+ Q++   + K  K L  D+
Sbjct: 669 EGAQEETDTRDVKRQVERSEICTEEPQKQK-STLKNEKHLKKDD 711


>gi|169145193|emb|CAQ15197.1| novel protein similar to vertebrate beaded filament structural
            protein 2, phakinin (BFSP2, zgc:103750) [Danio rerio]
 gi|169154382|emb|CAQ13383.1| novel protein similar to vertebrate beaded filament structural
            protein 2, phakinin (BFSP2, zgc:103750) [Danio rerio]
          Length = 438

 Score = 45.9 bits (107), Expect = 0.047,   Method: Composition-based stats.
 Identities = 80/383 (20%), Positives = 154/383 (40%), Gaps = 54/383 (14%)

Query: 669  LMYEKDELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGESSVRKHSFEVLSS 728
            L+  +D++H +E + ++L+   RHC++             KAV AG  +  K  +E +  
Sbjct: 95   LLEYRDKVHALEQLNKQLEEQIRHCLDR------------KAVSAGTWTGLKQDWEDVYI 142

Query: 729  KHQKSV-------IAVNNFIKEITHHTRRLVKEDPKRGKSESYLSDIRSELQKVNKTVMD 781
            +  +++       +   N          R   E P R   E  ++ +   +   N T MD
Sbjct: 143  QVSEAILYNARLMLQTENVQANAEDFKERYENEQPFRKAVEEEINSLYKVIDDANLTRMD 202

Query: 782  IR-----IKLRLYGIFQDIPQEQPPLYTIISGSEKILQGDYTFPPLSSLDVQSKFDSSYS 836
            +      +K  L  + Q   ++   LY  +SG E + + D   P  +SLD    F  S+ 
Sbjct: 203  LENEIESMKTELINVEQSHMEDVKMLYKQMSGRE-VDEPDA--PTETSLDQILSFIRSH- 258

Query: 837  KLFEIFYGDWTNNAIKEERYWTIYAFE--RSLKNQAHLNAEVERLSGLAQQPSDSTADLK 894
                     W    +++ R  T   FE  ++    + L+ E E +  L  + +D+   ++
Sbjct: 259  ---------W-ERVVEKNRAETYAYFECKQAGSLNSKLSQEEEEMECLKTECNDAGCKIQ 308

Query: 895  ELQTQLSRAKKYKESNDERIVSFIRSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTR 954
             LQ +    +  K    E  ++  +   + E++ L SVI     E  +   + ++ ++  
Sbjct: 309  NLQAETESIRALKRGL-ENALNDAKHWHDIELQNLGSVIGKLEAELTDIRGDIEQQRRDY 367

Query: 955  EKLVAQLSSRLK-ELNIDNAYGLWNEYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIY 1013
            E L   L++++K E+ I   +G+ +  +  F  S  +P G+  P             P  
Sbjct: 368  ETL---LNNKMKVEMEIGTYHGILDGEESRFYTS-TFPAGSSVPE--------GPTDPTP 415

Query: 1014 SVSKTIQKAGGDPSLMMDYEKVE 1036
            S S     A  D +L+ +Y   E
Sbjct: 416  STSGQQSCAQTDGTLLTEYYNTE 438


>gi|291415281|ref|XP_002723882.1| PREDICTED: FtsJ homolog 2 [Oryctolagus cuniculus]
          Length = 740

 Score = 45.9 bits (107), Expect = 0.048,   Method: Composition-based stats.
 Identities = 29/95 (30%), Positives = 51/95 (53%), Gaps = 5/95 (5%)

Query: 401 EEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHS 460
           E + R+ QEA +K    +A +E K  AD+E+  KDL++K  ++ +     + + S+ +  
Sbjct: 553 ELRHRQWQEANQKIQELQASQEVK--ADQEQKIKDLEQKLSLQEQD---AVVVRSMKSEL 607

Query: 461 VKLPPKEEELEEVKDEGKKGKEPGTTETDDREETE 495
            +LP  E EL+ ++DE    +E   T    +EE E
Sbjct: 608 ARLPKMERELKRLQDENSHLREMSETNGVLQEELE 642


>gi|332843618|ref|XP_003314683.1| PREDICTED: microtubule-associated protein 1A isoform 2 [Pan
            troglodytes]
          Length = 3041

 Score = 45.9 bits (107), Expect = 0.049,   Method: Composition-based stats.
 Identities = 60/275 (21%), Positives = 116/275 (42%), Gaps = 27/275 (9%)

Query: 398  NAQEEKQRREQEAKEKADREKADK----EAKEKADREKADKDLQEKTPIKAEGDDFGLGL 453
            + + E  +++ +A E+  R+   K    E K+KA RE  DKDL+EK     + D      
Sbjct: 1633 HVKNEAVKQQDKALEQKGRDLEQKDTALEQKDKA-REPKDKDLEEKDKALEQKD------ 1685

Query: 454  PSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHT 513
              +P    K   +++   E KD+  + K+    + D   E + K  +  D +L       
Sbjct: 1686 -KIPEEKDKALEQKDTALEQKDKALEPKDKDLEQKDRVLEQKEKIPEEKDKALDQKVRSV 1744

Query: 514  KNETPAIPTAKAPP---AQAHKGIQDK-KPQDQREKPLASDIGVGESDYAGIKLTKKEKE 569
            +++ P    A+       Q  K  + K + Q+Q++K         E  Y    L +K++ 
Sbjct: 1745 EHKAPEDTVAEMKDRDLEQTDKAPEQKHQAQEQKDKVSEKKDQALEQKYWA--LGQKDEA 1802

Query: 570  LQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAKVFYRSYSP 629
            L   E+N++  E   Q++ Q   +QE      K  +  SP+++K   +K   +  ++ + 
Sbjct: 1803 L---EQNIQALEENHQTQEQESLVQEDKTRKPKMLEEKSPEKVKAMEEKLEALLEKTKA- 1858

Query: 630  VDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQW 664
                  G +ES        + +  Y+R  + + +W
Sbjct: 1859 -----LGLEESLVQEGRAREQEEKYWRGQDVVQEW 1888


>gi|329116854|ref|ZP_08245571.1| translation initiation factor IF-2 [Streptococcus parauberis NCFD
           2020]
 gi|326907259|gb|EGE54173.1| translation initiation factor IF-2 [Streptococcus parauberis NCFD
           2020]
          Length = 970

 Score = 45.9 bits (107), Expect = 0.049,   Method: Composition-based stats.
 Identities = 48/200 (24%), Positives = 86/200 (43%), Gaps = 16/200 (8%)

Query: 344 QLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEK 403
           Q RD     K DY+     + +RF+       ++         + + A + A  NA+  +
Sbjct: 192 QSRDNKPGFKKDYN-----NRDRFQGNHNQNTASKPAAGKIDFKARAAALKAEQNAEYTR 246

Query: 404 QRRE--QEAKEKADR--EKADKEAKEKADREKADK-DLQEKTPIKAEGDDFGLGLPSVPT 458
           +R +  ++AKE A R  EKA +EAK  A +E A+K  L+++TP          G+P V  
Sbjct: 247 KREDDFRQAKE-AQRLAEKAQEEAKRLAVKEAAEKARLEKETPKVKPTAKVSQGVPEVAK 305

Query: 459 HSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETP 518
            S    P ++  ++ + E  +G+ P T +   + +    NQ  + N     +    N+ P
Sbjct: 306 TSTA-KPVDKRRKKSRPEKGQGESPRTEDGPKQNKKSWNNQSQVRNQ----RNSNWNKRP 360

Query: 519 AIPTAKAPPAQAHKGIQDKK 538
                      A K + ++K
Sbjct: 361 KKGKNNRNNNSAPKPVTERK 380


>gi|237742113|ref|ZP_04572594.1| predicted protein [Fusobacterium sp. 4_1_13]
 gi|229429761|gb|EEO39973.1| predicted protein [Fusobacterium sp. 4_1_13]
          Length = 925

 Score = 45.9 bits (107), Expect = 0.049,   Method: Composition-based stats.
 Identities = 31/99 (31%), Positives = 52/99 (52%), Gaps = 5/99 (5%)

Query: 873 NAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIKELKSV 932
           N  + +LS    + +    +LK+ Q+ L++  K  ++  E+IV+    E E+ IK LK  
Sbjct: 36  NKGISQLSNTIGKLNQEIVNLKDSQSLLAKYNKDTKALKEKIVTI--KETEKAIKNLKRE 93

Query: 933 IEADAK---ENPNPNKNQKKLQKTREKLVAQLSSRLKEL 968
           IE + K   EN    + Q+K  K  +K+V + +  LKEL
Sbjct: 94  IEIEKKAIEENTGKTRKQRKELKESKKIVEEKTKALKEL 132


>gi|195450769|ref|XP_002072625.1| GK13703 [Drosophila willistoni]
 gi|194168710|gb|EDW83611.1| GK13703 [Drosophila willistoni]
          Length = 9207

 Score = 45.9 bits (107), Expect = 0.049,   Method: Composition-based stats.
 Identities = 55/219 (25%), Positives = 88/219 (40%), Gaps = 52/219 (23%)

Query: 387  ELKQATVLARANAQEEKQRREQEAKEKADREKA------DKEAKEKADREKADKDLQEKT 440
            E+KQ     + N QEE + +EQ A  K  ++KA      D       D++K DK ++E  
Sbjct: 1120 EIKQ-----KDNPQEESKNKEQPASTKVSKKKAIDDVPKDTPKSSSTDKQKEDKPVEEA- 1173

Query: 441  PIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQD 500
              K + DD        P    +  P EEE +    E +K ++P     +D++E       
Sbjct: 1174 --KEKADD-------TPKKFTQKKPVEEEPKTSPAEKQKAEKP----VEDKQEQA----- 1215

Query: 501  ILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKP----QDQREKPLASDIGVGES 556
                   + K   K  T  +P  K       K +++ KP    +   EK +   I + + 
Sbjct: 1216 -------STKVSKKKPTDEVPKTKG------KTVEEPKPLPEEKTPEEKEVTEQIALKKV 1262

Query: 557  DY-AGIKLTKKEKE----LQEQEENLRVAEIIQQSRMQS 590
            D  A I   K+E      ++  EE+L V +    SR  S
Sbjct: 1263 DRKASISSVKEESRRSSVVKISEESLSVEDTKVSSRRSS 1301


>gi|27529702|dbj|BAA13206.2| KIAA0216 [Homo sapiens]
          Length = 2067

 Score = 45.9 bits (107), Expect = 0.049,   Method: Composition-based stats.
 Identities = 115/645 (17%), Positives = 261/645 (40%), Gaps = 84/645 (13%)

Query: 369  AETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKAD 428
             E RL Y       +FT +  Q          E+K   EQ+ K + +R   D +A +  +
Sbjct: 1382 GEWRLKYERAVREVDFTKKRLQQEF-------EDKLEVEQQNKRQLERRLGDLQA-DSEE 1433

Query: 429  REKADKDLQEKTP-IKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTE 487
             ++A + L++K   + AE  D  L L      + +L  K+   +    E  +  E    E
Sbjct: 1434 SQRALQQLKKKCQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDS---ELSQAHEEAQRE 1490

Query: 488  TDDREETERKNQDILDNSL-LAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKP 546
               RE+ +R+   +L  +  L  +   K+   A  T K    +A   +QD   Q+ +++ 
Sbjct: 1491 KLQREKLQREKDMLLAEAFSLKQQLEEKDMDIAGFTQKVVSLEAE--LQDISSQESKDEA 1548

Query: 547  LASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKS 606
              + +     D    K+  +E+EL EQ   +   ++++Q++++ E   E+   ++ +   
Sbjct: 1549 SLAKVKKQLRDLEA-KVKDQEEELDEQAGTI---QMLEQAKLRLEMEMERMRQTHSKEME 1604

Query: 607  LSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSP 666
               +E+++  Q   K   +    ++  Y+  Q+  +             ++     Q + 
Sbjct: 1605 SRDEEVEEARQSCQKKLKQMEVQLEEEYEDKQKVLREKRELEG------KLATLSDQVNR 1658

Query: 667  LGLMYEK---DELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGE----SSVR 719
                 EK    +L   +A+     ++  H ++N   +K  +  +   +E  E    ++V+
Sbjct: 1659 RDFESEKRLRKDLKRTKALLADAQLMLDH-LKNSAPSKREIAQLKNQLEESEFTCAAAVK 1717

Query: 720  ----------------------KHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKED-- 755
                                  K + E   S+ Q+    + N ++E       L+K+   
Sbjct: 1718 ARKAMEVEIEDLHLQIDDIAKAKTALEEQLSRLQREKNEIQNRLEEDQEDMNELMKKHKA 1777

Query: 756  --PKRGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLYTIISGSEKIL 813
               +  +  + ++D++++L++ NK   +++ KL+      +  ++     +++S  E  +
Sbjct: 1778 AVAQASRDLAQINDLQAQLEEANKEKQELQEKLQALQSQVEFLEQSMVDKSLVSRQEAKI 1837

Query: 814  QGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIK--EERYWTIYAFERSLKNQAH 871
            +          L+ + +F+ +  K  E        N  K  EER   I A  R  +    
Sbjct: 1838 R---------ELETRLEFERTQVKRLESLASRLKENMEKLTEERDQRIAAENREKEQNKR 1888

Query: 872  LNAEV----ERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIK 927
            L  ++    E +  LA++ ++++    EL+  L       E+ ++ + + ++  F+R I 
Sbjct: 1889 LQRQLRDTKEEMGELARKEAEASRKKHELEMDLESL----EAANQSLQADLKLAFKR-IG 1943

Query: 928  ELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKELNIDN 972
            +L++ IE + + + N +     L  + + +V +   R  +L  D+
Sbjct: 1944 DLQAAIEDEMESDENED-----LINSLQDMVTKYQKRKNKLEGDS 1983


>gi|332532411|ref|ZP_08408289.1| translation initiation factor 2 [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332038054|gb|EGI74501.1| translation initiation factor 2 [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 886

 Score = 45.9 bits (107), Expect = 0.051,   Method: Composition-based stats.
 Identities = 34/115 (29%), Positives = 57/115 (49%), Gaps = 6/115 (5%)

Query: 386 SELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADR---EKADKDLQEKTPI 442
           S ++Q    AR  A EEK R EQ+  +KA++E A+ +AK++A+R   E+AD+  +E+   
Sbjct: 100 SAMEQEQEQARL-AAEEKARLEQQ--QKAEQEAAELKAKQEAERKAKEEADRKAKEEAKR 156

Query: 443 KAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERK 497
           KA+ +         P  S K      E E ++ E ++       E   R+  E +
Sbjct: 157 KADAERKAKQKQMTPEQSAKSEKDRIEAERLQKEAEEAALKKAEEEAKRQAEEAR 211


>gi|164427657|ref|XP_963992.2| hypothetical protein NCU02858 [Neurospora crassa OR74A]
 gi|157071832|gb|EAA34756.2| predicted protein [Neurospora crassa OR74A]
          Length = 2524

 Score = 45.9 bits (107), Expect = 0.051,   Method: Composition-based stats.
 Identities = 51/210 (24%), Positives = 93/210 (44%), Gaps = 20/210 (9%)

Query: 390  QATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKD--LQEKTPIKAEGD 447
            Q   L     + E+   E+  +E+  REKA++  +EKA+REKA+++    EK   KAE +
Sbjct: 1515 QEDQLKAQKVETERLEHEKAEQERVAREKAERAEREKAEREKAEREQVALEKAREKAEQE 1574

Query: 448  DFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLL 507
                        + +   + E+ E  + E +K +E    E   RE+ E +  +     + 
Sbjct: 1575 -----------KAEREKAEREKAERERVEREKAREKLEQERIAREKAELEKAE--RERIA 1621

Query: 508  AGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKE 567
            A +   K E       KA   +       KK + ++ +   +++   E +    +  +K+
Sbjct: 1622 AEEARKKAELEKAELEKAERERIAAEKARKKAELEKAELEKAELEKAERERVAAEKARKK 1681

Query: 568  KELQEQEENLRVAEIIQQSRMQSEDLQEKA 597
             E QE+ E  RV    ++ + Q + LQEKA
Sbjct: 1682 AE-QEKAEQERV----EREKAQEKALQEKA 1706



 Score = 40.1 bits (92), Expect = 2.5,   Method: Composition-based stats.
 Identities = 56/236 (23%), Positives = 99/236 (41%), Gaps = 31/236 (13%)

Query: 380 NVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKE-----------KAD 428
           NVA      ++  VL     Q  + +   E + KA+RE AD++  E           K D
Sbjct: 582 NVAKTPDNPEKPEVLEARGEQAPEYKTLAEERRKAEREDADRKPAEQTVKGEEEETAKND 641

Query: 429 REKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTET 488
            +   K L+E+   K E +D  L      T       ++EE  +  ++ K+ +     E 
Sbjct: 642 GDVKPKTLEEQQKAKQEEEDRKLAQQIAKT-------QQEEAAKASEDAKRRQ---AEEA 691

Query: 489 DD-REETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPL 547
           DD  + TE +    L   + A +     E   I  A+A  A+A +  + +K    + K  
Sbjct: 692 DDLAKSTEAEKDKALGERIKAAEAEMLKE---IGHARAKVAEAERLTKTEK---NKVKTA 745

Query: 548 ASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKE 603
            S++ V   D   ++  +++     QE   + AE ++  R ++ +L EKA  + KE
Sbjct: 746 NSEMSVARIDAEALEEKRRKA---AQEGKAKDAEALEDRRRKALELAEKAAVAEKE 798



 Score = 38.5 bits (88), Expect = 7.0,   Method: Composition-based stats.
 Identities = 44/151 (29%), Positives = 70/151 (46%), Gaps = 13/151 (8%)

Query: 359  AEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRRE----QEAKEKA 414
            AE     R KAE   A            +L+Q  + AR  A+ EK  RE    +EA++KA
Sbjct: 1571 AEQEKAEREKAEREKAERERVEREKAREKLEQERI-AREKAELEKAERERIAAEEARKKA 1629

Query: 415  DREKADKEAKEKADREK--ADKDLQEKTPIKAEGDDFGLGLPS---VPTHSVKLPPKEEE 469
            + EKA+ E   KA+RE+  A+K  ++    KAE +   L       V     +   ++E+
Sbjct: 1630 ELEKAELE---KAERERIAAEKARKKAELEKAELEKAELEKAERERVAAEKARKKAEQEK 1686

Query: 470  LEEVKDEGKKGKEPGTTETDDREETERKNQD 500
             E+ + E +K +E    E  ++E   RK  +
Sbjct: 1687 AEQERVEREKAQEKALQEKAEQERIARKKAE 1717


>gi|206969369|ref|ZP_03230324.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           AH1134]
 gi|206736410|gb|EDZ53568.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           AH1134]
          Length = 612

 Score = 45.9 bits (107), Expect = 0.051,   Method: Composition-based stats.
 Identities = 53/240 (22%), Positives = 98/240 (40%), Gaps = 66/240 (27%)

Query: 334 LGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATV 393
           + G T   +  + D +++V AD +        + K+   + +  +++ +N + E  + T+
Sbjct: 93  MAGATSAWLYDVNDKSAEVGADSY--------KLKSGDVVVFRFVSDWSNISQETLKETL 144

Query: 394 LARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGL 453
                      + E+    K +  K D   +EK +  K D   QEK P + + +D     
Sbjct: 145 DKFGTC-----KTEEPNGGKPEEPKTDDPKQEKPEEPKTDDPKQEK-PEEPKTND----- 193

Query: 454 PSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHT 513
                      PK+E+ EE K +G K ++P  T+T+D E+ E+  Q+ + N         
Sbjct: 194 -----------PKQEKPEEPKTDGSKQEKPDGTKTND-EKPEQPKQENIQN--------- 232

Query: 514 KNETPAIPTAKAPPAQAHKGI---QDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKEL 570
                       P AQ ++ I    DK  QD          G+ ESD+  + L++  K +
Sbjct: 233 ------------PSAQLNEAISKTSDKMLQD----------GI-ESDWVAVALSRSGKNV 269


>gi|194675865|ref|XP_597858.4| PREDICTED: myosin XVIIIA isoform 2 [Bos taurus]
 gi|297486552|ref|XP_002695716.1| PREDICTED: myosin XVIIIA [Bos taurus]
 gi|296476878|gb|DAA18993.1| myosin XVIIIA [Bos taurus]
          Length = 2040

 Score = 45.9 bits (107), Expect = 0.051,   Method: Composition-based stats.
 Identities = 111/616 (18%), Positives = 250/616 (40%), Gaps = 77/616 (12%)

Query: 369  AETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKAD 428
             E RL Y       +FT +  Q          E+K   EQ++K + +R   D +    AD
Sbjct: 1370 GEWRLKYERAMREVDFTKKRLQQEF-------EDKLEVEQQSKRQLERRLGDLQ----AD 1418

Query: 429  REKADKDLQEKTP----IKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPG 484
             +++ + LQ+       + AE  D  L L      + +L  K+   +    E  +  E  
Sbjct: 1419 SDESQRTLQQLKKKCQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDS---ELSQAHEEA 1475

Query: 485  TTETDDREETERKNQDILDNSL-LAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQR 543
              E   RE+ +R+   +L  +  L  +   K+   A  T K    +A   +QD   Q+ +
Sbjct: 1476 QREKLQREKLQREKDMLLAEAFSLKQQMEEKDMDIAGFTQKVVSLEAE--LQDISSQESK 1533

Query: 544  EKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKE 603
            ++   + +     D    K+  +E+EL EQ   +   ++++Q++++ E   E+   ++ +
Sbjct: 1534 DEASLAKVKKQLRDLEA-KVKDQEEELDEQAGTI---QMLEQAKLRLEMEMERMRQTHSK 1589

Query: 604  WKSLSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQ 663
                  +E+++  Q   K   +    ++  Y+  Q   K +    + +     + + ++Q
Sbjct: 1590 EMENRDEEVEEARQSCQKKLKQMEVQLEEEYEDKQ---KVLREKRELEGKLATLSDQVNQ 1646

Query: 664  WSPLGLMYEKDELHGVEAVYQKLDVLFRHCIENLRAN------KNAVD-------AMSKA 710
                     + +L   +A+     ++  H   N  +       KN ++       A  KA
Sbjct: 1647 RDFESEKRLRKDLKRTKALLADAQIMLDHLKNNAPSKREIAQLKNQLEESEFTCAAAVKA 1706

Query: 711  VEAGESSVR------------KHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKED--- 755
             +A E  +             K + E   S+ Q+    + N ++E       L+K+    
Sbjct: 1707 RKAMEVEIEDLHLQIDDIAKAKTALEEQLSRLQREKNEIQNRLEEDQEDMNELMKKHKAA 1766

Query: 756  -PKRGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLYTIISGSEKILQ 814
              +  +  + ++D++++L++ NK   +++ KL+      +  ++     +++S  E  ++
Sbjct: 1767 VAQASRDLAQMNDLQAQLEEANKEKQELQEKLQALQSQVEFLEQSMVDKSLVSRQEAKIR 1826

Query: 815  GDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIK--EERYWTIYAFERSLKNQAHL 872
                      L+ + +F+ +  K  E       +N  K  EER     A  R  +    L
Sbjct: 1827 ---------ELETRLEFERTQVKRLESLASRLKDNMEKLTEERDQRAAAENREKEQNKRL 1877

Query: 873  NAEV----ERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIKE 928
              ++    E +  LA++ ++++    EL+  L       E+ ++ + + ++  F+R I +
Sbjct: 1878 QRQLRDTKEEMGELARKEAEASRKKHELEMDLESL----EAANQSLQADLKLAFKR-IGD 1932

Query: 929  LKSVIEADAKENPNPN 944
            L++ IE + + + N +
Sbjct: 1933 LQAAIEDEMESDENED 1948


>gi|254567069|ref|XP_002490645.1| DNA repair protein RAD50 [Pichia pastoris GS115]
 gi|238030441|emb|CAY68365.1| DNA repair protein RAD50 [Pichia pastoris GS115]
          Length = 1323

 Score = 45.9 bits (107), Expect = 0.052,   Method: Composition-based stats.
 Identities = 68/314 (21%), Positives = 134/314 (42%), Gaps = 31/314 (9%)

Query: 679 VEAVYQKLDVLFRHCIENLRANKNAVDAM--SKAVEAGESSVRKHSFEVLSSKHQKSVIA 736
           +E    K  VLF  C + L       D       +E G++  +      L  + ++S   
Sbjct: 416 IEEASSKASVLFSTCKKKLDLQTEHYDTRIHDLNLEIGQAESK------LGKEEERSSYL 469

Query: 737 VNNFIKEITHHTRRLVKEDPKRGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIP 796
            N+ I  +    + L K       +ES  ++ + +++++ K + D+R + +L  I  D+ 
Sbjct: 470 KND-INSLKKRNQALQKSINDINSNESEFNETKEDIERLTKQLEDLRSENKLASINNDLK 528

Query: 797 QEQPPLYTIISG----SEKILQGDYTFPPLSSLDV----QSKFDSSYSKLFEIF---YGD 845
           Q Q  +  + +     +++I+  +     L+ L +      K +SS SKL E +   + +
Sbjct: 529 QNQDKILVLENELDQINKQIITSNRQGEVLAKLHLLKENTKKGNSSISKLVESYGEQFKE 588

Query: 846 WTNNAIKEERYWTIYAFERSLKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKK 905
           +T   +  E    ++  E   K Q   + + + ++   Q   +S  D   L+ +L +++ 
Sbjct: 589 FTGEDLNPEDCLPVF-LEVLKKRQEDTDLKRKEVASFKQNEYESNHDRSLLEKKLEQSRS 647

Query: 906 YKESNDERIVSFIR----SEFEREIKELKSVIE---ADAKEN-PNPNKNQKKLQKTREKL 957
             +    RIVS +      E+E  +K+L+S  E    ++K N    N N+  L+  +E  
Sbjct: 648 QLQECRSRIVSILEDEPIEEYESIVKDLESDYEIALQNSKLNWATKNFNETALKIAKEHQ 707

Query: 958 VAQLSSRLKELNID 971
              L  R  ELN D
Sbjct: 708 YCILCKR--ELNHD 719


>gi|195143807|ref|XP_002012888.1| GL23684 [Drosophila persimilis]
 gi|194101831|gb|EDW23874.1| GL23684 [Drosophila persimilis]
          Length = 2893

 Score = 45.9 bits (107), Expect = 0.052,   Method: Composition-based stats.
 Identities = 54/208 (25%), Positives = 85/208 (40%), Gaps = 32/208 (15%)

Query: 385  TSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQE----KT 440
            T E K +   ++ +  E+ Q    E K+ A   + +     + D+ K DK+  +    K 
Sbjct: 1011 TKEQKDSEKTSKLHRSEDSQ---SETKDTATTPQTESTKGSETDKNKEDKEGDQPRLRKL 1067

Query: 441  PIKAEGDDFGLGL-------PSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREE 493
            P  AE +D    L        S P  + K PP EE     K+E K  KEP   ET  R+E
Sbjct: 1068 PSTAELEDRFNALERKMSVQKSSPAKTKKEPPDEEP---DKEEPKARKEPAKEETKARKE 1124

Query: 494  TERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGV 553
               +          A K   + E    P A+  P  +   I+D+KPQ++R    + D   
Sbjct: 1125 PAEEEPK-------ARKEPAREE----PKARKEPEDSE--IRDEKPQERRASKDSKDSEE 1171

Query: 554  GESDYAGIKLTKK--EKELQEQEENLRV 579
                   +K+  +   K  +E+E + RV
Sbjct: 1172 SNKRNETVKVKDRTPTKTREEKEASKRV 1199



 Score = 38.9 bits (89), Expect = 5.5,   Method: Composition-based stats.
 Identities = 52/252 (20%), Positives = 98/252 (38%), Gaps = 43/252 (17%)

Query: 400  QEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTH 459
            +EE + R++ AKE+    K   E + KA +E A ++ + +                    
Sbjct: 1105 KEEPKARKEPAKEETKARKEPAEEEPKARKEPAREEPKAR-------------------- 1144

Query: 460  SVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPA 519
                  KE E  E++DE K  +   + ++ D EE+ ++N+ +     +  +T TK     
Sbjct: 1145 ------KEPEDSEIRDE-KPQERRASKDSKDSEESNKRNETV----KVKDRTPTKTREEK 1193

Query: 520  IPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKK--------EKELQ 571
              + +  P  + K   D K + ++ K       V E+    +K  +K        EK   
Sbjct: 1194 EASKRVEPKPSGKDSPDTKVESEKAKKKPEPEKV-ENQEEPVKTARKSPPSTEELEKRFN 1252

Query: 572  EQEENLRVAEIIQQSRMQSEDLQEKAWDSYK-EWKSLSPDEIKQRFQKYAKVFYRSYSPV 630
              E+ L    +  +S  ++E  +  A D    E ++    E  +R QK  K F      V
Sbjct: 1253 ALEKQLSTTNL--ESSKEAEQTKSTAKDQRSTEARNQKEAETAEREQKSTKTFEEKLKEV 1310

Query: 631  DGSYKGTQESDK 642
            + +    Q+  +
Sbjct: 1311 NTALTNDQKKSE 1322


>gi|55379379|ref|YP_137229.1| MCP domain-containing signal transducer [Haloarcula marismortui
           ATCC 43049]
 gi|55232104|gb|AAV47523.1| MCP domain signal transducer [Haloarcula marismortui ATCC 43049]
          Length = 776

 Score = 45.9 bits (107), Expect = 0.052,   Method: Composition-based stats.
 Identities = 42/163 (25%), Positives = 66/163 (40%), Gaps = 20/163 (12%)

Query: 347 DLASKVKADYHWAEIRH-GNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQR 405
           DL  ++  D     +R     F A      +T++ VA F  E+  AT+     A+E    
Sbjct: 424 DLTKRLDEDAEETAMREVAVEFNAMLDGLEATVSEVAAFADEVADATIEVATGAEE---- 479

Query: 406 REQEAKEKADR--EKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKL 463
            E  ++  +DR  E AD   ++  D E+A           AE D+    +  V   S  +
Sbjct: 480 IETTSQTVSDRIQEIADGAIRQHDDLEEA----------AAEMDELSASIEEVAASSTTV 529

Query: 464 PPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSL 506
               E   E  D G+ G+E   +  DD  E E ++ D +D  L
Sbjct: 530 A---ETAREAVDRGETGREAAESAIDDMAEIESRSADAVDQIL 569


>gi|225574664|ref|ZP_03783274.1| hypothetical protein RUMHYD_02741 [Blautia hydrogenotrophica DSM
           10507]
 gi|225038132|gb|EEG48378.1| hypothetical protein RUMHYD_02741 [Blautia hydrogenotrophica DSM
           10507]
          Length = 1199

 Score = 45.5 bits (106), Expect = 0.054,   Method: Composition-based stats.
 Identities = 57/240 (23%), Positives = 117/240 (48%), Gaps = 25/240 (10%)

Query: 400 QEEKQRRE-QEAKEK--ADREKADKEAKEKADREKADKDL-QEKTPIKAEGDDFGLGLPS 455
           Q    R+E QE KE+  A ++K D+E K KAD +   K+  Q+K     +   +  G+ +
Sbjct: 353 QVTASRKELQEGKEELEASQKKLDEEIK-KADLDGKWKEYKQQKEAFDTQKKQYERGVQT 411

Query: 456 VPTHSVKLPPKEEELEEVK---DEGKKGKEPGTTETDDREETERKNQDI---LD--NSLL 507
           V     ++   +E+L  ++   D+ K+  + GT E ++ E  + + + +   +D   +++
Sbjct: 412 VQNSLNEVKKAQEQLTVLQAQYDQLKQAVDGGTLEGEELENAKAQLEQLKVSIDQLQTVV 471

Query: 508 AGK-------THTKNETPAIPTAKAPPAQAHKGIQDKKPQ-DQREKPLASDIGVGESDYA 559
           A K       T  + + PA+  A+A  A   K ++D + Q D  ++ +  D G  E +  
Sbjct: 472 AAKPQLEAKLTELEKQKPALDAAEAQLADGKKQLEDAQAQLDAAQEKI--DAGKKELEQG 529

Query: 560 GIKLTKKEKELQEQEENLRVAEI-IQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQK 618
             ++ +  ++L   ++ L+ ++  I  S  Q ED Q +  ++ ++ K  + +EI +  QK
Sbjct: 530 EAQIEEAVQKLLSTQQTLKASQSQISDSERQLEDGQREIDENEQKLKE-AQEEIDENEQK 588


>gi|74140527|dbj|BAE42402.1| unnamed protein product [Mus musculus]
          Length = 1700

 Score = 45.5 bits (106), Expect = 0.054,   Method: Composition-based stats.
 Identities = 110/613 (17%), Positives = 255/613 (41%), Gaps = 71/613 (11%)

Query: 369  AETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKAD 428
             E RL Y       +FT +  Q  +       E+K   EQ+++ + +R   D +A +  +
Sbjct: 1030 GEWRLKYERAVREVDFTKKRLQQEL-------EDKMEVEQQSRRQLERRLGDLQA-DSDE 1081

Query: 429  REKADKDLQEKTP-IKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTE 487
             ++A + L++K   + AE  D  L L      + +L  K+   +    E  +  E    E
Sbjct: 1082 SQRALQQLKKKCQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDS---ELSQAHEETQRE 1138

Query: 488  TDDREETERKNQDILDNSL-LAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKP 546
               RE+ +R+   +L  +  L  +   K+   A  T K    +A   +QD   Q+ +++ 
Sbjct: 1139 KLQREKLQREKDMLLAEAFSLKQQMEEKDLDIAGFTQKVVSLEAE--LQDISSQESKDEA 1196

Query: 547  LASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKS 606
              + +     D    K+  +E+EL EQ  ++   ++++Q++++ E   E+   ++ +   
Sbjct: 1197 SLAKVKKQLRDLEA-KVKDQEEELDEQAGSI---QMLEQAKLRLEMEMERMRQTHSKEME 1252

Query: 607  LSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSP 666
               +E+++  Q   K   +    ++  Y+  Q   KA+    + +     + + ++Q   
Sbjct: 1253 SRDEEVEEARQSCQKKLKQMEVQLEEEYEDKQ---KALREKRELESKLSTLSDQVNQRDF 1309

Query: 667  LGLMYEKDELHGVEAVYQKLDVLFRHCIENLRAN------KNAVD-------AMSKAVEA 713
                  + +L   +A+     ++  H   N  +       KN ++       A  KA +A
Sbjct: 1310 ESEKRLRKDLKRTKALLADAQIMLDHLKNNAPSKREIAQLKNQLEESEFTCAAAVKARKA 1369

Query: 714  GESSVR------------KHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKED----PK 757
             E  +             K + E   S+ Q+    + N ++E       L+K+      +
Sbjct: 1370 MEVEMEDLHLQIDDIAKAKTALEEQLSRLQREKNEIQNRLEEDQEDMNELMKKHKAAVAQ 1429

Query: 758  RGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLYTIISGSEKILQGDY 817
              +  + ++D+++++++ NK   +++ KL+      +  ++     +++S  E  ++   
Sbjct: 1430 ASRDMAQMNDLQAQIEESNKEKQELQEKLQALQSQVEFLEQSMVDKSLVSRQEAKIR--- 1486

Query: 818  TFPPLSSLDVQSKFDSSYSKLFEIFYGDW--TNNAIKEERYWTIYAFERSLKNQAHLNAE 875
                   L+ + +F+ +  K  E        T   + EER     A  R  +    L  +
Sbjct: 1487 ------ELETRLEFEKTQVKRLENLASRLKETMEKLTEERDQRAAAENREKEQNKRLQRQ 1540

Query: 876  V----ERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIKELKS 931
            +    E +S LA++ ++++    EL+  L       E+ ++ + + ++  F+R I +L++
Sbjct: 1541 LRDTKEEMSELARKEAEASRKKHELEMDLESL----EAANQSLQADLKLAFKR-IGDLQA 1595

Query: 932  VIEADAKENPNPN 944
             IE + + + N +
Sbjct: 1596 AIEDEMESDENED 1608


>gi|221485909|gb|EEE24179.1| trichohyalin, putative [Toxoplasma gondii GT1]
          Length = 2236

 Score = 45.5 bits (106), Expect = 0.056,   Method: Composition-based stats.
 Identities = 52/230 (22%), Positives = 102/230 (44%), Gaps = 42/230 (18%)

Query: 400 QEEKQRREQEAKE----KADREKADKEAKEKA---DREKADKDLQEKTPIKAEGDDFGLG 452
           +EE+++ EQE +E    +A+ EK  +EA EKA   +R+K +++ +E    +AE +     
Sbjct: 363 EEERKKMEQEREEWQKHRAEEEKGKQEAIEKAVEEERKKVEQEREEWQKHRAEEEK---- 418

Query: 453 LPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTE-TDDREETERKNQDILDNSLLAGKT 511
                        K+E +E+  +E +K  E    E    R E ER  Q+ ++ ++   + 
Sbjct: 419 ------------GKQEAIEKAVEEERKKMEQEREEWQKHRAEEERGKQEAIEKAVEEERK 466

Query: 512 HTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQ 571
            T+ E            Q H+  ++K  Q+  EK +  +    E +    +  + E+E  
Sbjct: 467 KTEQEREE--------WQKHRAEEEKGKQEAIEKAVEEERKKMEQEREEWQKHRAEEEKG 518

Query: 572 EQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAK 621
           +QE    + + +++ R + E  +E       EW+    +E K + +   K
Sbjct: 519 KQEA---IEQAVKEERKKMEQERE-------EWQKHRAEEEKGKQEAIEK 558



 Score = 43.6 bits (101), Expect = 0.21,   Method: Composition-based stats.
 Identities = 51/230 (22%), Positives = 103/230 (44%), Gaps = 42/230 (18%)

Query: 400 QEEKQRREQEAKE----KADREKADKEAKEKA---DREKADKDLQEKTPIKAEGDDFGLG 452
           +EE+++ EQE +E    +A+ EK  +EA EKA   +R+K +++ +E    +AE +     
Sbjct: 462 EEERKKTEQEREEWQKHRAEEEKGKQEAIEKAVEEERKKMEQEREEWQKHRAEEEK---- 517

Query: 453 LPSVPTHSVKLPPKEEELEE-VKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKT 511
                        K+E +E+ VK+E KK ++        R E E+  Q+ ++ ++   + 
Sbjct: 518 ------------GKQEAIEQAVKEERKKMEQEREEWQKHRAEEEKGKQEAIEKAVKEERK 565

Query: 512 HTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQ 571
             + E            Q H+  ++K  Q+  EK +  +    E +    +  + E+E  
Sbjct: 566 KMEQEREE--------WQKHRAEEEKGKQEAIEKAVEEERKKMEQEREEWQKHRAEEEKG 617

Query: 572 EQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAK 621
           +QE    + + +++ R + E  +E       EW+    +E K + +   K
Sbjct: 618 KQEA---IEKAVEEERKKMEQERE-------EWQKHRAEEEKGKQEAIEK 657


>gi|166031774|ref|ZP_02234603.1| hypothetical protein DORFOR_01475 [Dorea formicigenerans ATCC 27755]
 gi|166028227|gb|EDR46984.1| hypothetical protein DORFOR_01475 [Dorea formicigenerans ATCC 27755]
          Length = 1186

 Score = 45.5 bits (106), Expect = 0.057,   Method: Composition-based stats.
 Identities = 66/340 (19%), Positives = 140/340 (41%), Gaps = 40/340 (11%)

Query: 696  NLRANKNAVDAMSKAVEAGESSVRKHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKED 755
            NL + +  ++ + +AV+   + V K   E+   K+ +S      +  +I      L K  
Sbjct: 671  NLLSRRREIEELEQAVQKLRADVAKTEQEIAELKNNRS-----GYYDKIEQIKDLLQKAY 725

Query: 756  PKRGKSESYLSDIRSELQKVNKTVMDIRIKLR-LYGIFQDIPQEQPPLYTIISGSEKILQ 814
             ++  ++      +S+++  N+T ++I+ + + L     DI   Q  +   +  SE++ +
Sbjct: 726  VRQNTAKMNADQAKSKIEAANQTALEIQKETQQLDQEISDIMDNQQSINVELDTSEQLER 785

Query: 815  GDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERS----LKNQA 870
                       D+  + +   +KL ++ + +       E  + +  A E+     ++N  
Sbjct: 786  -----------DLNKQIEEGQTKLDDLKHQEILQQQASENAHLSCAATEQKVLFVMENAE 834

Query: 871  HLNAEV----ERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREI 926
             +  E+    E L GL      ++ +++E ++Q+   ++  E++ E  V           
Sbjct: 835  RIQEEMQKFREELKGLEASKGGTSREIEEKESQIQELRQTIENSGELFV----------- 883

Query: 927  KELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKELNIDNAYGLWNEYKEDFKA 986
             E++  IE   K   + N+  K+  + RE L  Q+S   KE  I       N Y+E  + 
Sbjct: 884  -EIQDEIEKAKKTREDLNQRHKEFLQKREDLSRQISDLDKE--IFRLESQKNSYEEAAEK 940

Query: 987  SFEYPLGTYEPAILGAMK-DMDRLHPIYSVSKTIQKAGGD 1025
               Y    YE     AM+   + L  +  + K IQ+  G+
Sbjct: 941  QINYMWEEYELTYNRAMELRNENLTDVAKMKKRIQELKGE 980


>gi|28416946|ref|NP_510880.2| myosin-XVIIIa isoform a [Homo sapiens]
 gi|33301318|sp|Q92614|MY18A_HUMAN RecName: Full=Myosin-XVIIIa; AltName: Full=Molecule associated with
            JAK3 N-terminus; Short=MAJN; AltName: Full=Myosin
            containing a PDZ domain
 gi|119571568|gb|EAW51183.1| hCG27198, isoform CRA_h [Homo sapiens]
 gi|168274483|dbj|BAG09661.1| myosin-XVIIIa [synthetic construct]
          Length = 2054

 Score = 45.5 bits (106), Expect = 0.060,   Method: Composition-based stats.
 Identities = 115/645 (17%), Positives = 261/645 (40%), Gaps = 84/645 (13%)

Query: 369  AETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKAD 428
             E RL Y       +FT +  Q          E+K   EQ+ K + +R   D +A +  +
Sbjct: 1369 GEWRLKYERAVREVDFTKKRLQQEF-------EDKLEVEQQNKRQLERRLGDLQA-DSEE 1420

Query: 429  REKADKDLQEKTP-IKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTE 487
             ++A + L++K   + AE  D  L L      + +L  K+   +    E  +  E    E
Sbjct: 1421 SQRALQQLKKKCQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDS---ELSQAHEEAQRE 1477

Query: 488  TDDREETERKNQDILDNSL-LAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKP 546
               RE+ +R+   +L  +  L  +   K+   A  T K    +A   +QD   Q+ +++ 
Sbjct: 1478 KLQREKLQREKDMLLAEAFSLKQQLEEKDMDIAGFTQKVVSLEAE--LQDISSQESKDEA 1535

Query: 547  LASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKS 606
              + +     D    K+  +E+EL EQ   +   ++++Q++++ E   E+   ++ +   
Sbjct: 1536 SLAKVKKQLRDLEA-KVKDQEEELDEQAGTI---QMLEQAKLRLEMEMERMRQTHSKEME 1591

Query: 607  LSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSP 666
               +E+++  Q   K   +    ++  Y+  Q+  +             ++     Q + 
Sbjct: 1592 SRDEEVEEARQSCQKKLKQMEVQLEEEYEDKQKVLREKRELEG------KLATLSDQVNR 1645

Query: 667  LGLMYEK---DELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGE----SSVR 719
                 EK    +L   +A+     ++  H ++N   +K  +  +   +E  E    ++V+
Sbjct: 1646 RDFESEKRLRKDLKRTKALLADAQLMLDH-LKNSAPSKREIAQLKNQLEESEFTCAAAVK 1704

Query: 720  ----------------------KHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKED-- 755
                                  K + E   S+ Q+    + N ++E       L+K+   
Sbjct: 1705 ARKAMEVEIEDLHLQIDDIAKAKTALEEQLSRLQREKNEIQNRLEEDQEDMNELMKKHKA 1764

Query: 756  --PKRGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLYTIISGSEKIL 813
               +  +  + ++D++++L++ NK   +++ KL+      +  ++     +++S  E  +
Sbjct: 1765 AVAQASRDLAQINDLQAQLEEANKEKQELQEKLQALQSQVEFLEQSMVDKSLVSRQEAKI 1824

Query: 814  QGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIK--EERYWTIYAFERSLKNQAH 871
            +          L+ + +F+ +  K  E        N  K  EER   I A  R  +    
Sbjct: 1825 R---------ELETRLEFERTQVKRLESLASRLKENMEKLTEERDQRIAAENREKEQNKR 1875

Query: 872  LNAEV----ERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIK 927
            L  ++    E +  LA++ ++++    EL+  L       E+ ++ + + ++  F+R I 
Sbjct: 1876 LQRQLRDTKEEMGELARKEAEASRKKHELEMDLESL----EAANQSLQADLKLAFKR-IG 1930

Query: 928  ELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKELNIDN 972
            +L++ IE + + + N +     L  + + +V +   R  +L  D+
Sbjct: 1931 DLQAAIEDEMESDENED-----LINSLQDMVTKYQKRKNKLEGDS 1970


>gi|95147555|ref|NP_002364.5| microtubule-associated protein 1A [Homo sapiens]
 gi|313104325|sp|P78559|MAP1A_HUMAN RecName: Full=Microtubule-associated protein 1A; Short=MAP-1A;
            AltName: Full=Proliferation-related protein p80;
            Contains: RecName: Full=MAP1 light chain LC2
 gi|119613014|gb|EAW92608.1| microtubule-associated protein 1A, isoform CRA_c [Homo sapiens]
 gi|260158890|gb|ACX32325.1| microtubule-associated protein 1A [synthetic construct]
          Length = 2803

 Score = 45.5 bits (106), Expect = 0.062,   Method: Composition-based stats.
 Identities = 63/268 (23%), Positives = 113/268 (42%), Gaps = 31/268 (11%)

Query: 402  EKQRREQEAKEKADREKADK--EAKEKADREKADKDLQEKTPIKAEGDD-FGLGLPSVPT 458
            E++ R+ E K+ A  E+ DK  E K+K D E+ DK L++K  I  E D        ++  
Sbjct: 1409 EQKGRDLEQKDTA-LEQKDKALEPKDK-DLEEKDKALEQKDKIPEEKDKALEQKDTALEQ 1466

Query: 459  HSVKLPPKEEELEEVKDEGKKGKEPGTTETDDR--EETERKNQDILDNSLLAGKTHTKNE 516
                L PK+++LE+ KD   + KE    E D    ++         ++++   K     +
Sbjct: 1467 KDKALEPKDKDLEQ-KDRVLEQKEKIPEEKDKALDQKVRSVEHKAPEDTVAEMKDRDLEQ 1525

Query: 517  TPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEEN 576
            T   P  K    +    + +KK Q   +K  A    +G+ D A       E+ +Q  EEN
Sbjct: 1526 TDKAPEQKHQAQEQKDKVSEKKDQALEQKYWA----LGQKDEA------LEQNIQALEEN 1575

Query: 577  LRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSYKG 636
                    Q++ Q   +QE      K  +  SP+++K   +K   +  ++ +       G
Sbjct: 1576 -------HQTQEQESLVQEDKTRKPKMLEEKSPEKVKAMEEKLEALLEKTKA------LG 1622

Query: 637  TQESDKAINHFLDNDFGYYRIHNFLSQW 664
             +ES        + +  Y+R  + + +W
Sbjct: 1623 LEESLVQEGRAREQEEKYWRGQDVVQEW 1650


>gi|168576062|ref|ZP_02721967.1| surface protein PspC [Streptococcus pneumoniae MLV-016]
 gi|183578076|gb|EDT98604.1| surface protein PspC [Streptococcus pneumoniae MLV-016]
          Length = 715

 Score = 45.5 bits (106), Expect = 0.062,   Method: Composition-based stats.
 Identities = 64/257 (24%), Positives = 111/257 (43%), Gaps = 60/257 (23%)

Query: 368 KAETRLAYSTIA------NVANFTSELKQATV-LARANAQE---EKQRREQEAKEKADRE 417
           K + R  Y TI        +A    E+K+A + L +  A E   E++ ++ EAK ++ + 
Sbjct: 164 KEKDRRNYPTITYKTLELEIAESDVEVKKAELELVKVKANEPRDEEKIKQAEAKVESKQA 223

Query: 418 KADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEG 477
           +A +  K K DRE+A+    E      E                    + EE  +VKDE 
Sbjct: 224 EATRLKKIKTDREQAEATRLENIKTDRE--------------------QAEEEAKVKDEP 263

Query: 478 KKGKEPGT---TETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAK---------A 525
           KK  + G      T D++E + K+ D          +    ET   P+ K          
Sbjct: 264 KKRTKRGVLGEPATPDKKENDAKSSD----------SSVGEETLPSPSLKPEKKVAEAEK 313

Query: 526 PPAQAHKGIQDKKPQDQREKPLAS----DIGVGESDYAGIKLTKKEKEL-QEQEENLRVA 580
              +A K  +D+K +D+R  P  +    ++ + ESD   +++ K E EL +E+ +  R  
Sbjct: 314 KVEEAKKKAEDQKEEDRRNYPTNTYKTLELEIAESD---VEVKKAELELVKEEAKEPRNE 370

Query: 581 EIIQQSRMQSEDLQEKA 597
           E ++Q++ + E  Q +A
Sbjct: 371 EKVKQAKAEVESKQAEA 387


>gi|313225548|emb|CBY07022.1| unnamed protein product [Oikopleura dioica]
          Length = 2355

 Score = 45.5 bits (106), Expect = 0.064,   Method: Composition-based stats.
 Identities = 52/216 (24%), Positives = 101/216 (46%), Gaps = 18/216 (8%)

Query: 397  ANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDL-QEKTPI--KAEG-----DD 448
            + A+E K+ ++ E      +++ +KE K +A+ E+    L QE+  +  KAE      DD
Sbjct: 829  SQAEEGKKMQDLEKNYDEVKKQLEKEKKRRAELEEQSVSLEQERNELNQKAEAQNSLLDD 888

Query: 449  FGLGLPSVPTHSVKLPPKEEELEE-VKDEGKKGKEPGTTETDDREETERKNQDILDNSLL 507
                   +  + ++L  K  EL+E ++DE +   E    +    +E+    +DI D  L 
Sbjct: 889  AEGRCEELIGNKIELDSKIRELQEKLEDEEEMNNELVAKKRKLEDESSELKKDIDDLELT 948

Query: 508  AGKTH-----TKNETPAIPTAKAPPAQA-HKGIQDKKPQDQREKPLASDIGVGESDYAGI 561
              K       T+N++  +    A   ++ HK  ++KK   +  K   +D+   E     +
Sbjct: 949  LAKIEKEKHATENKSKNVTEELASITESIHKLEKEKKALQEAHKQTLADLQSEEEKV--V 1006

Query: 562  KLTKKEKELQEQEENLRVA-EIIQQSRMQSEDLQEK 596
             L+K + +L++Q ++L +  E  ++SRM  E  + K
Sbjct: 1007 TLSKSKGKLEQQVDDLEIGLEAEKKSRMDLERAKRK 1042


>gi|126307118|ref|XP_001376049.1| PREDICTED: similar to C219-reactive peptide (FLJ39207) [Monodelphis
            domestica]
          Length = 2110

 Score = 45.5 bits (106), Expect = 0.065,   Method: Composition-based stats.
 Identities = 88/387 (22%), Positives = 159/387 (41%), Gaps = 56/387 (14%)

Query: 65   EQRLKKVSERYERVVSRDLTLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLLCRFM 124
            + ++KK  E  +    +++ L  EA   DLK   DT+K L ET +  L DK   L     
Sbjct: 1437 DHKIKKAKESVKETKKQNINLSDEAA--DLK---DTIKGLEETNKK-LDDKVKNL----H 1486

Query: 125  DMVETEDEHKINKQVRDALESAGFDLESTQENIRKVESALINNN--MKDAFRFLELAQKS 182
             ++ETE E  + KQ  D +      LE TQ++I K++  +  ++  + +    L  A+ S
Sbjct: 1487 SLLETEKEQNVKKQ--DMI------LE-TQKSIEKLQEVITMHSVELSEVQIALNEAKLS 1537

Query: 183  KETADSHIIEAIDVGTKLKENTPPTTFTSISKVLLKSNNMQDVVFTKIKEVVKKHVNAEL 242
            +E   S +    +   +LK+           + LL+         T++ E ++ +   + 
Sbjct: 1538 EEKVKSELHHVQEENARLKKR---------KEQLLQEAEGWSERHTELSEQIRLYQKTQK 1588

Query: 243  GHRKLRGLAFDHTYFNDKLNQFLKEIKNHQKEYDESEKGSSKARYHAAYAHIYWDLANDW 302
               +   LA+      D L   + ++K  Q + D   +G +    +       WD   D 
Sbjct: 1589 DTEE--ALAYKENEI-DVLTNCIMQLK--QLDLDSESEGKNNEEGNG------WD---DL 1634

Query: 303  VNGRVGDKSDEWARTSTNIASWIGRITRT--------EGLGGVTYDQIKQLRDLASKVKA 354
             NG VG   +E  +        + R+  T          L     D+IK   +L  ++K 
Sbjct: 1635 ANGEVGYNRNEKMKIQIKQMMDVSRVKTTLTIVEEDRNHLQSKLSDEIKARHELEEQIKK 1694

Query: 355  DYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLA--RANAQEEKQRREQEAKE 412
              H +   H  +   E      T+       +EL Q   +A  +   QEE +R+E+E K 
Sbjct: 1695 LEHDSSSLHSAKAHLENEC--KTLQQKVEILNELYQQKEMALQKKLTQEEYERQEKEQKL 1752

Query: 413  KADREKADKEAKEKADREKADKDLQEK 439
             A  EKA   A+E    ++  ++++++
Sbjct: 1753 TAADEKASLVAEEVKTYKQRIQEMEDE 1779


>gi|326672506|ref|XP_690237.5| PREDICTED: putative sodium-coupled neutral amino acid transporter 10
            [Danio rerio]
          Length = 1125

 Score = 45.5 bits (106), Expect = 0.066,   Method: Composition-based stats.
 Identities = 32/116 (27%), Positives = 57/116 (49%), Gaps = 9/116 (7%)

Query: 378  IANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQ 437
            +  V +   E ++   L   N ++E+++ ++E  E+A++EK  +E KE+ ++      LQ
Sbjct: 962  LQQVIDARHEKQKKESLEDENLKQEREKMDKEIMERAEKEKVIQEHKERLEQ------LQ 1015

Query: 438  EKTPIKAEGDDFGLGLPSVPTHSVKLPPKEE--ELEEVKDEGKKGKEPGTTETDDR 491
            +    K E D    G+P +P  +     KE    LEE K E K+ +E G  +   R
Sbjct: 1016 QVIDAKKEADALKEGVPPMPKQNGGRDLKENIVPLEEQKQE-KRSREDGGLDLKRR 1070


>gi|54633200|dbj|BAD66836.1| KIAA0216 splice variant 1 [Homo sapiens]
          Length = 2046

 Score = 45.5 bits (106), Expect = 0.066,   Method: Composition-based stats.
 Identities = 115/645 (17%), Positives = 261/645 (40%), Gaps = 84/645 (13%)

Query: 369  AETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKAD 428
             E RL Y       +FT +  Q          E+K   EQ+ K + +R   D +A +  +
Sbjct: 1361 GEWRLKYERAVREVDFTKKRLQQEF-------EDKLEVEQQNKRQLERRLGDLQA-DSEE 1412

Query: 429  REKADKDLQEKTP-IKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTE 487
             ++A + L++K   + AE  D  L L      + +L  K+   +    E  +  E    E
Sbjct: 1413 SQRALQQLKKKCQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDS---ELSQAHEEAQRE 1469

Query: 488  TDDREETERKNQDILDNSL-LAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKP 546
               RE+ +R+   +L  +  L  +   K+   A  T K    +A   +QD   Q+ +++ 
Sbjct: 1470 KLQREKLQREKDMLLAEAFSLKQQLEEKDMDIAGFTQKVVSLEAE--LQDISSQESKDEA 1527

Query: 547  LASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKS 606
              + +     D    K+  +E+EL EQ   +   ++++Q++++ E   E+   ++ +   
Sbjct: 1528 SLAKVKKQLRDLEA-KVKDQEEELDEQAGTI---QMLEQAKLRLEMEMERMRQTHSKEME 1583

Query: 607  LSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSP 666
               +E+++  Q   K   +    ++  Y+  Q+  +             ++     Q + 
Sbjct: 1584 SRDEEVEEARQSCQKKLKQMEVQLEEEYEDKQKVLREKRELEG------KLATLSDQVNR 1637

Query: 667  LGLMYEK---DELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGE----SSVR 719
                 EK    +L   +A+     ++  H ++N   +K  +  +   +E  E    ++V+
Sbjct: 1638 RDFESEKRLRKDLKRTKALLADAQLMLDH-LKNSAPSKREIAQLKNQLEESEFTCAAAVK 1696

Query: 720  ----------------------KHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKED-- 755
                                  K + E   S+ Q+    + N ++E       L+K+   
Sbjct: 1697 ARKAMEVEIEDLHLQIDDIAKAKTALEEQLSRLQREKNEIQNRLEEDQEDMNELMKKHKA 1756

Query: 756  --PKRGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLYTIISGSEKIL 813
               +  +  + ++D++++L++ NK   +++ KL+      +  ++     +++S  E  +
Sbjct: 1757 AVAQASRDLAQINDLQAQLEEANKEKQELQEKLQALQSQVEFLEQSMVDKSLVSRQEAKI 1816

Query: 814  QGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIK--EERYWTIYAFERSLKNQAH 871
            +          L+ + +F+ +  K  E        N  K  EER   I A  R  +    
Sbjct: 1817 R---------ELETRLEFERTQVKRLESLASRLKENMEKLTEERDQRIAAENREKEQNKR 1867

Query: 872  LNAEV----ERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIK 927
            L  ++    E +  LA++ ++++    EL+  L       E+ ++ + + ++  F+R I 
Sbjct: 1868 LQRQLRDTKEEMGELARKEAEASRKKHELEMDLESL----EAANQSLQADLKLAFKR-IG 1922

Query: 928  ELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKELNIDN 972
            +L++ IE + + + N +     L  + + +V +   R  +L  D+
Sbjct: 1923 DLQAAIEDEMESDENED-----LINSLQDMVTKYQKRKNKLEGDS 1962


>gi|237744785|ref|ZP_04575266.1| predicted protein [Fusobacterium sp. 7_1]
 gi|229432014|gb|EEO42226.1| predicted protein [Fusobacterium sp. 7_1]
          Length = 923

 Score = 45.5 bits (106), Expect = 0.068,   Method: Composition-based stats.
 Identities = 31/99 (31%), Positives = 52/99 (52%), Gaps = 5/99 (5%)

Query: 873 NAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIKELKSV 932
           N  + +LS    + +    +LK+ Q+ L++  K  ++  E+IV+    E E+ IK LK  
Sbjct: 34  NKGISQLSNTIGKLNQEIINLKDSQSLLAKYNKDTKALKEKIVTI--KETEKAIKNLKRE 91

Query: 933 IEADAK---ENPNPNKNQKKLQKTREKLVAQLSSRLKEL 968
           IE + K   EN    + Q+K  K  +K+V + +  LKEL
Sbjct: 92  IEIEKKAIEENTGKTRKQRKELKESKKIVEEKTKALKEL 130


>gi|299743639|ref|XP_001835890.2| pre-mRNA splicing factor [Coprinopsis cinerea okayama7#130]
 gi|298405749|gb|EAU85955.2| pre-mRNA splicing factor [Coprinopsis cinerea okayama7#130]
          Length = 1090

 Score = 45.1 bits (105), Expect = 0.071,   Method: Composition-based stats.
 Identities = 55/246 (22%), Positives = 114/246 (46%), Gaps = 30/246 (12%)

Query: 400 QEEKQRRE--QEAKEKADREKADKEAKEKA-DREKADKDLQEKTPIKAEGDDFGL----- 451
           ++E Q  E  +E   ++ + K DK+ +++  D ++ + D +EK   + +GD+ G      
Sbjct: 115 EDEDQSIEILKEKPRESSKSKRDKQIRKRDYDGKEWESDEEEKARKRWKGDEEGERRDED 174

Query: 452 ----GLPS--VPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDR-EETERKNQDILDN 504
               G P+  +   ++K   + E++ E     ++ KE    +T    E+   +N      
Sbjct: 175 ADMDGEPAEEIDEEALKEQQRLEDIRERDAFAERMKERDKQKTKKVVEDRSSRNAGATSE 234

Query: 505 SLLAGKTHTKNE--TPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIK 562
           + L  +     E  + A+P+ +    Q +      K + Q+ + L  +I   E+ +AG+K
Sbjct: 235 AALRRQLADDAEARSQALPSLRLHSRQEYL----TKREIQQIELLRKEIADDEALFAGMK 290

Query: 563 LTKKE-KELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAK 621
           +TK+E +EL++++E LR+ E     R++  D     W+ Y+  +    ++ K   +K   
Sbjct: 291 ITKRERRELEQKKELLRLVE----ERLKIND----KWEGYQLPEDYLTEQGKIDKKKKEN 342

Query: 622 VFYRSY 627
             YR Y
Sbjct: 343 ALYRRY 348


>gi|318064388|gb|ADV36425.1| hypothetical protein [Edwardsiella phage eiAU]
          Length = 222

 Score = 45.1 bits (105), Expect = 0.073,   Method: Composition-based stats.
 Identities = 54/195 (27%), Positives = 77/195 (39%), Gaps = 38/195 (19%)

Query: 379 ANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKAD----- 433
           + VA   +E K  T   RA  + EKQ RE+ A++  D +  DK  +EK  + +A+     
Sbjct: 44  SQVAALLNEKKTETEKRRAAEEAEKQAREEAARKAGDVDALDKSWQEKLAKVQAEAGGRT 103

Query: 434 ----KDLQEKT--------PIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGK--- 478
               K +Q+ T          +  G + GL LP V        P+   LEEV  + K   
Sbjct: 104 ELLSKKVQDLTIGATARDLASRVFGKNAGLMLPHV-------APR-LSLEEVDGDFKVRV 155

Query: 479 -KGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDK 537
            K  +P     DD E+  R N D     + +G   T       P     PA    G   +
Sbjct: 156 MKDGKPSAMSLDDLEKEFRTNADYAAVVVASGAGGT-------PKGGFQPAGG--GAMPQ 206

Query: 538 KPQDQREKPLASDIG 552
               QR   +AS IG
Sbjct: 207 STLAQRATEIASGIG 221


>gi|293343706|ref|XP_002725556.1| PREDICTED: rCG32052-like [Rattus norvegicus]
 gi|293355596|ref|XP_002728709.1| PREDICTED: paternally expressed 3 [Rattus norvegicus]
 gi|149027640|gb|EDL83191.1| rCG32052, isoform CRA_a [Rattus norvegicus]
          Length = 1579

 Score = 45.1 bits (105), Expect = 0.074,   Method: Composition-based stats.
 Identities = 31/101 (30%), Positives = 47/101 (46%), Gaps = 18/101 (17%)

Query: 401  EEKQRREQEAKEKADREKADKEA--KEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPT 458
            +E Q +E + KE  D+E  DKE   KE  D+E  DK+ Q+K P   E  D          
Sbjct: 973  DEPQDKEPQDKEPQDKEPQDKEPQDKEPQDKEPQDKEPQDKQPQDKEPQD---------- 1022

Query: 459  HSVKLPPKEEEL--EEVKDEGKKGKEPGTTETDDREETERK 497
                  P ++E+  EE   +   G+EP   E  D+E  +++
Sbjct: 1023 ----KEPLDQEMRSEEPHGDQPHGQEPHGDEPHDKEPVDQE 1059


>gi|8163638|gb|AAF73776.1|AF154009_1 surface protein PspC [Streptococcus pneumoniae]
          Length = 695

 Score = 45.1 bits (105), Expect = 0.076,   Method: Composition-based stats.
 Identities = 54/208 (25%), Positives = 96/208 (46%), Gaps = 45/208 (21%)

Query: 395 ARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLP 454
           A+A  + E+    +  K K DREKA++EAK +AD ++ D+  + K+ +K  GD   LG P
Sbjct: 207 AKAKVESEQAEATRLKKIKTDREKAEEEAKRRADAKEQDESKRRKSRVK-RGD---LGEP 262

Query: 455 SVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTK 514
           + P                    KK  +  ++++   EET      +   SL  GK   +
Sbjct: 263 ATPD-------------------KKENDAKSSDSGVGEET------LPSPSLKPGKKVAE 297

Query: 515 NETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLAS----DIGVGESDYAGIKLTKKEKEL 570
            E            +A K  +D+K +D R  P  +    ++ + ESD   +++ K E EL
Sbjct: 298 AEKKV--------EEAEKKAKDQKEEDHRNYPTITYKTLELEIAESD---VEVKKAELEL 346

Query: 571 -QEQEENLRVAEIIQQSRMQSEDLQEKA 597
            +E+ +  R  E ++Q++ + E  + +A
Sbjct: 347 VKEEAKGSRNEEKVKQAKAEVESKKAEA 374


>gi|325125153|gb|ADY84483.1| Cell division protein [Lactobacillus delbrueckii subsp. bulgaricus
           2038]
          Length = 737

 Score = 45.1 bits (105), Expect = 0.078,   Method: Composition-based stats.
 Identities = 40/148 (27%), Positives = 61/148 (41%), Gaps = 22/148 (14%)

Query: 362 RHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADK 421
           R  +R  AE  L Y T+        + KQ   L +     EK   E  ++ KA   +  K
Sbjct: 598 REKHRIIAEALLKYETL--------DEKQIYSLYKTGKMPEKSSEEFPSEAKALSYEEAK 649

Query: 422 EAKEKADREKADKDLQEK----TP----IKAEGDDFGLGLPSV------PTHSVKLPPKE 467
           EA +K   EKA++D  EK    TP    +K E D   L  P        P  S+  P + 
Sbjct: 650 EAAQKRAEEKAEEDTAEKQALATPSEDAVKPETDAAKLAEPDASASQEDPADSLPTPSES 709

Query: 468 EELEEVKDEGKKGKEPGTTETDDREETE 495
           +  ++ + +        T +TDD ++ E
Sbjct: 710 DLSKDPEKDDNDAPSQKTEQTDDSDKDE 737


>gi|104773522|ref|YP_618502.1| cell division protein FtsH [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|103422603|emb|CAI97206.1| Cell division protein FtsH [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
          Length = 737

 Score = 45.1 bits (105), Expect = 0.078,   Method: Composition-based stats.
 Identities = 40/148 (27%), Positives = 61/148 (41%), Gaps = 22/148 (14%)

Query: 362 RHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADK 421
           R  +R  AE  L Y T+        + KQ   L +     EK   E  ++ KA   +  K
Sbjct: 598 REKHRIIAEALLKYETL--------DEKQIYSLYKTGKMPEKSSEEFPSEAKALSYEEAK 649

Query: 422 EAKEKADREKADKDLQEK----TP----IKAEGDDFGLGLPSV------PTHSVKLPPKE 467
           EA +K   EKA++D  EK    TP    +K E D   L  P        P  S+  P + 
Sbjct: 650 EAAQKRAEEKAEEDTAEKQALATPSEDAVKPETDAAKLAEPDASASQEDPVDSLPTPSES 709

Query: 468 EELEEVKDEGKKGKEPGTTETDDREETE 495
           +  ++ + +        T +TDD ++ E
Sbjct: 710 DLSKDPEKDDNDAPSQKTEQTDDSDKDE 737


>gi|73982676|ref|XP_851317.1| PREDICTED: similar to cortactin isoform a isoform 1 [Canis
           familiaris]
          Length = 541

 Score = 45.1 bits (105), Expect = 0.078,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 7/73 (9%)

Query: 396 RANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPS 455
           RAN +   + +EQE + KA+ EKA + AKE+ ++E+A + L E+   +A+        P+
Sbjct: 351 RANFENLAKEKEQEDRRKAEAEKAQRMAKERQEQEEARRQLHEQAQAQAQK-------PT 403

Query: 456 VPTHSVKLPPKEE 468
            P      P +E+
Sbjct: 404 PPASPTPQPAQEK 416


>gi|225862006|ref|YP_002743515.1| surface protein PspC [Streptococcus pneumoniae Taiwan19F-14]
 gi|225728245|gb|ACO24096.1| surface protein PspC [Streptococcus pneumoniae Taiwan19F-14]
          Length = 567

 Score = 45.1 bits (105), Expect = 0.078,   Method: Composition-based stats.
 Identities = 53/203 (26%), Positives = 97/203 (47%), Gaps = 13/203 (6%)

Query: 400 QEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTH 459
           + E +  ++EAKE  + EK  K+AK K + EKA+    E+  IK + ++      +    
Sbjct: 73  EAELELVKEEAKESRNEEKV-KQAKAKVESEKAEAIRLEE--IKTDREEAKRKADAKLKE 129

Query: 460 SVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPA 519
           +V+      E  E K   K+G   G   T D++E + K+ D             K E   
Sbjct: 130 AVENNAATSEQGEPKRRVKRGVL-GEPATPDKKENDAKSSDSSVGEETLPSPSLKPEK-K 187

Query: 520 IPTAKAPPAQAHKGIQDKKPQDQREKPLAS----DIGVGESDYAGIKLTKKEKEL-QEQE 574
           +  A+   A+A K  +D+K +D+R  P  +    ++ + ESD   +K+ + E EL +E+ 
Sbjct: 188 VAEAEKKVAEAEKKAKDQKEEDRRNYPTNTYKTLELEIAESD---VKVKEAELELVKEEA 244

Query: 575 ENLRVAEIIQQSRMQSEDLQEKA 597
           +  R  E ++Q++ + E  + +A
Sbjct: 245 KESRNEEKVKQAKAKVESKKAEA 267


>gi|260811019|ref|XP_002600220.1| hypothetical protein BRAFLDRAFT_118261 [Branchiostoma floridae]
 gi|229285506|gb|EEN56232.1| hypothetical protein BRAFLDRAFT_118261 [Branchiostoma floridae]
          Length = 655

 Score = 45.1 bits (105), Expect = 0.078,   Method: Composition-based stats.
 Identities = 45/213 (21%), Positives = 86/213 (40%), Gaps = 23/213 (10%)

Query: 399 AQEEKQRREQEAKEKADREKAD-KEAKEKADREKADKDLQEKTPIKAEGDD--------F 449
           + E+K++R+Q+A  +     A  +E K  A++EK  + L  +  ++ + DD         
Sbjct: 293 SAEDKEKRKQQAGRRLQEINAKRREQKLAAEQEKLQQLLSIQELMEDDDDDSFLRALEEC 352

Query: 450 GLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETE-------RKNQDIL 502
           G    +         PK + L+   DEG+  +     +   R E E       R+ Q+I+
Sbjct: 353 GFSSANELQQPFNFAPKGKMLQ--PDEGQTSRATPELDKQQRAEREAIVGNLRRQRQEIV 410

Query: 503 DNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIK 562
           +      +   +     +   K+  AQ    I  +  Q +R +      G+ E D+   K
Sbjct: 411 ETRQQRRQRRQE-----VAKRKSHAAQERMKILTQLAQSERRRGKEDTFGMNEEDWNVYK 465

Query: 563 LTKKEKELQEQEENLRVAEIIQQSRMQSEDLQE 595
              KE +   ++E  R+ +I Q  R    D ++
Sbjct: 466 AISKEGDSDSEQEQERLNQIDQLLREHDPDFEK 498


>gi|73982672|ref|XP_863461.1| PREDICTED: similar to cortactin isoform a isoform 5 [Canis
           familiaris]
          Length = 555

 Score = 45.1 bits (105), Expect = 0.078,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 7/73 (9%)

Query: 396 RANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPS 455
           RAN +   + +EQE + KA+ EKA + AKE+ ++E+A + L E+   +A+        P+
Sbjct: 351 RANFENLAKEKEQEDRRKAEAEKAQRMAKERQEQEEARRQLHEQAQAQAQK-------PT 403

Query: 456 VPTHSVKLPPKEE 468
            P      P +E+
Sbjct: 404 PPASPTPQPAQEK 416


>gi|218|emb|CAA27841.1| unnamed protein product [Bos taurus]
 gi|225180|prf||1210310A chromogranin A,pre
          Length = 449

 Score = 45.1 bits (105), Expect = 0.079,   Method: Composition-based stats.
 Identities = 65/278 (23%), Positives = 107/278 (38%), Gaps = 41/278 (14%)

Query: 361 IRHGNRFKAETRLAYS-----TIANVANFTSELKQATVLARANAQEEKQRREQEAKEKAD 415
           +RH N  K    LA       T     + + E + + VL + N Q E +   +E   K  
Sbjct: 70  LRHQNLLKELQDLALQGAKERTHQQKKHSSYEDELSEVLEKPNDQAEPKEVTEEVSSKDA 129

Query: 416 REKADKEAKEKADREKADKDLQE------KTPIKAEGDDFGLG-----------LPSVPT 458
            EK D   + +   E +D D  +      + P K E D+   G           L S+P 
Sbjct: 130 AEKRDDFKEVEKSDEDSDGDRPQAPQGLGRGP-KVEEDNQAPGEEEEAPSNAHPLASLP- 187

Query: 459 HSVKLP-PKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNET 517
            S K P P+ +E  E   +G   +E G +    R+    + ++  + +    K   + E+
Sbjct: 188 -SPKYPGPQAKEDSEGPSQGPASREKGLSAEQGRQTEREEEEEKWEEAEAREKAVPEEES 246

Query: 518 PAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKEL----QEQ 573
           P     K PP+  +K       + QR  P   + G G+      K  + + E     QE+
Sbjct: 247 PPTAAFKPPPSLGNK-------ETQRAAPGWPEDGAGKMGAEEAKPPEGKGEWAHSRQEE 299

Query: 574 EENLRVAEIIQQSRMQSEDLQE----KAWDSYKEWKSL 607
           EE  R  +++ +     E  QE    K W+  K W  +
Sbjct: 300 EEMARAPQVLFRGGKSGEPEQEEQLSKEWEDAKRWSKM 337


>gi|8163703|gb|AAF73811.1|AF154039_1 surface protein PspC [Streptococcus pneumoniae]
          Length = 684

 Score = 45.1 bits (105), Expect = 0.081,   Method: Composition-based stats.
 Identities = 62/265 (23%), Positives = 120/265 (45%), Gaps = 34/265 (12%)

Query: 343 KQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIA-NVANFTSELKQATV-LARANAQ 400
           K++ +   KV+     A+ +    ++    + Y T+   +A F  ++K+A + L +  A+
Sbjct: 176 KKVAEARKKVEEAEKKAKDQKEEDYRNYPTITYKTLELEIAEFDVKVKEAELELLKVKAK 235

Query: 401 E---EKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVP 457
           E   EK+ +  EA+ ++ + +A +  K K DR+KA+++ + K  ++        G P   
Sbjct: 236 ESRDEKKIKHAEAEVESKQAEATRLKKIKTDRKKAEEEAKLKEAVEKNAATSEQGKP--- 292

Query: 458 THSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNET 517
                           K   K+G   G   T D++E + K+ D             K E 
Sbjct: 293 ----------------KRRVKRGAL-GEQATPDKKENDAKSSDSSVGEETLPSPSLKPEK 335

Query: 518 PAIPTAKAPPAQAHKGIQDKKPQDQREKPLAS----DIGVGESDYAGIKLTKKEKEL-QE 572
             +  A+   A+A K  +D+K +D+R  P  +    ++ + ESD   +K+ + E EL +E
Sbjct: 336 -KVAEAQKKVAEAEKKAKDQKEEDRRNYPTNTYKTLELEIAESD---VKVKEAELELVKE 391

Query: 573 QEENLRVAEIIQQSRMQSEDLQEKA 597
           + +  R  E I+Q + + E  Q +A
Sbjct: 392 EAKESRNEEKIKQVKAKVESKQAEA 416


>gi|268574596|ref|XP_002642277.1| Hypothetical protein CBG18266 [Caenorhabditis briggsae]
 gi|187025279|emb|CAP35746.1| hypothetical protein CBG_18266 [Caenorhabditis briggsae AF16]
          Length = 672

 Score = 45.1 bits (105), Expect = 0.084,   Method: Composition-based stats.
 Identities = 52/219 (23%), Positives = 92/219 (42%), Gaps = 42/219 (19%)

Query: 383 NFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPI 442
           NF S + Q     +  A+E+    EQ  + +ADRE+   E + KAD  + +K      P 
Sbjct: 174 NFWSSMNQEE--KKRQAEEKASHAEQLKRYEADRERTAAEIQNKADNYQPEKVNSVYKPT 231

Query: 443 KAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDIL 502
           K          P V   SV    ++E   ++ +E KK +E    E   REE +++ +   
Sbjct: 232 K----------PHVEMRSVN---RDEFWSKMNEEEKKRQE---DEMLAREEAQKQYE--A 273

Query: 503 DNSLLAGKTHTKNET--PAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAG 560
           D   +A + H+K E+  P   T+   P + H  I     ++                   
Sbjct: 274 DRQRMASEMHSKAESYQPEKVTSVYKPTKPHVEISSSAREEFWN---------------- 317

Query: 561 IKLTKKEKELQEQEE---NLRVAEIIQQSRMQSEDLQEK 596
            K+ ++EK+ Q +E+   +L+  E     +  +++L EK
Sbjct: 318 -KMNEEEKKRQAEEKEAYDLKQKEFESDRKRIADNLHEK 355


>gi|332843616|ref|XP_003314682.1| PREDICTED: microtubule-associated protein 1A isoform 1 [Pan
            troglodytes]
          Length = 2803

 Score = 45.1 bits (105), Expect = 0.086,   Method: Composition-based stats.
 Identities = 60/275 (21%), Positives = 116/275 (42%), Gaps = 27/275 (9%)

Query: 398  NAQEEKQRREQEAKEKADREKADK----EAKEKADREKADKDLQEKTPIKAEGDDFGLGL 453
            + + E  +++ +A E+  R+   K    E K+KA RE  DKDL+EK     + D      
Sbjct: 1395 HVKNEAVKQQDKALEQKGRDLEQKDTALEQKDKA-REPKDKDLEEKDKALEQKD------ 1447

Query: 454  PSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHT 513
              +P    K   +++   E KD+  + K+    + D   E + K  +  D +L       
Sbjct: 1448 -KIPEEKDKALEQKDTALEQKDKALEPKDKDLEQKDRVLEQKEKIPEEKDKALDQKVRSV 1506

Query: 514  KNETPAIPTAKAPP---AQAHKGIQDK-KPQDQREKPLASDIGVGESDYAGIKLTKKEKE 569
            +++ P    A+       Q  K  + K + Q+Q++K         E  Y    L +K++ 
Sbjct: 1507 EHKAPEDTVAEMKDRDLEQTDKAPEQKHQAQEQKDKVSEKKDQALEQKYWA--LGQKDEA 1564

Query: 570  LQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAKVFYRSYSP 629
            L   E+N++  E   Q++ Q   +QE      K  +  SP+++K   +K   +  ++ + 
Sbjct: 1565 L---EQNIQALEENHQTQEQESLVQEDKTRKPKMLEEKSPEKVKAMEEKLEALLEKTKA- 1620

Query: 630  VDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQW 664
                  G +ES        + +  Y+R  + + +W
Sbjct: 1621 -----LGLEESLVQEGRAREQEEKYWRGQDVVQEW 1650


>gi|73982668|ref|XP_863413.1| PREDICTED: similar to cortactin isoform b isoform 3 [Canis
           familiaris]
          Length = 504

 Score = 45.1 bits (105), Expect = 0.087,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 7/73 (9%)

Query: 396 RANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPS 455
           RAN +   + +EQE + KA+ EKA + AKE+ ++E+A + L E+   +A+        P+
Sbjct: 314 RANFENLAKEKEQEDRRKAEAEKAQRMAKERQEQEEARRQLHEQAQAQAQK-------PT 366

Query: 456 VPTHSVKLPPKEE 468
            P      P +E+
Sbjct: 367 PPASPTPQPAQEK 379


>gi|148240460|ref|YP_001225847.1| chromosome segregation ATPase [Synechococcus sp. WH 7803]
 gi|147848999|emb|CAK24550.1| Chromosome segregation ATPase [Synechococcus sp. WH 7803]
          Length = 1201

 Score = 45.1 bits (105), Expect = 0.088,   Method: Composition-based stats.
 Identities = 56/243 (23%), Positives = 101/243 (41%), Gaps = 40/243 (16%)

Query: 389 KQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKAD---REKADKDLQEKTPIKAE 445
           +Q  VLA   AQ E++R +Q  ++  D++  D +A E+ +   +E A K    +  +KA 
Sbjct: 248 RQELVLAYEAAQAERRRLQQRHQDLGDQDTRDSQALEEQETTLQEAATKLKTLQDNVKAL 307

Query: 446 GDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNS 505
           G+D  LG   V      L P+  ELE                   ++E ER      D  
Sbjct: 308 GEDQLLG---VQAELAGLDPENRELER-------------QAAQHQQEGERLQAVRHDLQ 351

Query: 506 LLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYA------ 559
              G+  +++E+  +    +  AQA +  +D +   +R +    ++      +       
Sbjct: 352 ARRGQIQSESESLRLSADPSGLAQAEQDCRDAEAAVERSRRQLGEVAGRSGTWIEEQRQR 411

Query: 560 -------GIKLTKKEKELQEQEENLRVAE----IIQQSRMQ--SED--LQEKAWDSYKEW 604
                   + L   ++E Q+ +E LR AE     ++Q R Q  +ED  +Q       +EW
Sbjct: 412 SSRRQQLQVSLAPLQEERQQLKERLRQAEERRLDLEQERDQDGAEDHKVQTLLAQLEQEW 471

Query: 605 KSL 607
           ++L
Sbjct: 472 QAL 474


>gi|149641589|ref|XP_001512120.1| PREDICTED: similar to C219-reactive peptide (FLJ39207)
            [Ornithorhynchus anatinus]
          Length = 2084

 Score = 45.1 bits (105), Expect = 0.089,   Method: Composition-based stats.
 Identities = 98/425 (23%), Positives = 167/425 (39%), Gaps = 76/425 (17%)

Query: 60   IVGPI---EQRLKKVSERYERVVSRDLTLVIEA-GLKDLKEVGDTLKRLAETGEVILSDK 115
            I+G I   EQ++K+  +  +    +++ L  EA GLKD      + K L ET +  L+DK
Sbjct: 1410 ILGKISEYEQKIKEAKKSVKETKKQNVNLSDEAAGLKD------SNKELEETNQK-LNDK 1462

Query: 116  SDRLLCRFMDMVETEDEHKINKQVRDALESAGFDLESTQENIRKVESALINNNMKDAFRF 175
             + LL     M+ETE E  + KQ  D +      LE  QE +      L +  + +    
Sbjct: 1463 MNNLLA----MLETEREQNLKKQ--DIILENQKTLEKLQEVV-----TLDSIELSEVQVA 1511

Query: 176  LELAQKSKETADSHIIEAIDVGTKLKENTPPTTFTSISKVLLKSNNMQDVVFTKIKEVVK 235
            L  A+ S+E   S +    +   KLKE           + LLK         +++ E +K
Sbjct: 1512 LNEAKMSEEKVKSDLRRTQEENAKLKET---------KEKLLKEAASWSEQHSELSEQIK 1562

Query: 236  KHVNAELGHRKLRGLAFDHTYFNDKLNQFLKEIKNHQKEYDESEKGSSKARYHAAYAHIY 295
             +  ++    +   LAF          + LK    H K+ D       K           
Sbjct: 1563 LYQKSQKDIEE--SLAFKENEI-----EVLKNCIMHLKQLDLGPDSEGKTDDEGNG---- 1611

Query: 296  WDLANDWVNGRVGDKSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRD-LASKVKA 354
            WD  +D  NG + D  +E  ++       + R+        +T   +K+ RD L SK+  
Sbjct: 1612 WDQGDDLANGELPDTRNEKTKSQIRQMMDVSRVK-------MTLTVVKEDRDHLQSKLTD 1664

Query: 355  DYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRRE-----QE 409
            +          R K E +     I  + N  S L+ A        Q  +Q+ E      +
Sbjct: 1665 EV-------SARHKLEEQ-----IKKLENDFSALQSAKAQKENECQTWQQKVEVLNELYQ 1712

Query: 410  AKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEE 469
             KE+A +++  +E  E+ ++E+          + A GD   L    V  +  ++   EEE
Sbjct: 1713 EKERALQKRLTQEEYERQEKEQK---------LSAAGDKAVLATEEVKIYKQRIQEMEEE 1763

Query: 470  LEEVK 474
             ++ +
Sbjct: 1764 FQKTE 1768


>gi|297700411|ref|XP_002827239.1| PREDICTED: LOW QUALITY PROTEIN: myosin-XVIIIa-like [Pongo abelii]
          Length = 2039

 Score = 45.1 bits (105), Expect = 0.089,   Method: Composition-based stats.
 Identities = 110/617 (17%), Positives = 250/617 (40%), Gaps = 79/617 (12%)

Query: 369  AETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKAD 428
             E RL Y       +FT +  Q          E+K   EQ+ K + +R   D +A +  +
Sbjct: 1369 GEWRLKYERAVREVDFTKKRLQQEF-------EDKLEVEQQNKRQLERRLGDLQA-DSEE 1420

Query: 429  REKADKDLQEKTP-IKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTE 487
             ++A + L++K   + AE  D  L L      + +L  K+   +    E  +  E    E
Sbjct: 1421 SQRALQQLKKKCQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDS---ELSQAHEEAQRE 1477

Query: 488  TDDREETERKNQDILDNSL-LAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKP 546
               RE+ +R+   +L  +  L  +   K+   A  T K    +A   +QD   Q+ +++ 
Sbjct: 1478 KLQREKLQREKDMLLAEAFSLKQQLEEKDMDIAGFTQKVVSLEAE--LQDISSQESKDEA 1535

Query: 547  LASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKS 606
              + +     D    K+  +E+EL EQ   +   ++++Q++++ E   E+   ++ +   
Sbjct: 1536 SLAKVKKQLRDLEA-KVKDQEEELDEQAGTI---QMLEQAKLRLEMEMERMRQTHSKEME 1591

Query: 607  LSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSP 666
               +E+++  Q   K   +    ++  Y+  Q+  +             ++     Q + 
Sbjct: 1592 SRDEEVEEARQSCQKKLKQMEVQLEEEYEDKQKVLREKRELEG------KLATLSDQVNR 1645

Query: 667  LGLMYEK---DELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGE----SSVR 719
                 EK    +L   +A+     ++  H ++N   +K  +  +   +E  E    ++V+
Sbjct: 1646 RDFESEKRLRKDLKRTKALLADAQLMLDH-LKNSAPSKREIAQLKNQLEESEFTCAAAVK 1704

Query: 720  ----------------------KHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKED-- 755
                                  K + E   S+ Q+    + N ++E       L+K+   
Sbjct: 1705 ARKAMEVEIEDLHLQIDDIAKAKTALEEQLSRLQREKNEIQNRLEEDQEDMNELMKKHKA 1764

Query: 756  --PKRGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLYTIISGSEKIL 813
               +  +  + ++D++++L++ NK   +++ KL+      +  ++     +++S  E  +
Sbjct: 1765 AVAQASRDLAQINDLQAQLEEANKEKQELQEKLQALQSQVEFLEQSMVDKSLVSRQEAKI 1824

Query: 814  QGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIK--EERYWTIYAFERSLKNQAH 871
            +          L+ + +F+ +  K  E        N  K  EER   I A  R  +    
Sbjct: 1825 R---------ELETRLEFERTQVKRLESLASRLKENMEKLTEERDQRIAAENREKEQNKR 1875

Query: 872  LNAEV----ERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIK 927
            L  ++    E +  LA++ ++++    EL+  L       E+ ++ + + ++  F+R I 
Sbjct: 1876 LQRQLRDTKEEMGELARKEAEASRKKHELEMDLESL----EAANQSLQADLKLAFKR-IG 1930

Query: 928  ELKSVIEADAKENPNPN 944
            +L++ IE + + + N +
Sbjct: 1931 DLQAAIEDEMESDENED 1947


>gi|42794779|ref|NP_976063.1| myosin-XVIIIa isoform b [Homo sapiens]
 gi|119571562|gb|EAW51177.1| hCG27198, isoform CRA_c [Homo sapiens]
 gi|119571564|gb|EAW51179.1| hCG27198, isoform CRA_c [Homo sapiens]
          Length = 2039

 Score = 45.1 bits (105), Expect = 0.089,   Method: Composition-based stats.
 Identities = 110/617 (17%), Positives = 250/617 (40%), Gaps = 79/617 (12%)

Query: 369  AETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKAD 428
             E RL Y       +FT +  Q          E+K   EQ+ K + +R   D +A +  +
Sbjct: 1369 GEWRLKYERAVREVDFTKKRLQQEF-------EDKLEVEQQNKRQLERRLGDLQA-DSEE 1420

Query: 429  REKADKDLQEKTP-IKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTE 487
             ++A + L++K   + AE  D  L L      + +L  K+   +    E  +  E    E
Sbjct: 1421 SQRALQQLKKKCQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDS---ELSQAHEEAQRE 1477

Query: 488  TDDREETERKNQDILDNSL-LAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKP 546
               RE+ +R+   +L  +  L  +   K+   A  T K    +A   +QD   Q+ +++ 
Sbjct: 1478 KLQREKLQREKDMLLAEAFSLKQQLEEKDMDIAGFTQKVVSLEAE--LQDISSQESKDEA 1535

Query: 547  LASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKS 606
              + +     D    K+  +E+EL EQ   +   ++++Q++++ E   E+   ++ +   
Sbjct: 1536 SLAKVKKQLRDLEA-KVKDQEEELDEQAGTI---QMLEQAKLRLEMEMERMRQTHSKEME 1591

Query: 607  LSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSP 666
               +E+++  Q   K   +    ++  Y+  Q+  +             ++     Q + 
Sbjct: 1592 SRDEEVEEARQSCQKKLKQMEVQLEEEYEDKQKVLREKRELEG------KLATLSDQVNR 1645

Query: 667  LGLMYEK---DELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGE----SSVR 719
                 EK    +L   +A+     ++  H ++N   +K  +  +   +E  E    ++V+
Sbjct: 1646 RDFESEKRLRKDLKRTKALLADAQLMLDH-LKNSAPSKREIAQLKNQLEESEFTCAAAVK 1704

Query: 720  ----------------------KHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKED-- 755
                                  K + E   S+ Q+    + N ++E       L+K+   
Sbjct: 1705 ARKAMEVEIEDLHLQIDDIAKAKTALEEQLSRLQREKNEIQNRLEEDQEDMNELMKKHKA 1764

Query: 756  --PKRGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLYTIISGSEKIL 813
               +  +  + ++D++++L++ NK   +++ KL+      +  ++     +++S  E  +
Sbjct: 1765 AVAQASRDLAQINDLQAQLEEANKEKQELQEKLQALQSQVEFLEQSMVDKSLVSRQEAKI 1824

Query: 814  QGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIK--EERYWTIYAFERSLKNQAH 871
            +          L+ + +F+ +  K  E        N  K  EER   I A  R  +    
Sbjct: 1825 R---------ELETRLEFERTQVKRLESLASRLKENMEKLTEERDQRIAAENREKEQNKR 1875

Query: 872  LNAEV----ERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIK 927
            L  ++    E +  LA++ ++++    EL+  L       E+ ++ + + ++  F+R I 
Sbjct: 1876 LQRQLRDTKEEMGELARKEAEASRKKHELEMDLESL----EAANQSLQADLKLAFKR-IG 1930

Query: 928  ELKSVIEADAKENPNPN 944
            +L++ IE + + + N +
Sbjct: 1931 DLQAAIEDEMESDENED 1947


>gi|310791460|gb|EFQ26987.1| hypothetical protein GLRG_02158 [Glomerella graminicola M1.001]
          Length = 826

 Score = 44.7 bits (104), Expect = 0.091,   Method: Composition-based stats.
 Identities = 23/60 (38%), Positives = 39/60 (65%), Gaps = 3/60 (5%)

Query: 389 KQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADR---EKADKDLQEKTPIKAE 445
           ++A   A   A+EE  R+ +E  ++  RE+AD++AKE+ADR   E+AD+  +E+   KA+
Sbjct: 390 RKAREEADRKAREEADRKAREEADRKAREEADRKAKEEADRKAKEEADRRAKEEADRKAK 449


>gi|168704364|ref|ZP_02736641.1| possible large adhesin [Gemmata obscuriglobus UQM 2246]
          Length = 1494

 Score = 44.7 bits (104), Expect = 0.093,   Method: Composition-based stats.
 Identities = 48/193 (24%), Positives = 87/193 (45%), Gaps = 29/193 (15%)

Query: 389  KQATVLARANAQEEKQRREQEAKEKADR---EKADKEAKEKADREKADKDLQEKTPIKAE 445
            K+    A  + Q   ++++ +A++K D+   E+A KEA++  +  K+D D  ++   + +
Sbjct: 1145 KKEMADAMKDLQSGNEQQKADARKKLDKTFGEQARKEAEQFMNDLKSD-DKDKQAAAQQK 1203

Query: 446  GDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNS 505
             DDF   +              EE  +   E  KGKEP       +++   K Q++    
Sbjct: 1204 FDDFKKEMEKRAA---------EENAKKNGESGKGKEPIDDPNAQKDKESAKGQEL---- 1250

Query: 506  LLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTK 565
                   +K E  A+ T KA   Q+    +D+K ++Q EK L   IG    +    K+ +
Sbjct: 1251 -------SKEELDAL-TKKAQDLQS----KDQKTREQAEKELDDKIGKENRERLQEKMKE 1298

Query: 566  KEKELQEQEENLR 578
            ++    EQE+ LR
Sbjct: 1299 QQPGTPEQEQKLR 1311


>gi|168494051|ref|ZP_02718194.1| surface protein PspC [Streptococcus pneumoniae CDC3059-06]
 gi|183575967|gb|EDT96495.1| surface protein PspC [Streptococcus pneumoniae CDC3059-06]
          Length = 655

 Score = 44.7 bits (104), Expect = 0.093,   Method: Composition-based stats.
 Identities = 43/200 (21%), Positives = 87/200 (43%), Gaps = 8/200 (4%)

Query: 387 ELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEG 446
           E K+A        + ++++ E+EAK + D ++ D+ +K +  R K     ++ TP K E 
Sbjct: 213 ESKKAEATRLKKIKTDREKAEEEAKRRVDAKEQDESSKRRKSRVKRGDLGEQATPDKKEN 272

Query: 447 D----DFGLGLPSVPTHSVKLPPKEEELE-EVKDEGKKGKEPGTTETDDREETERKNQDI 501
           D    D  +G  ++P+ S+K   K  E E +V++  KK K     + +DR          
Sbjct: 273 DAKSSDSSVGEETLPSPSLKPGKKVAEAEKKVEEADKKAK---AQKEEDRRNYPTNTYKT 329

Query: 502 LDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGI 561
           L+  +       K     +   +A   +  + ++  K + + +K  A+ +   ++D    
Sbjct: 330 LELEIAESDVEVKKAELELVKEEAKEPRNEEKVKQAKAEVESKKAEATRLEKIKTDRKKA 389

Query: 562 KLTKKEKELQEQEENLRVAE 581
           +   K K  +E +   + AE
Sbjct: 390 EEEAKRKAAEEDKVKEKPAE 409


>gi|73982670|ref|XP_863432.1| PREDICTED: similar to cortactin isoform b isoform 4 [Canis
           familiaris]
          Length = 467

 Score = 44.7 bits (104), Expect = 0.094,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 7/73 (9%)

Query: 396 RANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPS 455
           RAN +   + +EQE + KA+ EKA + AKE+ ++E+A + L E+   +A+        P+
Sbjct: 277 RANFENLAKEKEQEDRRKAEAEKAQRMAKERQEQEEARRQLHEQAQAQAQK-------PT 329

Query: 456 VPTHSVKLPPKEE 468
            P      P +E+
Sbjct: 330 PPASPTPQPAQEK 342


>gi|297587661|ref|ZP_06946305.1| N-acetylmuramoyl-L-alanine amidase [Finegoldia magna ATCC 53516]
 gi|297574350|gb|EFH93070.1| N-acetylmuramoyl-L-alanine amidase [Finegoldia magna ATCC 53516]
          Length = 786

 Score = 44.7 bits (104), Expect = 0.095,   Method: Composition-based stats.
 Identities = 36/150 (24%), Positives = 66/150 (44%), Gaps = 24/150 (16%)

Query: 346 RDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQ----- 400
           +D+ +++ A Y      + ++   + +L Y   ANV N  +  K+   L R + +     
Sbjct: 34  KDVENELSAKYTSISTHNQSKLTKKAKLGY---ANVDNLQNGKKENDDLNREDLKSTDLN 90

Query: 401 ---EEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVP 457
              +EK+ + + +    D E+++KE   K   +K  ++  E +PIKAE            
Sbjct: 91  KHIKEKEEKTEVSDSTKDEEESEKEVVPKKSDKKDTEEGLEVSPIKAE------------ 138

Query: 458 THSVKLPPKEEELEEVKDEGKKGKEPGTTE 487
             SV     EE++ E K++   GKE    E
Sbjct: 139 -ESVSKENSEEQVSEEKEQEADGKEAQDEE 167


>gi|327293772|ref|XP_003231582.1| myosin type II heavy chain [Trichophyton rubrum CBS 118892]
 gi|326466210|gb|EGD91663.1| myosin type II heavy chain [Trichophyton rubrum CBS 118892]
          Length = 2407

 Score = 44.7 bits (104), Expect = 0.099,   Method: Composition-based stats.
 Identities = 67/279 (24%), Positives = 118/279 (42%), Gaps = 47/279 (16%)

Query: 310  KSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKA 369
            KS  W R    +   +G  TRT G      ++I+QL   A +        +I    R + 
Sbjct: 908  KSSPWWRLFATMKPLLGE-TRTAGEVKKRDEKIQQLEAKAQQ--------DIAEKQRIEE 958

Query: 370  ETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADR 429
            E R   + +  +   T E +++  L +    +  Q RE E  EK     AD+E+ E    
Sbjct: 959  ERRKIETEMQRIRK-TLESERSLALDKEEIFKRLQLREVELSEKLAGAIADQESLE---- 1013

Query: 430  EKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEE-VKDEGKKGKEPGTTET 488
            ++ D+ +  K  I+ E D     L        +L  +++EL+E + D  KK K   +T  
Sbjct: 1014 DQLDELIAAKKKIEHELDLRRGQLEQAAQIMERLEGEKKELQERISDMEKKLKSVESTHG 1073

Query: 489  DDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLA 548
            +  E+ E  NQ+I  N+L                       +H  ++DKK QD   K L+
Sbjct: 1074 EYDEKIEALNQEI--NTL----------------------NSHLAMKDKKLQDLEAKLLS 1109

Query: 549  SDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSR 587
            SD          ++L    KEL+  ++ ++  ++++++R
Sbjct: 1110 SD------QQLDLELANTTKELEGSKKQIK--QLLEENR 1140


>gi|159904884|ref|YP_001548546.1| methyl-accepting chemotaxis sensory transducer [Methanococcus
           maripaludis C6]
 gi|159886377|gb|ABX01314.1| methyl-accepting chemotaxis sensory transducer [Methanococcus
           maripaludis C6]
          Length = 731

 Score = 44.7 bits (104), Expect = 0.100,   Method: Composition-based stats.
 Identities = 58/208 (27%), Positives = 91/208 (43%), Gaps = 44/208 (21%)

Query: 2   NELATSIDYQTNNLDQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYIV 61
           N++A  I      LD DK+    +A TL  I   + HL E   +  +D N  K++   + 
Sbjct: 357 NKMAKDIKELHATLDTDKVV---LANTLKEIFGIMDHLAEGDFSIRADENREKNK---LQ 410

Query: 62  GPIEQRLKKVSERYERVVSRDLTLVIEAGLKDLKEVGDTLKRLAETGEVI---------- 111
             I   ++ VS+  E++ S    L +E G     +VGD LKR  ET E +          
Sbjct: 411 KTINHAIENVSKMMEKLKSEIALLNVELG-----DVGDGLKRAKETSEQVTDAANQVASA 465

Query: 112 -------LSDKSDRL--LCRFMDMVETEDEHKINKQVRDALESAGFDLESTQENIRKVES 162
                  L D SD L        MV  + E    K V  ALE      ++++  ++KVE+
Sbjct: 466 AADQSAKLQDTSDELEKTANAAGMVYADAE----KSVDSALEVK----DNSEMGVKKVEN 517

Query: 163 AL-----INNNMKDAFRFL-ELAQKSKE 184
           A+     I N + +  R + EL ++SK+
Sbjct: 518 AIDTMQKITNVIDELGRSIQELGEESKK 545


>gi|302808856|ref|XP_002986122.1| hypothetical protein SELMODRAFT_425092 [Selaginella moellendorffii]
 gi|300146270|gb|EFJ12941.1| hypothetical protein SELMODRAFT_425092 [Selaginella moellendorffii]
          Length = 1261

 Score = 44.7 bits (104), Expect = 0.10,   Method: Composition-based stats.
 Identities = 45/160 (28%), Positives = 75/160 (46%), Gaps = 23/160 (14%)

Query: 397 ANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSV 456
           ANA +E++ R + A+E+A R   D+  +EKA +EK +++ +++ PI+ E         +V
Sbjct: 359 ANAHKEQEAR-RLAEEEAKRILEDEAEREKATKEKQEQEARQERPIEME--------QTV 409

Query: 457 PTHSVKLPPKEEELEEVKDEGKKGK--EPGTTETDDREETER---KNQDILDNSLLAGKT 511
            T+    P  +E    ++D+  KGK  E    E      T R   ++ DI      AG  
Sbjct: 410 RTYEA--PVGQEFHGRMRDDKGKGKWEEARQWEALSSRGTGRARARSGDIPGWEARAG-- 465

Query: 512 HTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDI 551
              N  P +P    PP +  + +  +KP      P ASD+
Sbjct: 466 ---NRVPEVPFG-PPPVKIEEIMPPRKPTRMPHGP-ASDV 500


>gi|225871446|ref|YP_002747393.1| cell surface-anchored protein [Streptococcus equi subsp. equi 4047]
 gi|225700850|emb|CAW95581.1| putative cell surface-anchored protein [Streptococcus equi subsp.
           equi 4047]
          Length = 673

 Score = 44.7 bits (104), Expect = 0.11,   Method: Composition-based stats.
 Identities = 56/221 (25%), Positives = 105/221 (47%), Gaps = 25/221 (11%)

Query: 387 ELKQATVLA--RANAQEEKQRREQEAKEKADRE-KADKEAKEKADREKADKDLQEKTPIK 443
           +L+QA   A  RAN  E+ ++  +  KEK ++E K   EAK KA  E+  KDLQ+     
Sbjct: 294 QLEQANQQANQRANLAEKSKKDLETQKEKLEQEIKEATEAKNKA--EQKLKDLQDSA--- 348

Query: 444 AEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILD 503
           ++G +           S +L  ++EEL     E +K  E  TTE       E+  Q++  
Sbjct: 349 SQGSEL----------SKQLLKEKEELTTKLQELQKQAEEKTTEI------EKLKQELEA 392

Query: 504 NSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKL 563
           N   +G+   + +       K       K ++ K+ Q+Q ++      G G+SD +  ++
Sbjct: 393 NKQNSGQLGQQEQKLQEQLNKVQKELKQKEMELKQAQEQLKQEQKPHEGGGDSDASKARI 452

Query: 564 TKKEKELQE-QEENLRVAEIIQQSRMQSEDLQEKAWDSYKE 603
           T+ EK++Q   +E   ++  ++ ++ Q  + Q +  ++ K+
Sbjct: 453 TELEKQVQTLTKEKADLSSTLESTKAQLSETQARLSEAQKQ 493


>gi|158287823|ref|XP_001230640.2| AGAP010972-PA [Anopheles gambiae str. PEST]
 gi|157019374|gb|EAU77464.2| AGAP010972-PA [Anopheles gambiae str. PEST]
          Length = 356

 Score = 44.7 bits (104), Expect = 0.11,   Method: Composition-based stats.
 Identities = 38/140 (27%), Positives = 58/140 (41%), Gaps = 19/140 (13%)

Query: 404 QRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKL 463
           +R ++E  E   RE+  +E       E+   DL +        DD GL L   P HS  +
Sbjct: 5   KRIQEEINEVTRREQELREGHRTGTEERNGLDLNDDNLSSGNSDDSGLSLSPTPVHSPSV 64

Query: 464 PPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTK-NETPAIPT 522
              +++LE+       GKE   T    R E +++   IL +     KT T+   TP +  
Sbjct: 65  SNLKDKLEQ------NGKE---TAHQHRTEEQQRRAFILPSP----KTLTRARSTPQLFH 111

Query: 523 AKAPPAQ-----AHKGIQDK 537
              PP +      H+GI  K
Sbjct: 112 TSTPPRRFNPNPNHRGIMQK 131


>gi|301771554|ref|XP_002921193.1| PREDICTED: myosin-10-like [Ailuropoda melanoleuca]
          Length = 1976

 Score = 44.7 bits (104), Expect = 0.11,   Method: Composition-based stats.
 Identities = 66/283 (23%), Positives = 119/283 (42%), Gaps = 53/283 (18%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   E+L  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 976  AEAKIKKMEEEILLLEDQNS-----KFIKEKKLTEDRIAECSSQLAEEEEKAKNLAKIRN 1030

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTII-------SGSEK 811
            K E  +SD+   L+K  KT  ++ + K +L G   D+  +   L   I       +  E+
Sbjct: 1031 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKVQLAKKEE 1090

Query: 812  ILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERS 865
             LQG      D T    ++L V  +  +  ++L E F  +      K  R        ++
Sbjct: 1091 ELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFESE------KASR-------NKA 1137

Query: 866  LKNQAHLNAEVERLSGLAQQPSDSTADLKELQT-------QLSRAKKYKESNDERIVSFI 918
             K +  L+ E+E L    +   D+TA  +EL+T       +L +A + +  N E  +  +
Sbjct: 1138 EKQKRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEEETRNHEAQIQDM 1197

Query: 919  RSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQL 961
            R      ++EL   +E   +   N  KN++ L+   ++L  ++
Sbjct: 1198 RQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEV 1240


>gi|194766409|ref|XP_001965317.1| GF24515 [Drosophila ananassae]
 gi|190617927|gb|EDV33451.1| GF24515 [Drosophila ananassae]
          Length = 2196

 Score = 44.7 bits (104), Expect = 0.11,   Method: Composition-based stats.
 Identities = 38/149 (25%), Positives = 63/149 (42%), Gaps = 14/149 (9%)

Query: 400 QEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTH 459
           +EE  + E E + K D  KA+   KE     KA +  +EK+P +A+ D       +  T 
Sbjct: 345 EEEPAKVESETEVKDDAVKAEDSEKETEPEAKAGE--KEKSPAEADKD-------ASETE 395

Query: 460 SVKLPPKEEELEEVKDEGKKGKEPG--TTETDDR---EETERKNQDILDNSLLAGKTHTK 514
             K   ++ E+EE     + G+E    T E+      E  E+K+ +  D S+   +   K
Sbjct: 396 ESKASEEKMEVEEASIPAENGQEKAEITAESSPEKTPESEEKKSPEDKDKSVEVEEESAK 455

Query: 515 NETPAIPTAKAPPAQAHKGIQDKKPQDQR 543
            E    P A +      K   D K  +++
Sbjct: 456 MEVEEAPKADSEDKSPEKAESDAKESEEK 484


>gi|167525371|ref|XP_001747020.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163774315|gb|EDQ87944.1| predicted protein [Monosiga brevicollis MX1]
          Length = 652

 Score = 44.7 bits (104), Expect = 0.11,   Method: Composition-based stats.
 Identities = 56/232 (24%), Positives = 102/232 (43%), Gaps = 14/232 (6%)

Query: 368 KAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKA 427
           +A++  A +  +N AN T   +QA   A   A+EE  R+ +E  ++  +E+AD++AKE+A
Sbjct: 308 EAKSGPASTNESNAAN-TEADRQAKEEADRQAKEEADRQAKEEADRQAKEEADRQAKEEA 366

Query: 428 DR---EKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPG 484
           DR   E+AD+  +E+   +A+ ++      +      K     +  EE   + K+  +  
Sbjct: 367 DRQAKEEADRRAKEEADRQAK-EEADRQAKAEADRQAKAEADRQAKEEADRQAKEEADRQ 425

Query: 485 TTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPP-----AQAHKGIQDKKP 539
             E  DR+  E  ++   + +    K     +       +A       A+     Q K+ 
Sbjct: 426 AKEEADRQAKEEADRRAKEEADRQAKEEADRQAKEEADRRAKEEADRRAKEEADRQAKEE 485

Query: 540 QDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSE 591
            D+R K  A      E+D    +  K+E + Q +EE  R A+     R + E
Sbjct: 486 ADRRAKEEADRQAKEEAD----RQAKEEADRQAKEEADRRAKEEADRRAKEE 533


>gi|54633204|dbj|BAD66838.1| KIAA0216 splice variant 2 [Homo sapiens]
          Length = 1715

 Score = 44.7 bits (104), Expect = 0.12,   Method: Composition-based stats.
 Identities = 110/617 (17%), Positives = 250/617 (40%), Gaps = 79/617 (12%)

Query: 369  AETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKAD 428
             E RL Y       +FT +  Q          E+K   EQ+ K + +R   D +A +  +
Sbjct: 1045 GEWRLKYERAVREVDFTKKRLQQEF-------EDKLEVEQQNKRQLERRLGDLQA-DSEE 1096

Query: 429  REKADKDLQEKTP-IKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTE 487
             ++A + L++K   + AE  D  L L      + +L  K+   +    E  +  E    E
Sbjct: 1097 SQRALQQLKKKCQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDS---ELSQAHEEAQRE 1153

Query: 488  TDDREETERKNQDILDNSL-LAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKP 546
               RE+ +R+   +L  +  L  +   K+   A  T K    +A   +QD   Q+ +++ 
Sbjct: 1154 KLQREKLQREKDMLLAEAFSLKQQLEEKDMDIAGFTQKVVSLEAE--LQDISSQESKDEA 1211

Query: 547  LASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKS 606
              + +     D    K+  +E+EL EQ   +   ++++Q++++ E   E+   ++ +   
Sbjct: 1212 SLAKVKKQLRDLEA-KVKDQEEELDEQAGTI---QMLEQAKLRLEMEMERMRQTHSKEME 1267

Query: 607  LSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSP 666
               +E+++  Q   K   +    ++  Y+  Q+  +             ++     Q + 
Sbjct: 1268 SRDEEVEEARQSCQKKLKQMEVQLEEEYEDKQKVLREKRELEG------KLATLSDQVNR 1321

Query: 667  LGLMYEK---DELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGE----SSVR 719
                 EK    +L   +A+     ++  H ++N   +K  +  +   +E  E    ++V+
Sbjct: 1322 RDFESEKRLRKDLKRTKALLADAQLMLDH-LKNSAPSKREIAQLKNQLEESEFTCAAAVK 1380

Query: 720  ----------------------KHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKED-- 755
                                  K + E   S+ Q+    + N ++E       L+K+   
Sbjct: 1381 ARKAMEVEIEDLHLQIDDIAKAKTALEEQLSRLQREKNEIQNRLEEDQEDMNELMKKHKA 1440

Query: 756  --PKRGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLYTIISGSEKIL 813
               +  +  + ++D++++L++ NK   +++ KL+      +  ++     +++S  E  +
Sbjct: 1441 AVAQASRDLAQINDLQAQLEEANKEKQELQEKLQALQSQVEFLEQSMVDKSLVSRQEAKI 1500

Query: 814  QGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIK--EERYWTIYAFERSLKNQAH 871
            +          L+ + +F+ +  K  E        N  K  EER   I A  R  +    
Sbjct: 1501 R---------ELETRLEFERTQVKRLESLASRLKENMEKLTEERDQRIAAENREKEQNKR 1551

Query: 872  LNAEV----ERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIK 927
            L  ++    E +  LA++ ++++    EL+  L       E+ ++ + + ++  F+R I 
Sbjct: 1552 LQRQLRDTKEEMGELARKEAEASRKKHELEMDLESL----EAANQSLQADLKLAFKR-IG 1606

Query: 928  ELKSVIEADAKENPNPN 944
            +L++ IE + + + N +
Sbjct: 1607 DLQAAIEDEMESDENED 1623


>gi|289619547|emb|CBI53830.1| putative SMC2 protein [Sordaria macrospora]
          Length = 1179

 Score = 44.3 bits (103), Expect = 0.12,   Method: Composition-based stats.
 Identities = 59/246 (23%), Positives = 99/246 (40%), Gaps = 30/246 (12%)

Query: 340 DQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANA 399
           ++I  L D   +V+A     E+R G + +A        +   AN    L     L +++ 
Sbjct: 272 NEISHLEDDLKRVRAQRD-KELRKGGKAQA----LEEAVKKHANELVRLATVVDLKKSSM 326

Query: 400 QEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTH 459
           +EE++RR+   K  AD E A KE  +  ++ KA  D  ++               ++   
Sbjct: 327 KEEQERRKAGEKNVADLEAALKEKTKTYEKTKAKYDAAKE---------------ALEKQ 371

Query: 460 SVKLPPKEEELEEVKD--EGKKGKEPG----TTETDDREETERKNQDILDNSLLAGKTHT 513
             +   KEE L+ ++     K+G+E G      +  +R       Q+     +   +   
Sbjct: 372 RQEADTKEELLQTLQTGVASKEGQENGYQGQLQDARNRVTAAATEQEQAKIKIAHLEKRI 431

Query: 514 KNETPAIPTAKAPPAQAHKGIQDKKPQDQR-EKPLASDIGVGESDYAGIKLTKKEKELQE 572
           K E P    AK   A   K +   K Q QR EK L     +G    +  ++ K+E  LQ+
Sbjct: 432 KEEEPRAKKAKEQNAGLLKDLDGLKAQAQRLEKELGK---LGFQPGSEEEMYKQESSLQQ 488

Query: 573 QEENLR 578
              NLR
Sbjct: 489 TIRNLR 494


>gi|148239736|ref|YP_001225123.1| putative ATPase involved in DNA repair [Synechococcus sp. WH 7803]
 gi|147848275|emb|CAK23826.1| Putative ATPase involved in DNA repair [Synechococcus sp. WH 7803]
          Length = 894

 Score = 44.3 bits (103), Expect = 0.12,   Method: Composition-based stats.
 Identities = 56/242 (23%), Positives = 106/242 (43%), Gaps = 42/242 (17%)

Query: 400 QEEKQRREQEA---KEKADREKADKEAK-EKADREKA-DKDLQEKTPIKAEGDDFGLGLP 454
           QEE+QR++Q        A+ E  D+  +  + D EKA D+  Q+   +KA          
Sbjct: 279 QEEQQRKQQLKTLMSLDAETESTDRSIQAHRRDLEKAGDQVAQQSEQLKAR--------- 329

Query: 455 SVPTHSVKLPPKEEELEEVKDEG---KKGKEPGTTETDDREETERKNQDILDNSLLAGKT 511
                   L   EE+ + +++ G   ++ +E  T ET  R+  +R +   L   LLA + 
Sbjct: 330 -----QASLNALEEQRQALEERGHSLRRQQEIRTLETRIRDYQQRAD---LRARLLAQQG 381

Query: 512 HTKNETPAIPTAKAPPAQAHKGIQDK-KPQDQREKPLASDIGVGESDYA----GIKLTKK 566
             +N+  A P+  +    A +G Q++ +  + R   +AS I +  +D      G+ L + 
Sbjct: 382 SLQNKLAAAPSQTSEALSALQGWQERLRELEIRLNSMASSIHLEAADQEVVLDGVALPEG 441

Query: 567 EKELQEQEENLRVAE--IIQQS----------RMQSEDLQEKAWDSYKEWKSLSPDEIKQ 614
           +   +     L+V E  ++Q +            Q   LQ +  +  ++W + S +E K+
Sbjct: 442 QTLQRSGPFRLQVGEGVMVQVNPGEGTGIAALTTQRSQLQTQVNEGLRQWGAQSLEEAKE 501

Query: 615 RF 616
           +F
Sbjct: 502 QF 503


>gi|302686478|ref|XP_003032919.1| hypothetical protein SCHCODRAFT_67608 [Schizophyllum commune H4-8]
 gi|300106613|gb|EFI98016.1| hypothetical protein SCHCODRAFT_67608 [Schizophyllum commune H4-8]
          Length = 335

 Score = 44.3 bits (103), Expect = 0.12,   Method: Composition-based stats.
 Identities = 37/158 (23%), Positives = 72/158 (45%), Gaps = 12/158 (7%)

Query: 387 ELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEG 446
           + +++T   +   +EEK +R QE +EK   ++A K AKE+   ++A+  ++ K      G
Sbjct: 114 QFEESTEEVKPLTEEEKAQRLQELREKMAAKRAVK-AKEQEKEDRANDAIRRKA-----G 167

Query: 447 DDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSL 506
            D       +     +   + +  E+++D+  +       E D +   E+  +   + +L
Sbjct: 168 KDLNKIREELKVKEAQKEAEAKRREKIEDQKARAAIKAQIEADKKARAEKAAR---EKAL 224

Query: 507 LAGKTHTKNET-PAIPTAKAPPAQAHKGIQDKKPQDQR 543
             G+        P+ PTA A PAQA  G+  K  ++ R
Sbjct: 225 REGRPIVDTPAGPSAPTAAAKPAQA--GVAGKDYKETR 260


>gi|154318930|ref|XP_001558783.1| predicted protein [Botryotinia fuckeliana B05.10]
 gi|150857984|gb|EDN33176.1| predicted protein [Botryotinia fuckeliana B05.10]
          Length = 1278

 Score = 44.3 bits (103), Expect = 0.13,   Method: Composition-based stats.
 Identities = 61/197 (30%), Positives = 95/197 (48%), Gaps = 38/197 (19%)

Query: 399 AQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPT 458
           A+ EK+R E+E KE A R+K +KE +EK   EKADK  ++K   K   D  G   P  P 
Sbjct: 743 AKAEKERIEREKKEMAVRDKINKEREEK---EKADKIARDKIA-KDLKDKEGNKKPDTPQ 798

Query: 459 HSVKLPPKEEELEEVKDEGKKGKEPGT--TETDDREETERKNQDILDNSLLAGKTHTKNE 516
           +       E+ L ++K++  K K PG   ++T D E+     ++I +      K   + +
Sbjct: 799 NFA-----EDILNKIKNDILK-KVPGVYDSKTADAEKKNLGKKNINEYVKKFVKNFEEGD 852

Query: 517 TPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEEN 576
           T           + + G    KP+   EKP A      ESD A     KKE+E +E+ E 
Sbjct: 853 T----------RKENMGKGKDKPE---EKPPA------ESDAA-----KKEREKKERAE- 887

Query: 577 LRVAEIIQQSRMQSEDL 593
            +VA   ++ R++ E+L
Sbjct: 888 -KVARDAEELRVKKEEL 903


>gi|257066940|ref|YP_003153196.1| Cna B domain-containing protein [Anaerococcus prevotii DSM 20548]
 gi|256798820|gb|ACV29475.1| Cna B domain protein [Anaerococcus prevotii DSM 20548]
          Length = 4881

 Score = 44.3 bits (103), Expect = 0.13,   Method: Composition-based stats.
 Identities = 26/42 (61%), Positives = 30/42 (71%), Gaps = 5/42 (11%)

Query: 406 REQEAKEKADREK--ADKEAKEKADREKADKDLQEKTPIKAE 445
           REQEAKEK  R+K  A+KEAKEK D  KA   L+EK+P K E
Sbjct: 460 REQEAKEKEARDKLQAEKEAKEKEDLLKA---LKEKSPTKDE 498


>gi|328850549|gb|EGF99712.1| Hypothetical protein MELLADRAFT_94139 [Melampsora larici-populina
           98AG31]
          Length = 1765

 Score = 44.3 bits (103), Expect = 0.14,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 38/57 (66%), Gaps = 3/57 (5%)

Query: 386 SELKQATVLARANAQEEKQRREQEAK--EKADREKADKEAKEKADRE-KADKDLQEK 439
           +E K+     +A A+ E+QR+ +E K  E+  +EKAD+EAKE+A+++ KA  D  EK
Sbjct: 721 TEKKRVEAEQKAAAELEEQRKVEEQKRLEREAKEKADREAKEQAEKDAKAKSDQSEK 777


>gi|90082547|dbj|BAE90455.1| unnamed protein product [Macaca fascicularis]
          Length = 430

 Score = 44.3 bits (103), Expect = 0.14,   Method: Composition-based stats.
 Identities = 55/220 (25%), Positives = 95/220 (43%), Gaps = 46/220 (20%)

Query: 384 FTSELKQATVLARANAQEEKQRREQEAKE---KADREKADKEAKEKAD------------ 428
            TSEL+    + +A+ Q+  Q  E+E +E    A  E     AKE+++            
Sbjct: 237 LTSELQTQAHMIKADTQDAGQETEKEGEEPQASAQDETQIASAKEESESTAVGQAHSDIS 296

Query: 429 REKADKDLQEKT-PIKAEGDDFGLGLPSVPT---HSVKLPPKEEELEEVKDEGKKGKEPG 484
           ++ +D+ L+E   P + EGD  G G  SVP    H++ +   E+ L E K++ K G    
Sbjct: 297 KDMSDQQLEEVVLPSEEEGD--GAGTKSVPEDDGHALLVERIEKSLVEPKEDEKGG---- 350

Query: 485 TTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQRE 544
                D ++ E +N  ++D     G T    +T               G + K+ +D +E
Sbjct: 351 -----DVDDPENQNSALVDTDASGGLTKESPDT--------------NGPKQKEKEDAQE 391

Query: 545 KPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQ 584
                     ESD A    T+ ++E+Q+QE     +E+ +
Sbjct: 392 AEFQEGKVHSESDKA--ITTQAQEEVQKQERESAKSELTE 429


>gi|332158715|ref|YP_004423994.1| methyl-accepting chemotaxis protein [Pyrococcus sp. NA2]
 gi|331034178|gb|AEC51990.1| methyl-accepting chemotaxis protein [Pyrococcus sp. NA2]
          Length = 423

 Score = 44.3 bits (103), Expect = 0.14,   Method: Composition-based stats.
 Identities = 49/187 (26%), Positives = 88/187 (47%), Gaps = 27/187 (14%)

Query: 36  IKHLREFIIAWSSDLNPHKDRYDYIVGPIEQRLKKVSERYERVVSRDLTLVIEAGLKDLK 95
           I H  E  +A S DL  +K R       IE+R+ ++ E   R+ S DL++  +A   +L 
Sbjct: 41  INHRVEPKVAVSEDLEEYKAR-------IEKRIDEIGEILNRIASGDLSVEDKAISGELA 93

Query: 96  EVGDTLKRLAET-GEVILSDKSDRLLCRFMDMVETEDEHKINK---QVRDALESAGFDLE 151
            V + +++L ++  E+IL+ K+  +  R       E+  ++     QV +A+     + +
Sbjct: 94  RVREGIEKLRKSLSELILNIKNAAIDVRNHTKTIKENIDQVADSVAQVAEAINQVSMEAQ 153

Query: 152 STQENIRKVESAL--INNNMKDAFRFL--------ELAQKSKE------TADSHIIEAID 195
             QENI K+   +  IN+  K+    +        E+AQ +KE      TA + I E   
Sbjct: 154 REQENISKMTETMRYINDISKETVSTMEEFEASMREMAQLAKEGGEKGRTAATQIEEISR 213

Query: 196 VGTKLKE 202
           +  K++E
Sbjct: 214 MMAKIEE 220


>gi|325119387|emb|CBZ54940.1| putative AT hook motif-containing protein [Neospora caninum
           Liverpool]
          Length = 3801

 Score = 44.3 bits (103), Expect = 0.14,   Method: Composition-based stats.
 Identities = 53/232 (22%), Positives = 91/232 (39%), Gaps = 45/232 (19%)

Query: 397 ANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFG--LGLP 454
           +  +EEK+RR  EA+E     +A+ +A+ +++R  +D++   +     EG++ G   G P
Sbjct: 560 SEGREEKRRRVSEAQELRTGGEAEADARGESERGASDREGGSRETETLEGEEQGKDRGGP 619

Query: 455 SVPT-----------HSVKLPPKEEELEEVKDEGKKGKEPGTTETDDR----EETERKNQ 499
                           S++    +E+ E  KDE  KG+  G      R     +T R + 
Sbjct: 620 DASEAPREESATQAGRSLREGGPDEQSERAKDE--KGERRGLRSDGGRGSLGPKTARGDD 677

Query: 500 DILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASD--------I 551
           D        G  H    T      +AP A +  G  +   +   E  +A +         
Sbjct: 678 D--------GAQHGARRTEGAAAERAPVASSSAGASEMLVEGAGEGSVAGEPAEASGDRS 729

Query: 552 GVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKE 603
           G   SD  G++  ++E  L ++     VA          ED +E+AW    E
Sbjct: 730 GSSASDAVGVEGAERESSLTDKSA---VAH-------GDEDARERAWGGASE 771


>gi|195470194|ref|XP_002087393.1| GE16349 [Drosophila yakuba]
 gi|194173494|gb|EDW87105.1| GE16349 [Drosophila yakuba]
          Length = 5330

 Score = 44.3 bits (103), Expect = 0.14,   Method: Composition-based stats.
 Identities = 55/243 (22%), Positives = 101/243 (41%), Gaps = 25/243 (10%)

Query: 411  KEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEEL 470
            KEKA   K D+E  ++A  +K + D + K   + + D  G       +  +++  KE E 
Sbjct: 1671 KEKAPEPKKDEEKSDEATPDKLEGDEKPKAEDEPKKDSIGTEGKQSESSEMEVDSKEAEP 1730

Query: 471  EEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQA 530
            +  K   +  K     E DD  E   K     + S        K E  +  T +   +  
Sbjct: 1731 DASKKSDEDYKNEDKMEVDDEAEKSDKESKPEEQS-----ETVKPEEKSEATEEDKSSTV 1785

Query: 531  HKGIQDKKPQDQREK-------------PLASDIGVGESDYAGIKLTKKEKELQEQEENL 577
              G QDK+ +  +EK             P  ++    ESD   I  TK E+   E+++  
Sbjct: 1786 STGDQDKEAETVQEKMDVDEKEDDEKLPPSKAE----ESDEKSIDDTKPEEGTTEKDKES 1841

Query: 578  RVAEIIQQSRMQSED-LQEKAWDSYKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSYKG 636
              +E  ++S  + E+ + EK   S  + ++  P+ +    ++Y  V YR++S +   ++ 
Sbjct: 1842 LESEGEKESVKEGEESVTEKEEKSEADTEN-KPEPVFIDVEEYF-VKYRNFSYLHCEWRT 1899

Query: 637  TQE 639
             +E
Sbjct: 1900 EEE 1902


>gi|71733128|gb|AAZ40189.1| nonmuscle myosin II [Aplysia californica]
          Length = 1902

 Score = 44.3 bits (103), Expect = 0.14,   Method: Composition-based stats.
 Identities = 134/671 (19%), Positives = 268/671 (39%), Gaps = 105/671 (15%)

Query: 47   SSDLNPHKDRYDYIVGPIEQRLKKVSERYERVVSRDLTLVIEAGLKDLKEVGDTLKRLAE 106
            S  L   K++Y+ I+  +E+RL+K  E+  R     +   +E  L DL++  +  ++  E
Sbjct: 995  SKQLGKLKNKYEAIIADLEERLRK--EQQARQELEKIRRRLETELTDLRDQLNEKRQQVE 1052

Query: 107  TGEVILSDKSDRLLCRFMDMVETEDEHKINKQVRDALESAGFDLESTQENIRKVESALIN 166
              +  L+ + + +       +   D+ +++K              S Q+ +R+V      
Sbjct: 1053 DLQAQLAKREEEV----QSALRKADDEEVSKS-------------SFQKQMREV-----T 1090

Query: 167  NNMKDAFRFLELAQKSKETADSHIIEAIDVGTKLKENTPPTTFTSISKVLLKSNNMQDVV 226
            N +++    LE  ++++  A+    +  +    L+     +  T+ +   L++    +V 
Sbjct: 1091 NQLQEVMDDLETEKEARNKAEKQKRDLNEELEALRGELEDSLDTTAAVQELRNKREHEV- 1149

Query: 227  FTKIKEVVKKHVNAELGHRKLRGLAFDHTYFNDKLNQFLKEIKNHQKEYDESEKGSSKAR 286
              ++K +V+   +A+  H +  G+      +N ++ Q  +E++N +K     EK  +KA 
Sbjct: 1150 -QELKRMVE---SAQKAHEE--GVQETKQKYNQQVEQVSEELENVKKTKASLEK--AKAT 1201

Query: 287  YHAAYAHIYWDLANDWVNGRVGDKSDEWAR--TSTNIASWIGRITRTEGLGGVTYDQIKQ 344
              A       DLAND  + ++  +  E  R    + +A    ++   E   G + ++ K+
Sbjct: 1202 LEAETT----DLANDLKSVQMAKQESERKRKQAESQVAEMSLKLAELERTAGDSGEKSKK 1257

Query: 345  LRDLASKVKADYHWAEIR--HGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEE 402
            L+    +V +    AE +   G +  +      + + +     +  K A       AQ++
Sbjct: 1258 LQVEVEQVASQLEAAETKALQGQQKASSLEAQLADVQDTLQEETRQKLALQSKLRAAQDD 1317

Query: 403  KQRREQEAK---------EKADREKADK--EAKEKADREKADKDLQE------------- 438
            K+R E+  +         EK  +E + K  E K+KAD + A+ +  E             
Sbjct: 1318 KERLEERVEEEEENKRQYEKQMQEISQKLIEVKKKADEDMANNEALEEYKKKVAREMEQL 1377

Query: 439  -----------------KTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGK 481
                             K  ++AE DD  + L S  ++   +  K+ + +++  E K   
Sbjct: 1378 QQQLEESRIQSDRLEKSKRKLQAEVDDMTVELESQRSNVSNMDKKQRKFDQMLAEEKSVS 1437

Query: 482  EPGTTETDDRE-ETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQ------AHKGI 534
            E    E D  E E+  K   IL+   L  +   + +   +  AK   A+      + K  
Sbjct: 1438 ERLGLERDTAEKESREKETKILNLQRLLDELQERADQ--LDRAKQQQARELEDLISSKDD 1495

Query: 535  QDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEE-NLRVAEIIQQSRMQ---- 589
              K   D  +   + D  V E      ++   E ELQ  E+  LR+   +Q  R Q    
Sbjct: 1496 VGKNVHDLEKSKRSLDATVAEQRQ---QIEDLEDELQAAEDAKLRLEVNMQALRAQFERD 1552

Query: 590  ---SEDLQEKAWDS-YKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAIN 645
                ED +E+A  S  K+ + +  +   +R QK   V  R  + + G   G ++  +  N
Sbjct: 1553 AAGREDQEEEARKSLLKQLREMEAELEDERKQKAIAVNAR--NKLQGDLSGLEQQVEMAN 1610

Query: 646  HFLDNDFGYYR 656
               D+    Y+
Sbjct: 1611 KVKDDAVKQYK 1621


>gi|330802931|ref|XP_003289465.1| myosin II heavy chain [Dictyostelium purpureum]
 gi|325080466|gb|EGC34021.1| myosin II heavy chain [Dictyostelium purpureum]
          Length = 2116

 Score = 44.3 bits (103), Expect = 0.15,   Method: Composition-based stats.
 Identities = 33/102 (32%), Positives = 58/102 (56%), Gaps = 9/102 (8%)

Query: 869  QAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIKE 928
            +  L+AEV+    L ++     ++LK +  QL   KK KE++D+R     +++ E+E+ E
Sbjct: 1268 KGELDAEVKSKQALEKRRVTLESELKLVSEQLDEEKKQKETSDKR-----KADLEKEVAE 1322

Query: 929  LKSVI--EADAKENPNPNKNQK--KLQKTREKLVAQLSSRLK 966
            LK  I  E +AK++ N  KN+K  +L + + +    +SSR K
Sbjct: 1323 LKDQIDEEINAKKSVNEAKNKKESELDEIKRQYADVVSSRDK 1364


>gi|300812101|ref|ZP_07092549.1| ATP-dependent metallopeptidase HflB [Lactobacillus delbrueckii
           subsp. bulgaricus PB2003/044-T3-4]
 gi|300496940|gb|EFK32014.1| ATP-dependent metallopeptidase HflB [Lactobacillus delbrueckii
           subsp. bulgaricus PB2003/044-T3-4]
          Length = 737

 Score = 44.3 bits (103), Expect = 0.15,   Method: Composition-based stats.
 Identities = 46/150 (30%), Positives = 63/150 (42%), Gaps = 26/150 (17%)

Query: 362 RHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADK 421
           R  +R  AE  L Y T+        + KQ   L +     EK   E  ++ KA   +  K
Sbjct: 598 REKHRIIAEALLKYETL--------DEKQIYSLYKTGKMPEKSSEEFPSEAKALSYEEAK 649

Query: 422 EAKEKADREKADKDLQEK----TP----IKAEGDDFGLGLPSV------PTHSVKLP-PK 466
           EA +K   EKA++D  EK    TP    +K E D   L  P        P  S  LP P 
Sbjct: 650 EAAQKRAEEKAEEDTAEKQALATPSEDAVKPETDAAKLAEPDASASQEDPADS--LPTPS 707

Query: 467 EEELEEVKDEGKKGKEPGTTE-TDDREETE 495
           E +L +  ++G        TE TDD ++ E
Sbjct: 708 ESDLAKDPEKGDNDAPSQKTEQTDDSDKDE 737


>gi|46804962|dbj|BAD17825.1| hypothetical protein [Oryza sativa Japonica Group]
 gi|46804963|dbj|BAD17826.1| hypothetical protein [Oryza sativa Japonica Group]
 gi|125603692|gb|EAZ43017.1| hypothetical protein OsJ_27604 [Oryza sativa Japonica Group]
 gi|125603693|gb|EAZ43018.1| hypothetical protein OsJ_27605 [Oryza sativa Japonica Group]
          Length = 286

 Score = 44.3 bits (103), Expect = 0.15,   Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 33/59 (55%), Gaps = 8/59 (13%)

Query: 399 AQEEKQRR-------EQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFG 450
           AQEEK RR        QE  +KA REK DK  +E    + +D D +++  I+A GDD G
Sbjct: 208 AQEEKARRSYFEKATRQEEDDKAAREKDDKTTREDKSMKASDDDEKDRA-IRASGDDKG 265


>gi|150018623|ref|YP_001310877.1| methyl-accepting chemotaxis sensory transducer [Clostridium
           beijerinckii NCIMB 8052]
 gi|149905088|gb|ABR35921.1| methyl-accepting chemotaxis sensory transducer [Clostridium
           beijerinckii NCIMB 8052]
          Length = 563

 Score = 44.3 bits (103), Expect = 0.15,   Method: Composition-based stats.
 Identities = 76/353 (21%), Positives = 147/353 (41%), Gaps = 69/353 (19%)

Query: 3   ELATSIDYQTNNLDQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYIVG 62
           +L ++I+ +T    +D+I  ED+A ++  +Q+++K L   +   + D+N   D  +  V 
Sbjct: 225 DLTSNINIRT----KDEI--EDIAISIDKVQNSLKALINDVAIVAKDMNTVNDTVNDKVK 278

Query: 63  PIEQRLKKVSERYERVVS--RDLTLVIEAGLKDLKEVGDTLKRLAETGEVI------LSD 114
            +   +++VS   E + +   +  +  E   +  KE+G  +  +AE  + I      +S 
Sbjct: 279 YLNNDVEEVSAITEEISASIEESAVSAEEMSRTSKEIGIIVNSIAEKSQYIEKKSIQVSK 338

Query: 115 KSDRLLCRFMDMVETEDEHKINKQVRDALESAGFDLESTQENIRKVE------------S 162
           K+  +      MV ++D  +  ++V    +  G  L+ + E  + VE            +
Sbjct: 339 KAKNI------MVTSKDNQRETEKV---FKETGIKLKQSVEKAKAVEKINVLSESILQIT 389

Query: 163 ALIN----NNMKDAFRFLELAQKSKETADS--HIIEAIDVGTKLKENTPPTTFTSISKVL 216
           + IN    N   +A R  E  +     A+    + E  +      +NT     +S+  + 
Sbjct: 390 SQINLLALNAAIEAARAGEAGKGFSVVAEEIRRLAEQSNETINKMQNTTSIILSSVEDLT 449

Query: 217 LKSNNMQDVVFTKIKEVVKKHVNAELGHRKLRGLAFDHTYFNDKLNQFLKEIKNHQKEYD 276
             SNNM   +  +I +  +  VNA             H Y ND L         + KE+ 
Sbjct: 450 NNSNNMLSFMEDRILKDYETLVNAS------------HEYNNDAL---------YYKEF- 487

Query: 277 ESEKGSSKARYHAAYAHIYWDLANDWVNGRVGDKSDEWARTSTNIASWIGRIT 329
            SE G +      +  +I   + N      V D S+E A+ +++IA+ +  IT
Sbjct: 488 SSELGITSKELLLSVENILETIEN------VADASNEGAKGASDIANRVSNIT 534


>gi|325911029|gb|ADZ45243.1| pneumococcal surface protein C [Streptococcus pneumoniae]
          Length = 703

 Score = 44.3 bits (103), Expect = 0.15,   Method: Composition-based stats.
 Identities = 54/208 (25%), Positives = 96/208 (46%), Gaps = 45/208 (21%)

Query: 395 ARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLP 454
           A+A  + EK    +  K K DREKA++EAK +AD ++ D+  + K+ +K  GD   LG  
Sbjct: 214 AKAKVESEKAEATRLKKIKTDREKAEEEAKRRADAKEQDESKRRKSRVK-RGD---LGEQ 269

Query: 455 SVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTK 514
           + P                    KK  +  ++++   EET      +   SL  GK   +
Sbjct: 270 ATPD-------------------KKENDAKSSDSSVGEET------LPSPSLKPGKKVAE 304

Query: 515 NETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLAS----DIGVGESDYAGIKLTKKEKEL 570
            E            +A K  +D+K +D+R  P  +    ++ + ESD   +++ K E EL
Sbjct: 305 AEKKV--------EEAKKKAEDQKEEDRRNYPTNTYKTLELEIAESD---VEVKKAELEL 353

Query: 571 -QEQEENLRVAEIIQQSRMQSEDLQEKA 597
            +E+ +  R  E ++Q++ + E  + +A
Sbjct: 354 VKEEAKEPRNEEKVKQAKAEVESKKAEA 381


>gi|194385990|dbj|BAG65370.1| unnamed protein product [Homo sapiens]
          Length = 314

 Score = 44.3 bits (103), Expect = 0.15,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 46/97 (47%), Gaps = 14/97 (14%)

Query: 374 AYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKAD 433
           AY     V   TS+    T   RAN +   + +EQE + KA+ E+A + AKE+ ++E+A 
Sbjct: 17  AYQKTVPVEAVTSK----TSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEAR 72

Query: 434 KDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEEL 470
           + L+E+   K +           P  S    P EE L
Sbjct: 73  RKLEEQARAKTQ----------TPPVSPAPQPTEERL 99


>gi|296080746|ref|NP_001171669.1| src substrate cortactin isoform c [Homo sapiens]
 gi|21707902|gb|AAH33889.1| CTTN protein [Homo sapiens]
 gi|119595172|gb|EAW74766.1| cortactin, isoform CRA_a [Homo sapiens]
          Length = 634

 Score = 44.3 bits (103), Expect = 0.15,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 46/97 (47%), Gaps = 14/97 (14%)

Query: 374 AYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKAD 433
           AY     V   TS+    T   RAN +   + +EQE + KA+ E+A + AKE+ ++E+A 
Sbjct: 296 AYQKTVPVEAVTSK----TSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEAR 351

Query: 434 KDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEEL 470
           + L+E+   K +           P  S    P EE L
Sbjct: 352 RKLEEQARAKTQ----------TPPVSPAPQPTEERL 378


>gi|281204369|gb|EFA78565.1| pleckstrin domain-containing protein [Polysphondylium pallidum
           PN500]
          Length = 1086

 Score = 43.9 bits (102), Expect = 0.16,   Method: Composition-based stats.
 Identities = 22/41 (53%), Positives = 27/41 (65%)

Query: 389 KQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADR 429
           K A V      QEEK ++E++  EK  REKA KEA+EKADR
Sbjct: 623 KPAPVPRSPALQEEKDKQEKQDSEKQAREKARKEAEEKADR 663


>gi|159027403|emb|CAO86887.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 518

 Score = 43.9 bits (102), Expect = 0.16,   Method: Composition-based stats.
 Identities = 41/133 (30%), Positives = 69/133 (51%), Gaps = 14/133 (10%)

Query: 869  QAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIKE 928
            Q +LN +V  LS  A   S+  A+LK +QT L     Y  + +E+ +S  +S  ++ I E
Sbjct: 51   QTNLNLQVTTLSSDADPNSEEFANLKLMQTSLIGQDPYSTA-EEQYLSAQKSA-KKTITE 108

Query: 929  L-KSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKELNIDNAYGLWNEYKEDFKAS 987
            L KS +  + K++   + N  K  + R  L+     +  + ++D+A  +W + KE  K+ 
Sbjct: 109  LKKSAVSPEQKKSLERDINFLKDLELRLSLI-----QASQGDLDSARQIWQDIKE--KSE 161

Query: 988  FEYPLGTYEPAIL 1000
            FE     Y+PAIL
Sbjct: 162  FE----NYKPAIL 170


>gi|149720807|ref|XP_001488000.1| PREDICTED: ankyrin repeat domain 12 [Equus caballus]
          Length = 2055

 Score = 43.9 bits (102), Expect = 0.16,   Method: Composition-based stats.
 Identities = 59/225 (26%), Positives = 103/225 (45%), Gaps = 32/225 (14%)

Query: 387  ELKQATVLARANAQEEKQRR--EQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKA 444
            ++K  T + +A+ +E+ + +   +  KEK+DRE+   E+KE        K L EK P + 
Sbjct: 882  KIKNITAIKKADDREKSREKIERKHDKEKSDRERHVAESKE--------KHLMEKKPKQL 933

Query: 445  EGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDN 504
            +  D+        T S K   K+ E++  K E  + KE     T+ +   E K   I D+
Sbjct: 934  DNSDY--------TKSEKSKNKDREID--KKEKSREKE-SVNITNSKHFQEEKKSSIADS 982

Query: 505  S------LLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREK-PLASDIGV-GES 556
            S       L+ K  TK+E    P  K    +     + K+    ++K  L S + +  E+
Sbjct: 983  SKAQHEKTLSLKEKTKDEPLKTPDGKEKDKKDKDIDRYKERDKHKDKIQLNSLLKLKSEA 1042

Query: 557  DYAGIKLTKKEKELQEQEENLRVAEIIQQS--RMQS-EDLQEKAW 598
            D    K +   K+ + +E+ L   +++Q S  RM S +DL+ + W
Sbjct: 1043 DKPKPKSSPASKDTRPKEKRLVNDDLMQTSFERMLSLKDLEIEQW 1087


>gi|307263085|ref|ZP_07544707.1| Methyl-accepting chemotaxis protein [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|306871711|gb|EFN03433.1| Methyl-accepting chemotaxis protein [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 875

 Score = 43.9 bits (102), Expect = 0.16,   Method: Composition-based stats.
 Identities = 67/325 (20%), Positives = 123/325 (37%), Gaps = 56/325 (17%)

Query: 305 GRVGDKSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHG 364
           G  G  SD +A  S       G ITR +  G     +I ++ +    ++      EI   
Sbjct: 342 GLAGQASDFFANGSIQ-----GLITRVKAAGTELAGKISKIHEETKMLRMSAREQEI--- 393

Query: 365 NRFKAETRLAYSTIAN--------VANFTSELKQ--------ATVLARANAQEEKQRREQ 408
             +KA+   A   + N        +A    E +Q           ++ AN    K RREQ
Sbjct: 394 --YKAQQEGATQAVINAINAKHDEIAAIAKEKEQVKQAEAAKKKAISEANKAANKARREQ 451

Query: 409 E-AKEKADREKADKEAKEKADREKADKDL----QEKTPIKAEGDDFGLGLPSVPTHSVKL 463
           E A +KA RE      KE +++EK  + L    +E   +    + +G    +V  +++KL
Sbjct: 452 EAAAKKAQREAEQAAKKEASEQEKTKERLRALAEEYRKVTEAQNGYGRA-AAVNINALKL 510

Query: 464 PPK--EEELEEVKDEGKKGKEPGTTETDDREETER------------KNQDILDNSLLAG 509
                EE+  + ++      + GT   +  E                KN   +D ++ A 
Sbjct: 511 GANATEEQKRQAQELAGAIYDVGTAMANMNELAGNLSPTLKVDMDFAKNSATIDEAVTAY 570

Query: 510 KTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKE 569
           +         I T ++ P   +K   +K+ QD  +  +     + E++       +   +
Sbjct: 571 QNQLAKINSQISTVQSSPMSVNK---EKQMQDLEQAKVVYTQAITEAE-------QMRSQ 620

Query: 570 LQEQEENLRVAEIIQQSRMQSEDLQ 594
           ++EQ    R+A   ++ +  S   Q
Sbjct: 621 IEEQYRQQRIAAQWEEWKQASAATQ 645


>gi|32034627|ref|ZP_00134774.1| COG0840: Methyl-accepting chemotaxis protein [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
          Length = 875

 Score = 43.9 bits (102), Expect = 0.16,   Method: Composition-based stats.
 Identities = 67/325 (20%), Positives = 123/325 (37%), Gaps = 56/325 (17%)

Query: 305 GRVGDKSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHG 364
           G  G  SD +A  S       G ITR +  G     +I ++ +    ++      EI   
Sbjct: 342 GLAGQASDFFANGSIQ-----GLITRVKAAGTELAGKISKIHEETKMLRMSAREQEI--- 393

Query: 365 NRFKAETRLAYSTIAN--------VANFTSELKQ--------ATVLARANAQEEKQRREQ 408
             +KA+   A   + N        +A    E +Q           ++ AN    K RREQ
Sbjct: 394 --YKAQQEGATQAVINAINAKHDEIAAIAKEKEQVKQAEAAKKKAISEANKAANKARREQ 451

Query: 409 E-AKEKADREKADKEAKEKADREKADKDL----QEKTPIKAEGDDFGLGLPSVPTHSVKL 463
           E A +KA RE      KE +++EK  + L    +E   +    + +G    +V  +++KL
Sbjct: 452 EAAAKKAQREAEQAAKKEASEQEKTKERLRALAEEYRKVTEAQNGYGRA-AAVNINALKL 510

Query: 464 PPK--EEELEEVKDEGKKGKEPGTTETDDREETER------------KNQDILDNSLLAG 509
                EE+  + ++      + GT   +  E                KN   +D ++ A 
Sbjct: 511 GANATEEQKRQAQELAGAIYDVGTAMANMNELAGNLSPTLKVDMDFAKNSATIDEAVTAY 570

Query: 510 KTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKE 569
           +         I T ++ P   +K   +K+ QD  +  +     + E++       +   +
Sbjct: 571 QNQLAKINSQISTVQSSPMSVNK---EKQMQDLEQAKVVYTQAITEAE-------QMRSQ 620

Query: 570 LQEQEENLRVAEIIQQSRMQSEDLQ 594
           ++EQ    R+A   ++ +  S   Q
Sbjct: 621 IEEQYRQQRIAAQWEEWKQASAATQ 645


>gi|313204509|ref|YP_004043166.1| hypothetical protein Palpr_2044 [Paludibacter propionicigenes WB4]
 gi|312443825|gb|ADQ80181.1| hypothetical protein Palpr_2044 [Paludibacter propionicigenes WB4]
          Length = 503

 Score = 43.9 bits (102), Expect = 0.16,   Method: Composition-based stats.
 Identities = 36/148 (24%), Positives = 63/148 (42%), Gaps = 23/148 (15%)

Query: 616 FQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRI------HNFLSQWSPLGL 669
           F K       +++ V  +YK       AINH   ND   Y I      H+++ +   LG+
Sbjct: 226 FSKNTHELKETFAFVQSTYKDISSVLNAINHLRINDIAKYNIQVYEKMHSYIDEVGALGM 285

Query: 670 -MYEKDE-LHGVEAVYQKLDVLFRHCI----ENLRANKNAVDAMSKAVEAGESSVRKHSF 723
            + E ++ L     V QKLD++F   I    E +RA K AV  + + ++           
Sbjct: 286 HLREVNQYLSATSTVVQKLDMVFEREISQFDERIRAIKRAVGNIDEGIDRS--------- 336

Query: 724 EVLSSKHQKSVIAVNNFIKEITHHTRRL 751
             L++ +  + + ++ F+K   H   R 
Sbjct: 337 --LTALNTNTALHLDEFVKSSVHLNERF 362


>gi|310820718|ref|YP_003953076.1| hypothetical protein STAUR_3459 [Stigmatella aurantiaca DW4/3-1]
 gi|309393790|gb|ADO71249.1| uncharacterized protein [Stigmatella aurantiaca DW4/3-1]
          Length = 468

 Score = 43.9 bits (102), Expect = 0.17,   Method: Composition-based stats.
 Identities = 47/223 (21%), Positives = 96/223 (43%), Gaps = 14/223 (6%)

Query: 372 RLAYSTIANVANFTSELKQATVLARANAQEEKQ-RREQEAKEKADREKADKEAKEKADRE 430
           R A +  A     T   +Q T  A    Q E + +R+ EAK++ +  +A  EA++ A+ E
Sbjct: 187 REAQAKAAAQVEETRRREQETAAAEKQRQTEAEAKRQAEAKQREETARAQAEARKAAEDE 246

Query: 431 KADKDLQE-KTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETD 489
           +  +  +E +   +AE +            +      E E ++ + E  + +     E  
Sbjct: 247 EKRRQAEEAQAKRQAETEAKQRKQEEARAQAEARRTAEAEEKQRQKEEAEARRQAEVEAK 306

Query: 490 DREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQ-DQREKPL- 547
            R++ E + Q     S  A +T  + ET  + +A+ PPA+  +G     P    R K L 
Sbjct: 307 QRKQEEARAQAEARRSAQAEETRRQQETARVASAE-PPAREEQGDSAAAPGISARRKTLE 365

Query: 548 ---------ASDIGVGESDYAGIKLTKKEKELQEQEENLRVAE 581
                    +S + +  ++    K+++ ++E+  + EN ++ +
Sbjct: 366 IVGFQQRASSSRVYIRTNERVQYKVSQSDREIILELENTQIGK 408


>gi|123416744|ref|XP_001304962.1| eukaryotic initiation factor [Trichomonas vaginalis G3]
 gi|121886449|gb|EAX92032.1| eukaryotic initiation factor, putative [Trichomonas vaginalis G3]
          Length = 404

 Score = 43.9 bits (102), Expect = 0.18,   Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 30/38 (78%)

Query: 394 LARANAQEEKQRREQEAKEKADREKADKEAKEKADREK 431
           LA   A++E+QRR +E  E+  REKA++EA+EKA++E+
Sbjct: 248 LAAIEAEKERQRRAKERAEQRAREKAEREAREKAEKER 285


>gi|303251608|ref|ZP_07337782.1| hypothetical protein APP6_0811 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307252074|ref|ZP_07533973.1| Methyl-accepting chemotaxis protein [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|302649606|gb|EFL79788.1| hypothetical protein APP6_0811 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306860374|gb|EFM92388.1| Methyl-accepting chemotaxis protein [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
          Length = 875

 Score = 43.9 bits (102), Expect = 0.18,   Method: Composition-based stats.
 Identities = 67/325 (20%), Positives = 124/325 (38%), Gaps = 56/325 (17%)

Query: 305 GRVGDKSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHG 364
           G  G  SD +A  S       G ITR +  G     +I ++ +    ++      EI   
Sbjct: 342 GLAGQASDFFANGSIQ-----GLITRVKAAGTELAGKISKIHEETKMLRMSAREQEI--- 393

Query: 365 NRFKAETRLAYSTIAN--------VANFTSELKQ--------ATVLARANAQEEKQRREQ 408
             +KA+   A   + N        +A    E +Q           ++ AN    K RREQ
Sbjct: 394 --YKAQQEGATQAVINAINAKHDEIAAIAKEKEQVKQAEAAKKKAISEANKAANKARREQ 451

Query: 409 E-AKEKADREKADKEAKEKADREKADKDL----QEKTPIKAEGDDFGLGLPSVPTHSVKL 463
           E A +KA RE      KE +++EK  + L    +E   +    + +G    +V  +++KL
Sbjct: 452 EAAAKKAQREAEQAAKKEASEQEKTKERLRALAEEYRKVTEAQNGYGRA-AAVNINALKL 510

Query: 464 PPK--EEELEEVKDEGKKGKEPGTTETDDREETER------------KNQDILDNSLLAG 509
                EE+  + ++      + GT   +  E                KN   ++ ++ A 
Sbjct: 511 GANATEEQKRQAQELAGAIYDVGTAMANMNELAGNLSPTLKVDMDFAKNSATINEAVTAY 570

Query: 510 KTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKE 569
           +         I TA++ P   +K   +K+ QD  +  +     + E++       +   +
Sbjct: 571 QNQLAKINSQISTAQSSPMSVNK---EKQMQDLEQAKVVYTQAITEAE-------QMRSQ 620

Query: 570 LQEQEENLRVAEIIQQSRMQSEDLQ 594
           ++EQ    R+A   ++ +  S   Q
Sbjct: 621 IEEQYRQQRIAAQWEEWKQASAATQ 645


>gi|302670337|ref|YP_003830297.1| cell surface protein [Butyrivibrio proteoclasticus B316]
 gi|302394810|gb|ADL33715.1| cell surface protein [Butyrivibrio proteoclasticus B316]
          Length = 1070

 Score = 43.9 bits (102), Expect = 0.18,   Method: Composition-based stats.
 Identities = 63/250 (25%), Positives = 107/250 (42%), Gaps = 27/250 (10%)

Query: 338 TYDQIKQLRDLASKVKADYHWA-EIRHGNRFKAETRLAYSTIANVANFTSELKQAT---V 393
           T +  ++  D A+K +  Y  A +  +G   +A+  L  + + NV    S+L++AT    
Sbjct: 243 TKEAFEKALDEANKAQEAYLAAIDAANGKAAEAKKHLEEAQV-NVNKLNSDLEEATEALT 301

Query: 394 LARANAQEEK----QRREQEAKE------KADREKADKEAK----EKADREKADKDLQEK 439
           +AR NA+  K    QR+EQE KE      KA +E +D + K    EKA R KA+ +   K
Sbjct: 302 IARENAEAAKELDVQRKEQELKEATESSNKAKKELSDIKGKIKQAEKAKRAKAEAENDAK 361

Query: 440 TPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQ 499
              + + D    G  +    +  +   E++ +++ +E K   + GT    D ++ E   +
Sbjct: 362 NLAEEKKDTIKAGTQA----AADVKKAEDDAKKLAEEKKDTIKAGTQAAADVKKAEDDAK 417

Query: 500 DILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYA 559
            + +      K   K  T A    K     A K  ++KK   +     A D+   E    
Sbjct: 418 KLAEEK----KDTIKAGTQAAADVKKAEDDAKKLAEEKKDTIKEGTKAAQDVKDAEGKIT 473

Query: 560 GIKLTKKEKE 569
             +  K E E
Sbjct: 474 LAQNKKTELE 483


>gi|148256698|ref|YP_001241283.1| hypothetical protein BBta_5403 [Bradyrhizobium sp. BTAi1]
 gi|146408871|gb|ABQ37377.1| putative exported protein of unknown function [Bradyrhizobium sp.
           BTAi1]
          Length = 466

 Score = 43.9 bits (102), Expect = 0.18,   Method: Composition-based stats.
 Identities = 50/213 (23%), Positives = 90/213 (42%), Gaps = 17/213 (7%)

Query: 395 ARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLP 454
            RA  Q + + R  E K  A   K+D+EA ++ DR  ADK+ Q +   K    D   G  
Sbjct: 159 GRAEDQRKGEDRAAETKSGATERKSDREA-DRNDRNGADKNRQSQDERKPGTSDQAAGKQ 217

Query: 455 SVPTHSVKLPPKEEELE--EVKDEGKKGKEPGTTETDDREE--TERKN---QDILDNSLL 507
           +    S     +  +    +     ++ ++PG+T  D R++  T + N   Q   + S  
Sbjct: 218 ATDKQSTDRNKQANQPTGADKASTAQQNQQPGSTTADTRQQNATGQANNPAQPGANRSST 277

Query: 508 AGKTHTKNETPAIPTAKAPPA--QAHKGIQ------DKKPQDQREKPLASDIGVGESDYA 559
               + + +T  +   K      QA   +       ++ P+  R +PL SDI     +Y 
Sbjct: 278 QVSVNAQQKTRVVDQLKRDHDFDQARTNVDIRINVGERLPERVRPRPLPSDIVTIVPEYR 337

Query: 560 GIKLTKKEKELQEQEENLR-VAEIIQQSRMQSE 591
           G + T    E+   +   R + +II Q+ M+++
Sbjct: 338 GYEYTVVHDEIAIVDPRSREIVDIIPQNGMRAD 370


>gi|254584576|ref|XP_002497856.1| ZYRO0F15092p [Zygosaccharomyces rouxii]
 gi|238940749|emb|CAR28923.1| ZYRO0F15092p [Zygosaccharomyces rouxii]
          Length = 419

 Score = 43.9 bits (102), Expect = 0.18,   Method: Composition-based stats.
 Identities = 42/145 (28%), Positives = 55/145 (37%), Gaps = 20/145 (13%)

Query: 414 ADREKADKEAK--EKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELE 471
           A  +KA  E K  E+ D  K   D  +  P      D  LG P  PTHS + P  E   E
Sbjct: 255 AMEQKAQSEGKNVEELDEWKMLGDGGKSEP---PSHDESLGAPQRPTHSKEDPKPEGHSE 311

Query: 472 EVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAK---APPA 528
           E KD   +G  PG  +    E  E   ++           H     PA P  +     P 
Sbjct: 312 ESKDSKSEGL-PGRPKGGSEESKEGGPEE-----------HPGGSKPAGPPGEHKSESPD 359

Query: 529 QAHKGIQDKKPQDQREKPLASDIGV 553
           ++H G Q++  Q   E P     GV
Sbjct: 360 ESHNGAQEQPHQAPGEDPKDQKHGV 384


>gi|90022046|ref|YP_527873.1| electron transport complex protein RnfC [Saccharophagus degradans
           2-40]
 gi|89951646|gb|ABD81661.1| serine/threonine protein kinase [Saccharophagus degradans 2-40]
          Length = 745

 Score = 43.9 bits (102), Expect = 0.19,   Method: Composition-based stats.
 Identities = 62/244 (25%), Positives = 94/244 (38%), Gaps = 46/244 (18%)

Query: 397 ANAQEEKQ---------RREQ-------EAKEKADREKADKEAK----EKADREKADKDL 436
           ANA+ EK          R+E+       +  ++  R+KA +EAK    EKAD   A    
Sbjct: 439 ANAEREKSDKARVRFEFRQERIAKAEAEKEAKRLARKKAAEEAKKLLAEKADSPAA---A 495

Query: 437 QEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETER 496
            EKT  K              T   KL   E  L   +   ++ ++      D++EE + 
Sbjct: 496 NEKTTSKPGAAAAKPQAADPATQKAKL---ERALSSAQSRVERAQK---ALNDEQEEADE 549

Query: 497 KNQDILDNSLLAGKTHTKNETPAIPT-AKAPPAQ--AHKGIQDK---KPQDQREKPLASD 550
              D L   L   +         +    KAP       + I+DK    P+D+ EK LAS 
Sbjct: 550 ARLDSLRARLKQAELKASEAQAKLDEFGKAPEVTVGGEQAIKDKMAMSPRDKLEKNLAS- 608

Query: 551 IGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPD 610
                      +L+  ++ L E + N   A  +   +M  E LQ+K  D+ +E   L PD
Sbjct: 609 --------LNKRLSTAQERLAEAQAN--GAATVDALKMGVEKLQQKVNDAEQELAQLGPD 658

Query: 611 EIKQ 614
              Q
Sbjct: 659 SAAQ 662


>gi|2498955|sp|Q60598|SRC8_MOUSE RecName: Full=Src substrate cortactin
 gi|509495|gb|AAA19689.1| cortactin [Mus musculus]
          Length = 546

 Score = 43.9 bits (102), Expect = 0.19,   Method: Composition-based stats.
 Identities = 35/132 (26%), Positives = 60/132 (45%), Gaps = 11/132 (8%)

Query: 396 RANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPS 455
           RAN +   + REQE + KA+ E+A + AKE+ ++E+A + L+E+   K +        P+
Sbjct: 351 RANFENLAKEREQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKKQTP------PA 404

Query: 456 VPT-HSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTK 514
            P+   ++  P    + E  D      EP    ++   E   +   I +     G T+T 
Sbjct: 405 SPSPQPIEDRPPSSPIYE--DAAPFKAEPSYRGSEPEPEYSIEAAGIPEAGSQQGLTYTS 462

Query: 515 NETPAIPTAKAP 526
              P   T +AP
Sbjct: 463 E--PVYETTEAP 472


>gi|26351023|dbj|BAC39148.1| unnamed protein product [Mus musculus]
          Length = 509

 Score = 43.9 bits (102), Expect = 0.19,   Method: Composition-based stats.
 Identities = 35/132 (26%), Positives = 60/132 (45%), Gaps = 11/132 (8%)

Query: 396 RANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPS 455
           RAN +   + REQE + KA+ E+A + AKE+ ++E+A + L+E+   K +        P+
Sbjct: 314 RANFENLAKEREQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKKQTP------PA 367

Query: 456 VPT-HSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTK 514
            P+   ++  P    + E  D      EP    ++   E   +   I +     G T+T 
Sbjct: 368 SPSPQPIEDRPPSSPIYE--DAAPFKAEPSYRGSEPEPEYSIEAAGIPEAGSQQGLTYTS 425

Query: 515 NETPAIPTAKAP 526
              P   T +AP
Sbjct: 426 E--PVYETTEAP 435


>gi|15030315|gb|AAH11434.1| Cttn protein [Mus musculus]
 gi|74223237|dbj|BAE40752.1| unnamed protein product [Mus musculus]
 gi|74225117|dbj|BAE38252.1| unnamed protein product [Mus musculus]
 gi|148686299|gb|EDL18246.1| cortactin, isoform CRA_a [Mus musculus]
          Length = 509

 Score = 43.9 bits (102), Expect = 0.19,   Method: Composition-based stats.
 Identities = 35/132 (26%), Positives = 60/132 (45%), Gaps = 11/132 (8%)

Query: 396 RANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPS 455
           RAN +   + REQE + KA+ E+A + AKE+ ++E+A + L+E+   K +        P+
Sbjct: 314 RANFENLAKEREQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKKQTP------PA 367

Query: 456 VPT-HSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTK 514
            P+   ++  P    + E  D      EP    ++   E   +   I +     G T+T 
Sbjct: 368 SPSPQPIEDRPPSSPIYE--DAAPFKAEPSYRGSEPEPEYSIEAAGIPEAGSQQGLTYTS 425

Query: 515 NETPAIPTAKAP 526
              P   T +AP
Sbjct: 426 E--PVYETTEAP 435


>gi|439821|gb|AAB28755.1| cortactin, p80/p85 [mice, BALB/c 3T3 cells, Peptide, 546 aa]
          Length = 546

 Score = 43.9 bits (102), Expect = 0.19,   Method: Composition-based stats.
 Identities = 35/132 (26%), Positives = 60/132 (45%), Gaps = 11/132 (8%)

Query: 396 RANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPS 455
           RAN +   + REQE + KA+ E+A + AKE+ ++E+A + L+E+   K +        P+
Sbjct: 351 RANFENLAKEREQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKKQTP------PA 404

Query: 456 VPT-HSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTK 514
            P+   ++  P    + E  D      EP    ++   E   +   I +     G T+T 
Sbjct: 405 SPSPQPIEDRPPSSPIYE--DAAPFKAEPSYRGSEPEPEYSIEAAGIPEAGSQQGLTYTS 462

Query: 515 NETPAIPTAKAP 526
              P   T +AP
Sbjct: 463 E--PVYETTEAP 472


>gi|75677414|ref|NP_031829.2| src substrate cortactin [Mus musculus]
 gi|74147151|dbj|BAE27485.1| unnamed protein product [Mus musculus]
 gi|74195080|dbj|BAE28287.1| unnamed protein product [Mus musculus]
 gi|74219924|dbj|BAE40543.1| unnamed protein product [Mus musculus]
 gi|148686304|gb|EDL18251.1| cortactin, isoform CRA_e [Mus musculus]
          Length = 546

 Score = 43.9 bits (102), Expect = 0.19,   Method: Composition-based stats.
 Identities = 35/132 (26%), Positives = 60/132 (45%), Gaps = 11/132 (8%)

Query: 396 RANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPS 455
           RAN +   + REQE + KA+ E+A + AKE+ ++E+A + L+E+   K +        P+
Sbjct: 351 RANFENLAKEREQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKKQTP------PA 404

Query: 456 VPT-HSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTK 514
            P+   ++  P    + E  D      EP    ++   E   +   I +     G T+T 
Sbjct: 405 SPSPQPIEDRPPSSPIYE--DAAPFKAEPSYRGSEPEPEYSIEAAGIPEAGSQQGLTYTS 462

Query: 515 NETPAIPTAKAP 526
              P   T +AP
Sbjct: 463 E--PVYETTEAP 472


>gi|6469845|gb|AAF13455.1| unknown [Streptococcus pneumoniae]
          Length = 488

 Score = 43.9 bits (102), Expect = 0.20,   Method: Composition-based stats.
 Identities = 54/213 (25%), Positives = 99/213 (46%), Gaps = 40/213 (18%)

Query: 400 QEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTH 459
           + E    + +AK K+++ +A +  K K DRE+A+    E      E              
Sbjct: 192 RNEDTINQAKAKVKSEQAEATRLKKIKTDREQAEATRLENIKTDRE-------------- 237

Query: 460 SVKLPPKEEELEEVKDEGKKGKE---PGTTETDDREETERKNQD-------ILDNSLLAG 509
             +   ++ E EEVKD+ K+  +   PG   T D++E + K+ D       +   SL +G
Sbjct: 238 KAEEAKRKAEAEEVKDKLKRRTKRAVPGEPATPDKKENDAKSSDSSVGEETLPSPSLKSG 297

Query: 510 KTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLAS----DIGVGESDYAGIKLTK 565
           K         +  A+   A+A K  +D+K +D+R  P  +    D+ + ESD   +K+ +
Sbjct: 298 KK--------VAEAQKKVAEAEKKAKDQKEEDRRNYPTNTYKTLDLEIAESD---VKVKE 346

Query: 566 KEKEL-QEQEENLRVAEIIQQSRMQSEDLQEKA 597
            E EL +E+ +  R  E ++Q++ + E  + +A
Sbjct: 347 AELELVKEEAKESRNEEKVKQAKAKVESKKAEA 379


>gi|332199719|gb|EGJ13794.1| LPXTG-motif cell wall anchor domain protein [Streptococcus pneumoniae
            GA41317]
          Length = 947

 Score = 43.9 bits (102), Expect = 0.20,   Method: Composition-based stats.
 Identities = 55/224 (24%), Positives = 90/224 (40%), Gaps = 38/224 (16%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 19   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 70

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N + +Q+            LSS L +L  ++NA  +  
Sbjct: 71   DYYARDLENVETVIEKEDVET-NASNDQR----------VDLSSELDKLKKLENA-TVHM 118

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGDPSLMMDYEKVEPS 1038
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D     +     P 
Sbjct: 119  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSDGKQFYNNYNDAPL 175

Query: 1039 DVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSYVN 1082
             V  G              W         P    P+  V  YVN
Sbjct: 176  KVKPG-------------QWNSVTFTVEKPTAELPNGRVRLYVN 206


>gi|217039601|gb|ACJ76929.1| neuraminidase A [Streptococcus pneumoniae SP14-BS69]
          Length = 980

 Score = 43.9 bits (102), Expect = 0.20,   Method: Composition-based stats.
 Identities = 55/224 (24%), Positives = 90/224 (40%), Gaps = 38/224 (16%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 57   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 108

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N + +Q+            LSS L +L  ++NA  +  
Sbjct: 109  DYYARDLENVETVIEKEDVET-NASNDQR----------VDLSSELDKLKKLENA-TVHM 156

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGDPSLMMDYEKVEPS 1038
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D     +     P 
Sbjct: 157  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSDGKQFYNNYNDAPL 213

Query: 1039 DVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSYVN 1082
             V  G              W         P    P+  V  YVN
Sbjct: 214  KVKPG-------------QWNSVTFTVEKPTAELPNGRVRLYVN 244


>gi|194397355|ref|YP_002038305.1| neuraminidase A [Streptococcus pneumoniae G54]
 gi|194357022|gb|ACF55470.1| neuraminidase A [Streptococcus pneumoniae G54]
          Length = 942

 Score = 43.9 bits (102), Expect = 0.20,   Method: Composition-based stats.
 Identities = 55/224 (24%), Positives = 90/224 (40%), Gaps = 38/224 (16%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 19   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 70

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N + +Q+            LSS L +L  ++NA  +  
Sbjct: 71   DYYARDLENVETVIEKEDVET-NASNDQR----------VDLSSELDKLKKLENA-TVHM 118

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGDPSLMMDYEKVEPS 1038
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D     +     P 
Sbjct: 119  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSDGKQFYNNYNDAPL 175

Query: 1039 DVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSYVN 1082
             V  G              W         P    P+  V  YVN
Sbjct: 176  KVKPG-------------QWNSVTFTVEKPTAELPNGRVRLYVN 206


>gi|149001983|ref|ZP_01826937.1| sialidase A precursor [Streptococcus pneumoniae SP14-BS69]
 gi|149004299|ref|ZP_01829070.1| sialidase A precursor [Streptococcus pneumoniae SP14-BS69]
 gi|147757732|gb|EDK64747.1| sialidase A precursor [Streptococcus pneumoniae SP14-BS69]
 gi|147759792|gb|EDK66782.1| sialidase A precursor [Streptococcus pneumoniae SP14-BS69]
          Length = 942

 Score = 43.9 bits (102), Expect = 0.20,   Method: Composition-based stats.
 Identities = 55/224 (24%), Positives = 90/224 (40%), Gaps = 38/224 (16%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 19   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 70

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N + +Q+            LSS L +L  ++NA  +  
Sbjct: 71   DYYARDLENVETVIEKEDVET-NASNDQR----------VDLSSELDKLKKLENA-TVHM 118

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGDPSLMMDYEKVEPS 1038
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D     +     P 
Sbjct: 119  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSDGKQFYNNYNDAPL 175

Query: 1039 DVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSYVN 1082
             V  G              W         P    P+  V  YVN
Sbjct: 176  KVKPG-------------QWNSVTFTVEKPTAELPNGRVRLYVN 206


>gi|198476743|ref|XP_001357465.2| GA17619 [Drosophila pseudoobscura pseudoobscura]
 gi|198137832|gb|EAL34535.2| GA17619 [Drosophila pseudoobscura pseudoobscura]
          Length = 5605

 Score = 43.9 bits (102), Expect = 0.20,   Method: Composition-based stats.
 Identities = 39/165 (23%), Positives = 71/165 (43%), Gaps = 17/165 (10%)

Query: 368  KAETRLAYSTIANVANFTSELK-QATVLARANAQEEKQRREQEAKEKADREKADKEAKEK 426
            K+E     S        TS++K + T   +A +  EK+    +A+EK+   + D  A E 
Sbjct: 3658 KSEESETASVAEETEEDTSKIKDEDTDTVKAESSPEKEVLSADAEEKSSEAEKDASAAEV 3717

Query: 427  ADREKADKDLQE---KTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEP 483
             D  K+ +DL +     PI   G++         T S ++  ++  +E    E K+ K  
Sbjct: 3718 TDESKSSEDLAKMEVDEPIAENGEE------KEETTSPEVEAEDASIESTSAEEKEKKSK 3771

Query: 484  GTTETDDR-----EETERKNQDILDNSLLAGKTHTKNETPAIPTA 523
             + E  ++     EE E K   +    + A  T  K ++PA+ ++
Sbjct: 3772 ASEEAKEKPESVEEEMETKTSKMETEDVAA--TEEKAKSPAVESS 3814


>gi|300797856|ref|NP_001179297.1| desmoplakin [Bos taurus]
 gi|297489535|ref|XP_002697644.1| PREDICTED: desmoplakin [Bos taurus]
 gi|296473943|gb|DAA16058.1| desmoplakin [Bos taurus]
          Length = 2889

 Score = 43.9 bits (102), Expect = 0.20,   Method: Composition-based stats.
 Identities = 135/680 (19%), Positives = 263/680 (38%), Gaps = 106/680 (15%)

Query: 350  SKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQE 409
            +KV+A+Y    I   N+F+ E  +  +TI  +      L++    +   AQ +   RE  
Sbjct: 1359 AKVRANYDEEIISLKNQFETEINITKTTIHQLT-----LQKEEDTSGYRAQIDTLTRENR 1413

Query: 410  AKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEE 469
            +  +  +   +  A+      + ++++Q++   KA G +           S +    E E
Sbjct: 1414 SLSEEVKRLKNTLAQNTETLRRVEENVQQQ---KATGLEM----------SQRKQQLEVE 1460

Query: 470  LEEVKDEGKKGKEPGTTETDDREET-ERKNQDI-----LDNSLLAGKTHTKNETPAIPTA 523
            L +V     +         DD  +T + KN++I     L  +  + +   ++E   +  A
Sbjct: 1461 LRQVTQMRTEESARYKQSLDDAAKTIQDKNKEIDRLKQLIETEASQRKCLEDENARLQRA 1520

Query: 524  KAPPAQAHKG----IQDKKPQDQREKPLASDI-------GVGESDYAGIKLTKKEKELQE 572
            +    +AH      I   K Q+Q    L  D         V + D A  + + KE +LQ+
Sbjct: 1521 QGELQKAHSSATETISKLKVQEQELLRLRLDYERVSQERTVRDQDIARFQTSLKELQLQK 1580

Query: 573  Q--EENL----RVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAKVFYRS 626
            Q  EE L    R A      R + E+  E    + KE +++    + Q+ ++ + V  RS
Sbjct: 1581 QKAEEELARLKRAASEDSSKRKKLEEELEGMRRTLKE-QAIKVTSLTQQLEQASIVKKRS 1639

Query: 627  YSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSPLGLMYEKDELHGVEAVYQKL 686
               +       Q+ D    H  +                       +DEL  + +  + L
Sbjct: 1640 EDEL------RQQRDTLDGHLREKQ-------------------RTQDELRRLASEVEAL 1674

Query: 687  DVLFRHCIENLRANKNAVDAMSKAVEAGESSVRKHSFEVLSSKHQKSVIAVNNFIKEITH 746
                    E++R  +   +   KA+E    S+ +   E+   +     +   + + E   
Sbjct: 1675 RRQLLQEQESVRQAQTRNEHFQKAIEDKSRSLNESKIEIERLQSLTESLTKEHLMLEEEL 1734

Query: 747  HTRRLVKEDPKRGKSES------YLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQP 800
               RL  +D +RG+SE+       ++++R++LQ  N         L L G+  D+ +E+ 
Sbjct: 1735 RQLRLEYDDLQRGRSEADHDKNATIAELRNQLQISNNRT------LELQGLINDLQRERE 1788

Query: 801  PLYTIISGSEKILQGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWT---NNAIKEERYW 857
             L   I   +K            +L+  ++   S ++  ++     +      + E+   
Sbjct: 1789 NLRQEIERFQK-----------QALEASNRIQESKNQCTQVVQERESLLVKIKVLEQDKA 1837

Query: 858  TIYAFERSL-KNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKK------YKESN 910
             +   E  L + +  L AE      L  +      DL + +TQ SR ++       +   
Sbjct: 1838 RLQRLEEELSRAKTTLEAESRLKQRLECEKQQIQNDLNQWKTQYSRKEEAIRKIESEREK 1897

Query: 911  DERIVSFIRSEFEREIKELKSVIE-ADAKENPNPNKNQKKLQKTREKLVAQLSSRLKELN 969
             ER  + +RSE ER   E+K + E    K   +  + Q +L+  R +L  ++  RLK+  
Sbjct: 1898 SEREKNSLRSEIERLQAEIKRIEERCRRKLEDSSRETQSQLETERCRLQREI-DRLKQ-- 1954

Query: 970  IDNAYGLWNEYKEDFKASFE 989
                YG   E + +++ S +
Sbjct: 1955 --RPYGSHRETQTEYEWSVD 1972


>gi|328789632|ref|XP_396581.4| PREDICTED: RNA polymerase-associated protein CTR9 homolog [Apis
            mellifera]
          Length = 1255

 Score = 43.6 bits (101), Expect = 0.20,   Method: Composition-based stats.
 Identities = 48/212 (22%), Positives = 92/212 (43%), Gaps = 21/212 (9%)

Query: 363  HGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQ-RREQEAKEKADREKADK 421
            HG+R +   +LA +      +  S+ +     AR   +EEK  RR+QE + +A + +  +
Sbjct: 798  HGDRME---QLAEAEARRCQDLLSQAQYHVARARRLDEEEKMLRRKQEEERQAFKMRQTE 854

Query: 422  EAK--EKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEE-VKDEGK 478
            E +  E+  R+K ++ LQ++     E     L    +P+       K    ++ V D G 
Sbjct: 855  EQRKLEEMRRQKEEEMLQKRQEY-VEKTKNALVFGEMPSEKPGKKGKRVRTDQYVSDSGG 913

Query: 479  KGKEPGTTETDDREETERK-----------NQDILDNSLLAGKTHTKNETPAIPTAKAPP 527
             G+E G  E    ++ +RK            +      L +G++ ++++ P     +   
Sbjct: 914  SGREEGREEAPREKKRKRKASGERKERKGKGKGKRKKELASGESGSESDRPKPKRGRKGG 973

Query: 528  AQAHKGIQDKKPQDQREK-PLASD-IGVGESD 557
            A+  KG +    +  + K PL+ + I   ESD
Sbjct: 974  AKKDKGFRKSTSETTKGKMPLSKETISTSESD 1005


>gi|327303910|ref|XP_003236647.1| midasin [Trichophyton rubrum CBS 118892]
 gi|326461989|gb|EGD87442.1| midasin [Trichophyton rubrum CBS 118892]
          Length = 4925

 Score = 43.6 bits (101), Expect = 0.20,   Method: Composition-based stats.
 Identities = 47/198 (23%), Positives = 82/198 (41%), Gaps = 30/198 (15%)

Query: 386  SELKQATVLARANAQEEKQRREQEAKEKADRE----KADKEAKEKADREKADKDLQEKTP 441
            +E K+A      +A  E+++ ++ AK++AD E    ++D+EA E        +D+    P
Sbjct: 4212 NESKRAEKADDMSAATEQRKEDESAKKEADEEHETAESDEEAPEDEKEGAGREDMDVTDP 4271

Query: 442  IKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREET---ERKN 498
               E D   L LP                E++  +G+K ++ G+   D   E    E  N
Sbjct: 4272 YAQEND--VLDLP----------------EDMDLDGEKKEDEGSDVDDGMSEMSMEETAN 4313

Query: 499  QDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDY 558
            QD L          T+ E+P +  A+ P   A +  Q ++   + +     D   GE D 
Sbjct: 4314 QDDLPEDTNEENKETRPESPDVDMAENPDDNADEDGQREEETGEPDSEPQPD--AGEEDK 4371

Query: 559  AGIKLTKKEKELQEQEEN 576
               K+   E E Q+ + +
Sbjct: 4372 ---KIIPVEDEQQKADPD 4386


>gi|163867511|ref|YP_001608710.1| translation initiation factor IF-2 [Bartonella tribocorum CIP
           105476]
 gi|189028301|sp|A9IMT5|IF2_BART1 RecName: Full=Translation initiation factor IF-2
 gi|161017157|emb|CAK00715.1| translation initiation factor IF-2 [Bartonella tribocorum CIP
           105476]
          Length = 842

 Score = 43.6 bits (101), Expect = 0.21,   Method: Composition-based stats.
 Identities = 51/215 (23%), Positives = 92/215 (42%), Gaps = 30/215 (13%)

Query: 386 SELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADK-DLQEKTPIKA 444
           S L  A + AR  A EE        +EK  RE+A+KEA+   +RE+  K ++QE+  ++ 
Sbjct: 87  SNLSSAEMEARLRALEEAH-----IQEKITREQAEKEARLAKEREEILKQEIQEQEILQK 141

Query: 445 EGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDN 504
           + ++     P+VP  SV   P   E  ++    K        + D+ +E ER        
Sbjct: 142 QEEE----KPTVPISSVSSDPSLIEKTDIPIVPKNTTVIEKRKIDENQEEER-------- 189

Query: 505 SLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGV--GESDYAGIK 562
                  H++   PA    +AP  +  KG  +++           + G   G S  A  +
Sbjct: 190 -------HSRRANPAKSEIRAP--KIVKGADERRRGKLTLNSALDEEGSARGRSMAAMRR 240

Query: 563 LTKKEKELQEQEENLRVA-EIIQQSRMQSEDLQEK 596
             +K K  Q QE   +++ E++    +  ++L ++
Sbjct: 241 RQEKFKRAQNQEPREKISREVVLPETITIQELAQR 275


>gi|125526306|gb|EAY74420.1| hypothetical protein OsI_02309 [Oryza sativa Indica Group]
          Length = 325

 Score = 43.6 bits (101), Expect = 0.21,   Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 33/59 (55%), Gaps = 8/59 (13%)

Query: 399 AQEEKQRR-------EQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFG 450
           AQEEK RR        QE  +KA REK DK  +E    + +D D +++  I+A GDD G
Sbjct: 247 AQEEKARRSYFEKATRQEEDDKAAREKDDKTTREDKSMKASDDDEKDRA-IRASGDDKG 304


>gi|158341109|ref|YP_001522276.1| hypothetical protein AM1_E0193 [Acaryochloris marina MBIC11017]
 gi|158311350|gb|ABW32962.1| hypothetical protein AM1_E0193 [Acaryochloris marina MBIC11017]
          Length = 545

 Score = 43.6 bits (101), Expect = 0.21,   Method: Composition-based stats.
 Identities = 50/217 (23%), Positives = 91/217 (41%), Gaps = 59/217 (27%)

Query: 844  GDWTNNAIKEERYWTIYAFER---SLKN-----QAHLNAEVERLSGLAQQPS--DSTADL 893
            G++   A ++ R      F+R   ++KN     ++ L++  E +     QPS  D  A L
Sbjct: 216  GEYAQAAQEKMRNLAPQQFDRVSQTVKNTQDRMKSALDSATEAVQARLNQPSMKDRVAAL 275

Query: 894  KELQTQLSRAKKYKESNDERIVSFIRSEFEREIKELKSVI-------------EADAKE- 939
                          E++ ++I + I++EF  EIK+L+  +             +A A+E 
Sbjct: 276  --------------ETSTDQIRAAIKAEFATEIKDLQQTVSGLESNVAHLEQQQAKAQEM 321

Query: 940  -----NPNPNKNQKKLQKTREKLVAQLSSRLKEL------NIDNAYGLWNEYKEDFKASF 988
                  P P  +  +L + +  LV+ +  R +++       ID A    +E  E FK   
Sbjct: 322  IAALQAPKPQLSNPRLNQWQSNLVSAMKDRFEKIKQNLGEKIDQAKAKVSELFETFKQKV 381

Query: 989  EYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGD 1025
               L   +P I       DRL P+Y  ++ +++  GD
Sbjct: 382  RERL---QPVI-------DRLQPVYDQAQALKQQAGD 408


>gi|326504734|dbj|BAK06658.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 592

 Score = 43.6 bits (101), Expect = 0.21,   Method: Composition-based stats.
 Identities = 31/102 (30%), Positives = 47/102 (46%), Gaps = 5/102 (4%)

Query: 402 EKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSV-PTHS 460
           E + R +  +E  DRE    + KEKADREK  +  + +   K    D G     V     
Sbjct: 56  EDRERHRSGREHRDRE----DGKEKADREKVREKDEGRDREKVREKDGGRSREKVREKDE 111

Query: 461 VKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDIL 502
            + P K  E EE +D  K  ++ G+ + +   E ER+ +D L
Sbjct: 112 SRDPEKVREKEESRDREKVREKDGSRDREKVREKEREGRDRL 153


>gi|326523595|dbj|BAJ92968.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 592

 Score = 43.6 bits (101), Expect = 0.21,   Method: Composition-based stats.
 Identities = 31/102 (30%), Positives = 47/102 (46%), Gaps = 5/102 (4%)

Query: 402 EKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSV-PTHS 460
           E + R +  +E  DRE    + KEKADREK  +  + +   K    D G     V     
Sbjct: 56  EDRERHRSGREHRDRE----DGKEKADREKVREKDEGRDREKVREKDGGRSREKVREKDE 111

Query: 461 VKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDIL 502
            + P K  E EE +D  K  ++ G+ + +   E ER+ +D L
Sbjct: 112 SRDPEKVREKEESRDREKVREKDGSRDREKVREKEREGRDRL 153


>gi|326494786|dbj|BAJ94512.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 592

 Score = 43.6 bits (101), Expect = 0.21,   Method: Composition-based stats.
 Identities = 31/102 (30%), Positives = 47/102 (46%), Gaps = 5/102 (4%)

Query: 402 EKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSV-PTHS 460
           E + R +  +E  DRE    + KEKADREK  +  + +   K    D G     V     
Sbjct: 56  EDRERHRSGREHRDRE----DGKEKADREKVREKDEGRDREKVREKDGGRSREKVREKDE 111

Query: 461 VKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDIL 502
            + P K  E EE +D  K  ++ G+ + +   E ER+ +D L
Sbjct: 112 SRDPEKVREKEESRDREKVREKDGSRDREKVREKEREGRDRL 153


>gi|56159917|gb|AAV80770.1| SP-A receptor subunit SP-R210 alphaS [Homo sapiens]
          Length = 1581

 Score = 43.6 bits (101), Expect = 0.21,   Method: Composition-based stats.
 Identities = 110/617 (17%), Positives = 250/617 (40%), Gaps = 79/617 (12%)

Query: 369  AETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKAD 428
             E RL Y       +FT +  Q          E+K   EQ+ K + +R   D +A +  +
Sbjct: 911  GEWRLKYERAVREVDFTKKRLQQEF-------EDKLEVEQQNKRQLERRLGDLQA-DSEE 962

Query: 429  REKADKDLQEKTP-IKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTE 487
             ++A + L++K   + AE  D  L L      + +L  K+   +    E  +  E    E
Sbjct: 963  SQRALQQLKKKCQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDS---ELSQAHEEAQRE 1019

Query: 488  TDDREETERKNQDILDNSL-LAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKP 546
               RE+ +R+   +L  +  L  +   K+   A  T K    +A   +QD   Q+ +++ 
Sbjct: 1020 KLQREKLQREKDMLLAEAFSLKQQLEEKDMDIAGFTQKVVSLEAE--LQDISSQESKDEA 1077

Query: 547  LASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKS 606
              + +     D    K+  +E+EL EQ   +   ++++Q++++ E   E+   ++ +   
Sbjct: 1078 SLAKVKKQLRDLEA-KVKDQEEELDEQAGTI---QMLEQAKLRLEMEMERMRQTHSKEME 1133

Query: 607  LSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSP 666
               +E+++  Q   K   +    ++  Y+  Q+  +             ++     Q + 
Sbjct: 1134 SRDEEVEEARQSCQKKLKQMEVQLEEEYEDKQKVLREKRELEG------KLATLSDQVNR 1187

Query: 667  LGLMYEK---DELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGE----SSVR 719
                 EK    +L   +A+     ++  H ++N   +K  +  +   +E  E    ++V+
Sbjct: 1188 RDFESEKRLRKDLKRTKALLADAQLMLDH-LKNSAPSKREIAQLKNQLEESEFTCAAAVK 1246

Query: 720  ----------------------KHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKED-- 755
                                  K + E   S+ Q+    + N ++E       L+K+   
Sbjct: 1247 ARKAMEVEIEDLHLQIDDIAKAKTALEEQLSRLQREKNEIQNRLEEDQEDMNELMKKHKA 1306

Query: 756  --PKRGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLYTIISGSEKIL 813
               +  +  + ++D++++L++ NK   +++ KL+      +  ++     +++S  E  +
Sbjct: 1307 AVAQASRDLAQINDLQAQLEEANKEKQELQEKLQALQSQVEFLEQSMVDKSLVSRQEAKI 1366

Query: 814  QGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIK--EERYWTIYAFERSLKNQAH 871
            +          L+ + +F+ +  K  E        N  K  EER   I A  R  +    
Sbjct: 1367 R---------ELETRLEFERTQVKRLESLASRLKENMEKLTEERDQRIAAENREKEQNKR 1417

Query: 872  LNAEV----ERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIK 927
            L  ++    E +  LA++ ++++    EL+  L       E+ ++ + + ++  F+R I 
Sbjct: 1418 LQRQLRDTKEEMGELARKEAEASRKKHELEMDLESL----EAANQSLQADLKLAFKR-IG 1472

Query: 928  ELKSVIEADAKENPNPN 944
            +L++ IE + + + N +
Sbjct: 1473 DLQAAIEDEMESDENED 1489


>gi|71415731|ref|XP_809922.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gi|70874377|gb|EAN88071.1| hypothetical protein, conserved [Trypanosoma cruzi]
          Length = 670

 Score = 43.6 bits (101), Expect = 0.22,   Method: Composition-based stats.
 Identities = 60/301 (19%), Positives = 116/301 (38%), Gaps = 49/301 (16%)

Query: 357 HWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADR 416
           H AE     R +AE   A    A          +     +  A+EE +RR Q  +E   R
Sbjct: 102 HQAEEEAAKRHQAEEEAAKRRQAEEEAEKRHQAEEEAAKKHQAEEEAERRRQAEEEAEKR 161

Query: 417 EKADKEA-------KEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEE 469
            +A++EA       +E A R +A+++ +++   + E                    K  +
Sbjct: 162 RQAEEEAEKRRQAEEEAAKRRQAEEEAEKRHQAEEEA------------------AKRHQ 203

Query: 470 LEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQ 529
            EE  ++ ++ +E         EE E++ Q              + E      A+   A+
Sbjct: 204 AEEEAEKRRQAEEEAEKRHQAEEEAEKRRQ-------------AEEEAEKRRQAEEEAAK 250

Query: 530 AHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQ 589
            H+  ++ + + Q E+  A      E          K ++ +E+ E  R AE   + R Q
Sbjct: 251 RHQAEEEAEKRRQAEEEAAKRRQAEEE-------AAKRRQAEEEAEKRRQAEEEAEKRHQ 303

Query: 590 SEDLQEKAWDSYKEW--KSLSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHF 647
           +E+  EK   + +E   +  + +E  +R Q   +   R  +  +   +  ++S+K   +F
Sbjct: 304 AEEEAEKRRQAEEEAAKRHQAEEEAAKRHQAEEEAEKRRQAEEEAEKR--RQSEKDTQNF 361

Query: 648 L 648
           L
Sbjct: 362 L 362


>gi|261345161|ref|ZP_05972805.1| translation initiation factor IF-2 [Providencia rustigianii DSM
           4541]
 gi|282566852|gb|EFB72387.1| translation initiation factor IF-2 [Providencia rustigianii DSM
           4541]
          Length = 906

 Score = 43.6 bits (101), Expect = 0.22,   Method: Composition-based stats.
 Identities = 43/176 (24%), Positives = 71/176 (40%), Gaps = 29/176 (16%)

Query: 397 ANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSV 456
           A  +E +   ++EA+EKA RE ADK  +E A+REK  +    + P K    +        
Sbjct: 131 AAKREAEANAKREAEEKAKREAADKATREAAEREKVKQSENHQKPGKTNESNAEKQRREA 190

Query: 457 PTHSVKLPPKEEELEEVKDEGKKGKEPG-----------TTETDDREETE---------R 496
               +K   +EE   +V+ E ++  E             T ET   E+++         R
Sbjct: 191 EAAELKRKAEEETQRKVEAEARRVAEEARKMAEENGEKWTAETKTEEDSDYHTTTSTHAR 250

Query: 497 KNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIG 552
             +D  D      ++  +       TAKAP  +  KG +  +  D+ E+  A   G
Sbjct: 251 AAEDESDEKEEGRRSRNR-------TAKAP--RQKKGNKLSEKADREEERAAGRSG 297


>gi|168185389|ref|ZP_02620024.1| conserved hypothetical protein [Clostridium botulinum C str.
           Eklund]
 gi|169296249|gb|EDS78382.1| conserved hypothetical protein [Clostridium botulinum C str.
           Eklund]
          Length = 795

 Score = 43.6 bits (101), Expect = 0.22,   Method: Composition-based stats.
 Identities = 60/230 (26%), Positives = 98/230 (42%), Gaps = 35/230 (15%)

Query: 400 QEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTH 459
           Q EK+++ Q  K+K + E   KEA+EKA +E+  K+ +EK  IKAE              
Sbjct: 241 QVEKEKQAQAEKQK-EAEANQKEAQEKAKQEQLKKEQEEK--IKAE-------------- 283

Query: 460 SVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKN--ET 517
                 +EE+ ++VK E +K K+    E   REE ER  ++  +N L+    +  N    
Sbjct: 284 ------QEEKEKQVKMEAEKVKQ----EQKAREEAERIEKE--NNRLIEEAKNNINLGNL 331

Query: 518 PAIPTAKAPPAQAHKGIQDK-KPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEEN 576
             I +    P +A  G+Q   K  D+        + +  +D    K+T      ++   +
Sbjct: 332 TNIKSNLILPNKAANGVQITWKSSDESVIKNDGTVTIPSADKGDKKVTLTATFTKDSLTS 391

Query: 577 LRVAEII--QQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAKVFY 624
            +V E I   + ++QS DL +   D      SL  D          + FY
Sbjct: 392 TKVFEAIVKAEEKIQS-DLNKDTMDKEISINSLKKDSEGNYIANNQEEFY 440


>gi|147777785|emb|CAN75734.1| hypothetical protein VITISV_030148 [Vitis vinifera]
          Length = 1922

 Score = 43.6 bits (101), Expect = 0.22,   Method: Composition-based stats.
 Identities = 34/131 (25%), Positives = 56/131 (42%), Gaps = 20/131 (15%)

Query: 389  KQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDD 448
            K+   ++     E+K++R  + +E    EK   E +   D+E   +D QE +P K E   
Sbjct: 1600 KEEKSVSEGKQVEDKEKRPSDTEESEKEEKPYSEGRPVEDKEGICQDAQE-SPEKKE--- 1655

Query: 449  FGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLA 508
                     ++S     +E E EE K +   G+E    E  D EET+ +N +   N    
Sbjct: 1656 ---------SYS-----EEREPEESKRDSPSGEEANKEEQSDSEETQAENLE--SNPTDX 1699

Query: 509  GKTHTKNETPA 519
             K+  K   P+
Sbjct: 1700 DKSSKKTSDPS 1710


>gi|119571563|gb|EAW51178.1| hCG27198, isoform CRA_d [Homo sapiens]
          Length = 1581

 Score = 43.6 bits (101), Expect = 0.22,   Method: Composition-based stats.
 Identities = 110/617 (17%), Positives = 250/617 (40%), Gaps = 79/617 (12%)

Query: 369  AETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKAD 428
             E RL Y       +FT +  Q          E+K   EQ+ K + +R   D +A +  +
Sbjct: 911  GEWRLKYERAVREVDFTKKRLQQEF-------EDKLEVEQQNKRQLERRLGDLQA-DSEE 962

Query: 429  REKADKDLQEKTP-IKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTE 487
             ++A + L++K   + AE  D  L L      + +L  K+   +    E  +  E    E
Sbjct: 963  SQRALQQLKKKCQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDS---ELSQAHEEAQRE 1019

Query: 488  TDDREETERKNQDILDNSL-LAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKP 546
               RE+ +R+   +L  +  L  +   K+   A  T K    +A   +QD   Q+ +++ 
Sbjct: 1020 KLQREKLQREKDMLLAEAFSLKQQLEEKDMDIAGFTQKVVSLEAE--LQDISSQESKDEA 1077

Query: 547  LASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKS 606
              + +     D    K+  +E+EL EQ   +   ++++Q++++ E   E+   ++ +   
Sbjct: 1078 SLAKVKKQLRDLEA-KVKDQEEELDEQAGTI---QMLEQAKLRLEMEMERMRQTHSKEME 1133

Query: 607  LSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSP 666
               +E+++  Q   K   +    ++  Y+  Q+  +             ++     Q + 
Sbjct: 1134 SRDEEVEEARQSCQKKLKQMEVQLEEEYEDKQKVLREKRELEG------KLATLSDQVNR 1187

Query: 667  LGLMYEK---DELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGE----SSVR 719
                 EK    +L   +A+     ++  H ++N   +K  +  +   +E  E    ++V+
Sbjct: 1188 RDFESEKRLRKDLKRTKALLADAQLMLDH-LKNSAPSKREIAQLKNQLEESEFTCAAAVK 1246

Query: 720  ----------------------KHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKED-- 755
                                  K + E   S+ Q+    + N ++E       L+K+   
Sbjct: 1247 ARKAMEVEIEDLHLQIDDIAKAKTALEEQLSRLQREKNEIQNRLEEDQEDMNELMKKHKA 1306

Query: 756  --PKRGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLYTIISGSEKIL 813
               +  +  + ++D++++L++ NK   +++ KL+      +  ++     +++S  E  +
Sbjct: 1307 AVAQASRDLAQINDLQAQLEEANKEKQELQEKLQALQSQVEFLEQSMVDKSLVSRQEAKI 1366

Query: 814  QGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIK--EERYWTIYAFERSLKNQAH 871
            +          L+ + +F+ +  K  E        N  K  EER   I A  R  +    
Sbjct: 1367 R---------ELETRLEFERTQVKRLESLASRLKENMEKLTEERDQRIAAENREKEQNKR 1417

Query: 872  LNAEV----ERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIK 927
            L  ++    E +  LA++ ++++    EL+  L       E+ ++ + + ++  F+R I 
Sbjct: 1418 LQRQLRDTKEEMGELARKEAEASRKKHELEMDLESL----EAANQSLQADLKLAFKR-IG 1472

Query: 928  ELKSVIEADAKENPNPN 944
            +L++ IE + + + N +
Sbjct: 1473 DLQAAIEDEMESDENED 1489


>gi|332305366|ref|YP_004433217.1| FimV N-terminal domain protein [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332172695|gb|AEE21949.1| FimV N-terminal domain protein [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 1247

 Score = 43.6 bits (101), Expect = 0.22,   Method: Composition-based stats.
 Identities = 56/230 (24%), Positives = 97/230 (42%), Gaps = 24/230 (10%)

Query: 378 IANVANFTSELKQATVLARANAQEEKQRREQEAKEKADRE-KADKE--AKEKADREKADK 434
           +++  N + E +  + L R +A E +   E +    AD+   ADKE  A +    E+AD+
Sbjct: 664 LSDQVNESEEDENDSALERDDALETEGLPEADVAPAADKAPSADKEPSADKAPLSEQADE 723

Query: 435 DLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKE-PGTTETDDREE 493
             +++     E DD  L    VP         E +L    DE     E P + + D+ EE
Sbjct: 724 SEEDENDSALELDD-ALETEDVP---------EADLAPAADETLTADEAPLSEQADESEE 773

Query: 494 TERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGV 553
            E  +   LD++L   +T    E    P A   PA  ++   +K+P   +E     +   
Sbjct: 774 DENDSALELDDAL---ETEDVPEADVAPAADKEPAADNEPAANKEPSADKEPSAEQEPAA 830

Query: 554 GESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKE 603
            E+  A   L  ++ + +  E +  ++E       Q+++ QE   DS  E
Sbjct: 831 DETPMADEALLSEQADDETHENHESLSE-------QADESQEDENDSAME 873


>gi|312218658|emb|CBX98603.1| hypothetical protein [Leptosphaeria maculans]
          Length = 618

 Score = 43.6 bits (101), Expect = 0.22,   Method: Composition-based stats.
 Identities = 79/368 (21%), Positives = 145/368 (39%), Gaps = 64/368 (17%)

Query: 318 STNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYST 377
           +T + S    +   +GL     D+  +L+ +  +V            ++FKAE  L    
Sbjct: 274 NTLVTSKAALLAEADGLRNAVQDRQTKLQQVEQQVT-----------DKFKAELMLKAGE 322

Query: 378 IANVANFTSELKQATVLARANAQEEKQRREQEAKEK-ADREKADKEAKEKA--------- 427
           +A  A    +LK    L +ANA+  + R ++  KE  A  EK    A E A         
Sbjct: 323 VAKEAEKNMDLKSLIDLQKANAEIAQARADKLMKENGALNEKYRLLAAEHAHAFSKLNGQ 382

Query: 428 ------------DREKADKDLQEK----TPIKAEGDDFGLGLPSVPTHSVKLPPKEEELE 471
                        R+K + DL+++    + ++ +  +F    P+ P    KL     ELE
Sbjct: 383 TKRIDSLVMDLEQRQKENVDLKQQFSKLSELEKQHANFSQAKPAFPEEMKKL---SAELE 439

Query: 472 EVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHT-KNETPAIPTAKAPPAQA 530
           + +D+G + K        D ++  +K   +++     G+  T KN+  A        AQA
Sbjct: 440 KARDDGLRAKT-------DIDQLMKK---VIEFEKTTGRLETEKNDRLAQQIDAEKAAQA 489

Query: 531 HKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQS 590
              +Q +K ++ R K +  ++  G          ++  +L E+   L       ++ +  
Sbjct: 490 ---LQIQKLENLRLKEVIRELQNGSITGDPQMCVQENTQLLEKVRGLEAKSAALETAL-- 544

Query: 591 EDLQEKAWDSYKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQE--SDKAINHFL 648
           E+    A  SYKE+K + P        K A    +     DG+ K  ++  S    + + 
Sbjct: 545 EEWTHLAKRSYKEYKEMLP------LYKLADQCQKESLSKDGTIKDLKDQLSAAKASQYN 598

Query: 649 DNDFGYYR 656
             D GY++
Sbjct: 599 GGDTGYWK 606


>gi|299470407|emb|CBN80168.1| C2H2 zinc finger protein [Ectocarpus siliculosus]
          Length = 417

 Score = 43.6 bits (101), Expect = 0.22,   Method: Composition-based stats.
 Identities = 40/178 (22%), Positives = 70/178 (39%), Gaps = 35/178 (19%)

Query: 452 GLPSVPTHSVKLPPKEEELEEVKDEGKK---------GKEPGT--------------TET 488
           G+PS  +H    PP   E   V   G               GT              +E 
Sbjct: 190 GMPSCGSHKPSAPPPPVEDSGVAQGGHNCGAAVSGGGASTSGTPVARVCGACGKAFSSEQ 249

Query: 489 DDREETERKNQDIL--DNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKP 546
             R+  +R++ D++  D + LA K   KN++PA  T   PP +  +  +++    Q+++ 
Sbjct: 250 FLRKHMDRRHPDLVRQDTAPLAEKEEVKNDSPA-STPLPPPGEEARATEEQPSPPQQQEE 308

Query: 547 LASDIGVGESDYAG---------IKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQE 595
            A   G G  D  G         ++  ++  EL  + E+ R    +   R + +DL+E
Sbjct: 309 AAGGKGTGSEDKGGGENVIGSEVVEGARRLGELVREREHARFKLEVVALRREVQDLKE 366


>gi|229193819|ref|ZP_04320749.1| hypothetical protein bcere0002_54530 [Bacillus cereus ATCC 10876]
 gi|228589662|gb|EEK47551.1| hypothetical protein bcere0002_54530 [Bacillus cereus ATCC 10876]
          Length = 308

 Score = 43.6 bits (101), Expect = 0.23,   Method: Composition-based stats.
 Identities = 38/136 (27%), Positives = 63/136 (46%), Gaps = 12/136 (8%)

Query: 368 KAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKA 427
           KA+T++A S         ++ K+    A   AQEE QR+ QE   +  +E+AD +A+E+A
Sbjct: 96  KADTKVATSQDTKKDTADTKSKEE---ADRKAQEETQRKAQEEANRKAQEEADHKAQEEA 152

Query: 428 DR---EKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPG 484
           +R   E+A++  QE+   KA+ +       +  T        +EE +    E    K   
Sbjct: 153 NRKAQEEANRKAQEEANRKAQEE------ANRKTQEEANRKTQEETQRKAQEEANRKAQE 206

Query: 485 TTETDDREETERKNQD 500
                 +EE  RK Q+
Sbjct: 207 EANRKAQEEANRKAQE 222


>gi|109113818|ref|XP_001110924.1| PREDICTED: myosin-XVIIIa-like isoform 5 [Macaca mulatta]
          Length = 2039

 Score = 43.6 bits (101), Expect = 0.23,   Method: Composition-based stats.
 Identities = 110/617 (17%), Positives = 249/617 (40%), Gaps = 79/617 (12%)

Query: 369  AETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKAD 428
             E RL Y       +FT +  Q          E+K   EQ+ K + +R   D +A +  +
Sbjct: 1369 GEWRLKYERAVREVDFTKKRLQQEF-------EDKLEVEQQNKRQLERRLGDLQA-DSEE 1420

Query: 429  REKADKDLQEKTP-IKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTE 487
             ++A + L++K   + AE  D  L L      + +L  K+   +    E  +  E    E
Sbjct: 1421 SQRALQQLKKKCQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDS---ELSQAHEEAQRE 1477

Query: 488  TDDREETERKNQDILDNSL-LAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKP 546
               RE+ +R+   +L  +  L  +   K+   A  T K    +A   +QD   Q+ +++ 
Sbjct: 1478 KLQREKLQREKDMLLAEAFSLKQQLEEKDMDIAGFTQKVVSLEAE--LQDISSQESKDEA 1535

Query: 547  LASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKS 606
              + +     D    K+  +E+EL EQ   +   ++++Q++++ E   E+   ++ +   
Sbjct: 1536 SLAKVKKQLRDLEA-KVKDQEEELDEQAGTI---QMLEQAKLRLEMEMERMRQTHSKEME 1591

Query: 607  LSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSP 666
               +E+++  Q   K   +    ++  Y+  Q+  +             ++     Q + 
Sbjct: 1592 SRDEEVEEARQSCQKKLKQMEVQLEEEYEDKQKVLREKRELEG------KLATLSDQVNR 1645

Query: 667  LGLMYEK---DELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGE----SSVR 719
                 EK    +L   +A+     ++  H ++N   +K  +  +   +E  E    ++V+
Sbjct: 1646 RDFESEKRLRKDLKRTKALLADAQLMLDH-LKNSAPSKREIAQLKNQLEESEFTCAAAVK 1704

Query: 720  ----------------------KHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKED-- 755
                                  K   E   S+ Q+    + N ++E       L+K+   
Sbjct: 1705 ARKAMEVEIEDLHLQIDDIAKAKTVLEEQLSRLQREKNEIQNRLEEDQEDMNELMKKHKA 1764

Query: 756  --PKRGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLYTIISGSEKIL 813
               +  +  + ++D++++L++ NK   +++ KL+      +  ++     +++S  E  +
Sbjct: 1765 AVAQASRDLAQINDLQAQLEEANKEKQELQEKLQALQSQVEFLEQSMVDKSLVSRQEAKI 1824

Query: 814  QGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIK--EERYWTIYAFERSLKNQAH 871
            +          L+ + +F+ +  K  E        N  K  EER   I A  R  +    
Sbjct: 1825 R---------ELETRLEFERTQVKRLESLASRLKENMEKLTEERDQRIAAENREKEQNKR 1875

Query: 872  LNAEV----ERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIK 927
            L  ++    E +  LA++ ++++    EL+  L       E+ ++ + + ++  F+R I 
Sbjct: 1876 LQRQLRDTKEEMGELARKEAEASRKKHELEMDLESL----EAANQSLQADLKLAFKR-IG 1930

Query: 928  ELKSVIEADAKENPNPN 944
            +L++ IE + + + N +
Sbjct: 1931 DLQAAIEDEMESDENED 1947


>gi|154736698|gb|ABS84876.1| immunoglobulin G binding protein A [Staphylococcus aureus]
 gi|154736706|gb|ABS84880.1| immunoglobulin G binding protein A [Staphylococcus aureus]
          Length = 391

 Score = 43.6 bits (101), Expect = 0.23,   Method: Composition-based stats.
 Identities = 59/243 (24%), Positives = 92/243 (37%), Gaps = 50/243 (20%)

Query: 341 QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSE--------LKQAT 392
           + K+L D A   KAD         N+F  E + A+  I ++ N T E        LK   
Sbjct: 174 EAKKLND-AQAPKAD---------NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDP 223

Query: 393 VLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQE--KTPIKAEGDDFG 450
            +++    E K+  + +A ++ D  K  KE   K  +E  +K  +E  K P K +G+   
Sbjct: 224 SVSKEILAEAKKLNDAQAPKEEDNNKPGKEDNNKPGKEDGNKPGKEDNKKPGKEDGNK-- 281

Query: 451 LGLPSVPTHSVKLPPKEEELEEVKDEGKK-GKE---------PGTTETDDREETERKNQD 500
                        P KE+  +  K++G K GKE         PG T  D  +        
Sbjct: 282 -------------PGKEDGNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADK 328

Query: 501 ILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAG 560
           I  ++ LA K   K     +   K P   A        P+   E P      +G + + G
Sbjct: 329 IAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEENPF-----IGTTVFGG 383

Query: 561 IKL 563
           + L
Sbjct: 384 LSL 386


>gi|316971134|gb|EFV54962.1| putative ribosomal protein L3 [Trichinella spiralis]
          Length = 1311

 Score = 43.6 bits (101), Expect = 0.24,   Method: Composition-based stats.
 Identities = 39/149 (26%), Positives = 67/149 (44%), Gaps = 18/149 (12%)

Query: 377  TIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREK------ADKEAKEKADRE 430
            + A    F S+ +Q          E+K+R+  +A  KA  EK      + K+ K++    
Sbjct: 1083 STAEAGQFESQREQT---------EQKKRKADDALLKASGEKEKMQKISSKKGKDRTKGR 1133

Query: 431  KADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDD 490
              DK  QE   +   G + G  LPSV   +VK   + +++EE K     G+   +T +DD
Sbjct: 1134 DVDKVEQEGV-VHGNGSENGGSLPSV-HKTVKRRKRNKKVEEEK-LVHIGRGRSSTPSDD 1190

Query: 491  REETERKNQDILDNSLLAGKTHTKNETPA 519
              + +    D++++     K H KN+  A
Sbjct: 1191 ENDQQNVEADLINDDEEEIKLHKKNQNTA 1219


>gi|297798252|ref|XP_002867010.1| hypothetical protein ARALYDRAFT_328116 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297312846|gb|EFH43269.1| hypothetical protein ARALYDRAFT_328116 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 1396

 Score = 43.6 bits (101), Expect = 0.24,   Method: Composition-based stats.
 Identities = 60/258 (23%), Positives = 109/258 (42%), Gaps = 63/258 (24%)

Query: 344 QLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEK 403
           +L D   +++ +    E R         R A+    NV    + L+Q          EEK
Sbjct: 589 KLNDALKRMEEETRIKEARVKEENDRREREAFEKAENVKRLKAALEQ----------EEK 638

Query: 404 QRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKL 463
           +R+ +EA+EKA+ E+   EA EKA++E+  K+ QE                      ++L
Sbjct: 639 ERKIKEAREKAENERRAVEASEKAEQERKMKEQQE----------------------LEL 676

Query: 464 PPKEE-ELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPT 522
             KE  E EE     ++ +E    E + R   E++ +      +   +   +NE      
Sbjct: 677 RLKEAFEKEEKNRRMREAREKADHERNMRVALEQEKE----RRIKEAREKEENE------ 726

Query: 523 AKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVA-E 581
                    + I++ + + + E+ L + +   E +       ++ KE QE+EEN R A E
Sbjct: 727 ---------RRIKEAREKAELEQRLKATLEQEEKE-------RQIKECQEREENERRAKE 770

Query: 582 IIQQS---RMQSEDLQEK 596
           +++Q+   R   E L++K
Sbjct: 771 VLEQAENERKLKEALEQK 788


>gi|219113419|ref|XP_002186293.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|209583143|gb|ACI65763.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 997

 Score = 43.6 bits (101), Expect = 0.24,   Method: Composition-based stats.
 Identities = 27/83 (32%), Positives = 46/83 (55%), Gaps = 5/83 (6%)

Query: 389 KQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADR--EKADKDLQE---KTPIK 443
           +Q   +    AQ E+++R +EAK +A+RE+  +EAKE+  R  E AD++ +E   K+   
Sbjct: 677 RQGPNVEHEMAQAEEEKRNREAKGRAERERQAQEAKEQQRRAQEVADREAREILAKSNGA 736

Query: 444 AEGDDFGLGLPSVPTHSVKLPPK 466
            E  +    +  +P  SV  PP+
Sbjct: 737 NESSNQLKVMLGMPDQSVPSPPQ 759


>gi|149409598|ref|XP_001507265.1| PREDICTED: similar to p80/85 [Ornithorhynchus anatinus]
          Length = 462

 Score = 43.6 bits (101), Expect = 0.24,   Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 34/50 (68%)

Query: 396 RANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAE 445
           RAN +   + +EQE ++KA+ E+A + AKEK ++E+A K L+E+   K +
Sbjct: 259 RANFENLAKEKEQEDRKKAEAERAQRMAKEKQEQEEARKKLEEQAKAKKQ 308


>gi|62896785|dbj|BAD96333.1| cortactin isoform a variant [Homo sapiens]
          Length = 550

 Score = 43.6 bits (101), Expect = 0.24,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 46/97 (47%), Gaps = 14/97 (14%)

Query: 374 AYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKAD 433
           AY     V   TS+    T   RAN +   + +EQE + KA+ E+A + AKE+ ++E+A 
Sbjct: 333 AYQKTVPVEAVTSK----TSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEAR 388

Query: 434 KDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEEL 470
           K L+E+   K +           P  S    P EE L
Sbjct: 389 KKLEEQARAKTQ----------TPPVSPAPQPTEERL 415


>gi|154500878|ref|ZP_02038916.1| hypothetical protein BACCAP_04563 [Bacteroides capillosus ATCC
           29799]
 gi|150270378|gb|EDM97704.1| hypothetical protein BACCAP_04563 [Bacteroides capillosus ATCC
           29799]
          Length = 1098

 Score = 43.6 bits (101), Expect = 0.24,   Method: Composition-based stats.
 Identities = 66/300 (22%), Positives = 121/300 (40%), Gaps = 52/300 (17%)

Query: 326 GRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIAN----- 380
            R +  + +GGV   + + LR    K +A     E+     F+  T L    IAN     
Sbjct: 202 ARASVQQYIGGVVCREDEPLRARLEKAQA----GELP----FQETTELIRQLIANGREEE 253

Query: 381 ------VANFTSELKQATVLARANAQEEKQRREQEAKEKADREKAD----KEAKEKA--- 427
                 +    +ELK+ ++L     + E+ ++ +E  E A RE+A+     EA +KA   
Sbjct: 254 GDWQKVLDRLDAELKETSILL---GKAEEAQKNREKLELARRERAELVPQVEAAQKALQA 310

Query: 428 DREKADKD---------LQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGK 478
           + EKA +          L+ + P   E      GL +   H   L  K  E EE +  G 
Sbjct: 311 EMEKAPRQELLNQELGALEAELPRYQELSQREAGLAAQTEHIAALERKCREQEEAQRAGA 370

Query: 479 KGKEPGTTETDDREETERKNQDIL--DNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQD 536
           +  +    E +     E + + +L   N   + K+  +     +   KA   Q  +G + 
Sbjct: 371 EALDAWKREAEALAPVEAEKERLLGKKNQAESRKSALEVLETQVGQWKACLRQISEGQRR 430

Query: 537 KKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEK 596
           ++  D++ + LA+D            L +K+++LQ   E  +  + + + R +    QE+
Sbjct: 431 REELDRQRETLAAD------------LLRKKEQLQANRETFQATQSLTEERQEQLHRQER 478


>gi|164424037|ref|XP_963289.2| hypothetical protein NCU10479 [Neurospora crassa OR74A]
 gi|157070343|gb|EAA34053.2| predicted protein [Neurospora crassa OR74A]
          Length = 1538

 Score = 43.6 bits (101), Expect = 0.25,   Method: Composition-based stats.
 Identities = 39/159 (24%), Positives = 65/159 (40%), Gaps = 36/159 (22%)

Query: 396  RANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQ-EKTPIKAEGDDFGLGLP 454
            R  +QE++Q +++   EK D E ADK A+++A  +  ++D++ EKT              
Sbjct: 1279 RDKSQEKEQEKKKPDGEKEDVEMADKPAEKEASEKAMEEDMEVEKT-------------- 1324

Query: 455  SVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTK 514
            S P    K   + E  + V+ E     EP   E +   E  ++ + + D           
Sbjct: 1325 SKPEPENKKKQENEPEKRVEQEKVTSPEPKAKEAEPEPEPVKETEPVPD----------- 1373

Query: 515  NETPAIPTAKA---PPAQAHKGIQDKKPQDQREKPLASD 550
              TP +    A   PPA+      +K P  + E   A D
Sbjct: 1374 --TPPVSNLDAPAKPPAEV-----EKTPVPETETETADD 1405


>gi|164424006|ref|XP_001728116.1| hypothetical protein NCU08417 [Neurospora crassa OR74A]
 gi|157070329|gb|EDO65025.1| predicted protein [Neurospora crassa OR74A]
          Length = 1578

 Score = 43.6 bits (101), Expect = 0.25,   Method: Composition-based stats.
 Identities = 39/159 (24%), Positives = 65/159 (40%), Gaps = 36/159 (22%)

Query: 396  RANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQ-EKTPIKAEGDDFGLGLP 454
            R  +QE++Q +++   EK D E ADK A+++A  +  ++D++ EKT              
Sbjct: 1319 RDKSQEKEQEKKKPDGEKEDVEMADKPAEKEASEKAMEEDMEVEKT-------------- 1364

Query: 455  SVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTK 514
            S P    K   + E  + V+ E     EP   E +   E  ++ + + D           
Sbjct: 1365 SKPEPENKKKQENEPEKRVEQEKVTSPEPKAKEAEPEPEPVKETEPVPD----------- 1413

Query: 515  NETPAIPTAKA---PPAQAHKGIQDKKPQDQREKPLASD 550
              TP +    A   PPA+      +K P  + E   A D
Sbjct: 1414 --TPPVSNLDAPAKPPAEV-----EKTPVPETETETADD 1445


>gi|71834468|ref|NP_001025332.1| PERQ amino acid-rich with GYF domain-containing protein 2 [Danio
           rerio]
 gi|122064902|sp|Q4KME6|PERQ2_DANRE RecName: Full=PERQ amino acid-rich with GYF domain-containing
           protein 2; AltName: Full=Trinucleotide repeat-containing
           gene 15 protein
 gi|68534531|gb|AAH98603.1| Zgc:111944 [Danio rerio]
          Length = 1335

 Score = 43.6 bits (101), Expect = 0.25,   Method: Composition-based stats.
 Identities = 36/165 (21%), Positives = 70/165 (42%), Gaps = 29/165 (17%)

Query: 400 QEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTH 459
           +E  +  E++  E    +  D   ++++DR + +   +E +P+            +VP  
Sbjct: 338 EENDEYAEKDDSETEQTKDTDTNTRQESDRNEENCKSEEPSPV------------AVPFS 385

Query: 460 SVKLPPKEE--------ELEEVKDEGKKGKEPGTTETDDREETERKN-QDILDNSLLAGK 510
           +V  PPK           LE+ +D+ +  +   TT  + R E  +      L NS++   
Sbjct: 386 AVDTPPKATTPAPIQPVHLEKAEDKERPSER--TTLPEIRHELSKAPLHTALSNSIVEAI 443

Query: 511 T--HTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGV 553
           +  H  N+ P +P     PA +   ++   PQ Q+ KP+   + V
Sbjct: 444 SIPHVANKLPDLPV----PAPSVLPVKSVPPQSQQVKPIEMPVSV 484


>gi|149642767|ref|NP_001092586.1| SWI/SNF-related matrix-associated actin-dependent regulator of
           chromatin e1 [Bos taurus]
 gi|148745040|gb|AAI42471.1| SMARCE1 protein [Bos taurus]
 gi|296476367|gb|DAA18482.1| SWI/SNF-related matrix-associated actin-dependent regulator of
           chromatin e1 [Bos taurus]
          Length = 415

 Score = 43.6 bits (101), Expect = 0.25,   Method: Composition-based stats.
 Identities = 44/193 (22%), Positives = 85/193 (44%), Gaps = 15/193 (7%)

Query: 341 QIKQLRDLASKVKADYHWAEIRH---GNRFKAETRLAYSTIANVANFTSELKQATVLARA 397
           Q++ L     K++A+    E RH     +F   T    + +  +     E+    + A  
Sbjct: 230 QVQSLMVHQRKLEAELLQIEERHQEKKRKFLESTDSFNNELKRLCGLKVEVDMEKIAAEI 289

Query: 398 NAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVP 457
              EE+ R+ QE +E        KEA E+A+R ++   + E+ P  ++ +D      S+P
Sbjct: 290 AQAEEQARKRQEERE--------KEAAEQAERSQSSI-IPEEEPAASKTEDKKED-ESMP 339

Query: 458 THSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNET 517
             +  L P+E  LE+  +  + G+E GT+  +D+E  +     + +       T +++ +
Sbjct: 340 METGSL-PEETHLEDTTESQQNGEE-GTSTPEDKESGQEGVDSLAEEGTSDSNTGSESNS 397

Query: 518 PAIPTAKAPPAQA 530
            A+      PA A
Sbjct: 398 AAVEEPPTDPAPA 410


>gi|323693035|ref|ZP_08107255.1| hypothetical protein HMPREF9475_02118 [Clostridium symbiosum
           WAL-14673]
 gi|323502916|gb|EGB18758.1| hypothetical protein HMPREF9475_02118 [Clostridium symbiosum
           WAL-14673]
          Length = 1483

 Score = 43.6 bits (101), Expect = 0.26,   Method: Composition-based stats.
 Identities = 49/189 (25%), Positives = 87/189 (46%), Gaps = 18/189 (9%)

Query: 16  DQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYIVGPIEQRLKKVSERY 75
           +Q++   E V +TL S ++ ++ L+  II ++S +   K R    +   +QR  + ++ Y
Sbjct: 443 EQNRKEQETVRETLKSKEERLEELQNQIIDYASRMAGQKTR----IAVFDQRENRFNKMY 498

Query: 76  ERVVSRDLTLVIEAGLKDLKEVGDTLKRLAETGEVILSDK-SDRLLCRFMDMVETEDEHK 134
              + R+L    E G          L+ L +  E  L D   +RL  R     ETE++ K
Sbjct: 499 GESLKRNLLGEYEPG---------ALQILLQIYEKTLEDVIKERLTLRQKQETETEEKKK 549

Query: 135 INKQVRDALESAGFDLESTQENIR-KVESALINNNMKDAFRFLELAQKSKETADSHIIEA 193
           + +++ D  +  G + E  +E +R   E     +  +   R+LEL        D+ I++A
Sbjct: 550 LERRLEDLKQELGRNGEEQRELLRIGREYGEELSERRKILRYLELKDSLVFEQDA-ILQA 608

Query: 194 IDVGTKLKE 202
              G KLKE
Sbjct: 609 --SGRKLKE 615


>gi|66803771|ref|XP_635715.1| DEAD/DEAH box helicase [Dictyostelium discoideum AX4]
 gi|74996600|sp|Q54G57|HELC1_DICDI RecName: Full=Activating signal cointegrator 1 complex subunit 3
 gi|60464048|gb|EAL62210.1| DEAD/DEAH box helicase [Dictyostelium discoideum AX4]
          Length = 2195

 Score = 43.6 bits (101), Expect = 0.26,   Method: Composition-based stats.
 Identities = 45/207 (21%), Positives = 95/207 (45%), Gaps = 29/207 (14%)

Query: 48  SDLNPH----KDRYDYI-VGPIEQRLKKVSERYER------VVSRDLTLVIEAGLKDLKE 96
           S++NP+    KD +  I + P++    ++ E++        +VS++LT  ++   K+LKE
Sbjct: 525 SNINPYGYLDKDNFKIIYIAPLKALASEMVEKFSNSLKYLGIVSKELTGDMQLTQKELKE 584

Query: 97  VGDTLKRLAETGEVILSDKSDRLLCRFMDMVETEDEHKINKQVRDALE----SAGFDLES 152
               +    E  +VI    SD  L + + ++  ++ H ++++    LE         +E+
Sbjct: 585 T-QIIVTTPEKWDVITRKSSDVALTKLVRLIIIDEIHLLHEERGPVLECIVARTLRQVET 643

Query: 153 TQENIRKVESALINNNMKDAFRFLELAQKSKETADSHIIEAIDVGTKLKENTPPTTFTSI 212
           TQE IR V  +    N KD  RF+         + +H  ++      L +N     F  +
Sbjct: 644 TQEMIRIVGLSATLPNYKDVARFIR-----APASGTHFFDSSYRPVPLTQN-----FIGV 693

Query: 213 SK---VLLKSNNMQDVVFTKIKEVVKK 236
                +++  NNM  + + ++++ +K+
Sbjct: 694 KDNQGIMVMKNNMNQLCYERLEKSLKE 720


>gi|332685843|ref|YP_004455617.1| secreted antigen GbpB/SagA/PcsB [Melissococcus plutonius ATCC
           35311]
 gi|332369852|dbj|BAK20808.1| secreted antigen GbpB/SagA/PcsB, putative peptidoglycan hydrolase
           [Melissococcus plutonius ATCC 35311]
          Length = 544

 Score = 43.6 bits (101), Expect = 0.26,   Method: Composition-based stats.
 Identities = 40/169 (23%), Positives = 70/169 (41%), Gaps = 8/169 (4%)

Query: 385 TSELKQATVLARANAQEEKQRREQEAKEKADREKADKEA-KEKADREKADKDLQEKTPIK 443
           T E K+++ +A+  A ++K   EQ A++KA  EKA + A  E   RE A K  ++K    
Sbjct: 208 TEENKKSSFIAQKEAAQKKLEEEQ-ARQKAAEEKAQQTAIAEAKQREVAAKQNEQKRTTN 266

Query: 444 AEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTT-ETDDREETERKNQDIL 502
               D  +   S    + K   K +  E  +  G   ++P  T +  D  +   + ++  
Sbjct: 267 LNATDKKIVQESASVETSKNTEKNKPAENNQASGTSVEQPKETPKQPDAGQQPEQPKETP 326

Query: 503 DNSLLAGKTHTKNETPAIPTAKAPPAQAHKG-----IQDKKPQDQREKP 546
                  +     ETP  P A   P Q  +      ++  +P+  +E P
Sbjct: 327 KQPDAGQQPEQPKETPKQPDAGQQPEQPKETPKQPEVEQVQPEQPKETP 375


>gi|123496124|ref|XP_001326896.1| CK1 family protein kinase [Trichomonas vaginalis G3]
 gi|121909817|gb|EAY14673.1| CK1 family protein kinase [Trichomonas vaginalis G3]
          Length = 971

 Score = 43.6 bits (101), Expect = 0.26,   Method: Composition-based stats.
 Identities = 41/205 (20%), Positives = 87/205 (42%), Gaps = 41/205 (20%)

Query: 396 RANAQEEKQRREQEAKEKADREKADKEAKEKADREKA-DKDLQEKTPIKAEGDDFGLGLP 454
           +  +Q +    +Q+++ K D +K   + K+  D++K+ +KD ++K   + +GD+      
Sbjct: 767 KQKSQNKDDEDKQKSQNKDDEDKQKSQNKDDEDKQKSQNKDDEDKQKSQNKGDE------ 820

Query: 455 SVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTK 514
                S     ++++  + KD+  K K   +   DD ++ + +N+D  D +++ G  + +
Sbjct: 821 -DKQKSQNKDDEDKQKSQNKDDEDKQK---SQNKDDEDKQKSQNKDDEDKNIVKGDKNKQ 876

Query: 515 NETPAIPTAKAPPAQAHKGIQ------------------------DKKPQDQREKPLASD 550
                 P     P +  K  Q                        D+KPQ   EKP   +
Sbjct: 877 INEEKKPEQTTKPKEEEKTEQKPIIADDNKISQESKPEPPKQNNTDQKPQISSEKPSEEE 936

Query: 551 IGVGESDYAGIKLTKKEKELQEQEE 575
             V   +      TKK +E+++Q++
Sbjct: 937 KRVNSDE------TKKNEEVKKQKQ 955


>gi|257424251|ref|ZP_05600680.1| immunoglobulin G-binding protein A [Staphylococcus aureus subsp.
           aureus 55/2053]
 gi|257426927|ref|ZP_05603329.1| immunoglobulin G-binding protein A [Staphylococcus aureus subsp.
           aureus 65-1322]
 gi|282912968|ref|ZP_06320760.1| immunoglobulin G binding protein A [Staphylococcus aureus subsp.
           aureus M899]
 gi|282922595|ref|ZP_06330285.1| immunoglobulin G-binding protein A [Staphylococcus aureus subsp.
           aureus C101]
 gi|293498023|ref|ZP_06665877.1| immunoglobulin G-binding protein A [Staphylococcus aureus subsp.
           aureus 58-424]
 gi|293550221|ref|ZP_06672893.1| immunoglobulin G binding protein A [Staphylococcus aureus subsp.
           aureus M1015]
 gi|257273269|gb|EEV05371.1| immunoglobulin G-binding protein A [Staphylococcus aureus subsp.
           aureus 55/2053]
 gi|257276558|gb|EEV08009.1| immunoglobulin G-binding protein A [Staphylococcus aureus subsp.
           aureus 65-1322]
 gi|282314816|gb|EFB45202.1| immunoglobulin G-binding protein A [Staphylococcus aureus subsp.
           aureus C101]
 gi|282323068|gb|EFB53387.1| immunoglobulin G binding protein A [Staphylococcus aureus subsp.
           aureus M899]
 gi|290919268|gb|EFD96344.1| immunoglobulin G binding protein A [Staphylococcus aureus subsp.
           aureus M1015]
 gi|291096954|gb|EFE27212.1| immunoglobulin G-binding protein A [Staphylococcus aureus subsp.
           aureus 58-424]
          Length = 453

 Score = 43.2 bits (100), Expect = 0.27,   Method: Composition-based stats.
 Identities = 58/228 (25%), Positives = 87/228 (38%), Gaps = 31/228 (13%)

Query: 341 QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSE--------LKQAT 392
           + K+L D A   KAD         N+F  E + A+  I ++ N T E        LK   
Sbjct: 211 EAKKLND-AQAPKAD---------NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDP 260

Query: 393 VLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQE--KTPIKAEGDDFG 450
            +++    E K+  + +A ++ D  K  KE   K  +E  +K  +E  K P K +G+  G
Sbjct: 261 SVSKEILAEAKKLNDAQAPKEEDNNKPGKEDNNKPGKEDGNKPGKEDNKKPGKEDGNKPG 320

Query: 451 LGLPSVP-THSVKLPPKEEELEEVKDEGKK-GKE---------PGTTETDDREETERKNQ 499
                 P       P KE+  +  K++G K GKE         PG T  D  +       
Sbjct: 321 KEDNKKPGKEDGNKPGKEDGNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTAD 380

Query: 500 DILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPL 547
            I  ++ LA K   K     +   K P   A        P+   E P 
Sbjct: 381 KIAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEENPF 428


>gi|312211746|emb|CBX91830.1| similar to UBX domain protein [Leptosphaeria maculans]
          Length = 323

 Score = 43.2 bits (100), Expect = 0.27,   Method: Composition-based stats.
 Identities = 33/116 (28%), Positives = 57/116 (49%), Gaps = 14/116 (12%)

Query: 346 RDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARA-NAQEEKQ 404
           R L S  +A++H ++  H N  ++   +A  T         ELK+   L RA  A++EK+
Sbjct: 91  RKLRSTTQAEWHASKTGHENFSQSTEEIAPLTEEEKKQRLEELKEKLALKRATQAEQEKE 150

Query: 405 RRE-------------QEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGD 447
            R+             QE KE+  +++  KEA+ K   +KAD++ +++   K E D
Sbjct: 151 ERKRNEQIRLKATKESQEIKEELQKKERLKEAQAKRAEKKADEEARKRVLAKLEAD 206


>gi|45382633|ref|NP_990799.1| src substrate protein p85 [Gallus gallus]
 gi|267027|sp|Q01406|SRC8_CHICK RecName: Full=Src substrate protein p85; AltName: Full=Cortactin;
           AltName: Full=p80
 gi|212589|gb|AAA49031.1| p80/85 [Gallus gallus]
          Length = 563

 Score = 43.2 bits (100), Expect = 0.27,   Method: Composition-based stats.
 Identities = 23/66 (34%), Positives = 39/66 (59%), Gaps = 7/66 (10%)

Query: 378 IANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQ 437
           +  VAN TS +       RAN +   + +EQE + KA+ E+A + A+EK ++E+A + L+
Sbjct: 349 VERVANKTSSI-------RANLENLAKEKEQEDRRKAEAERAQRMAREKQEQEEARRKLE 401

Query: 438 EKTPIK 443
           E+   K
Sbjct: 402 EQAKAK 407


>gi|119574313|gb|EAW53928.1| myosin, heavy polypeptide 11, smooth muscle, isoform CRA_d [Homo
            sapiens]
          Length = 1266

 Score = 43.2 bits (100), Expect = 0.28,   Method: Composition-based stats.
 Identities = 61/273 (22%), Positives = 123/273 (45%), Gaps = 33/273 (12%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE--ITHHTRRLVKEDPK-------RGKSESY 764
             E+ ++K   E+L    Q + ++    + E  I+  T  L +E+ K       + K ES 
Sbjct: 976  AEAKIKKLEDEILVMDDQNNKLSKERKLLEERISDLTTNLAEEEEKAKNLTKLKNKHESM 1035

Query: 765  LSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTIIS-------GSEKILQGD 816
            +S++   L+K  K+  ++ ++K +L G   D  ++   L   I+         E+ LQ  
Sbjct: 1036 ISELEVRLKKEEKSRQELEKLKRKLEGDASDFHEQIADLQAQIAELKMQLAKKEEELQA- 1094

Query: 817  YTFPPLSSLDVQ-SKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAE 875
                 L+ LD + ++ +++  K+ E+   +   + ++E+      A  ++ K +  L  E
Sbjct: 1095 ----ALARLDDEIAQKNNALKKIREL---EGHISDLQEDLDSERAARNKAEKQKRDLGEE 1147

Query: 876  VERLSGLAQQPSDSTADLKELQ-------TQLSRAKKYKESNDERIVSFIRSEFEREIKE 928
            +E L    +   DSTA  +EL+       T L +A   +  + E  V  +R +  + ++E
Sbjct: 1148 LEALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEE 1207

Query: 929  LKSVIEADAKENPNPNKNQKKLQKTREKLVAQL 961
            L   +E   +   N +KN++ L+K    L  +L
Sbjct: 1208 LTEQLEQFKRAKANLDKNKQTLEKENADLAGEL 1240


>gi|194034734|ref|XP_001927765.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 8 [Sus scrofa]
          Length = 1117

 Score = 43.2 bits (100), Expect = 0.28,   Method: Composition-based stats.
 Identities = 29/111 (26%), Positives = 52/111 (46%), Gaps = 10/111 (9%)

Query: 396 RANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPS 455
           + NA+E+ ++RE E  +K D+E + K+ +E    ++  K   E T  K   +D G   P+
Sbjct: 517 QQNAKEQMEKRESEQAKKEDKETSAKKGREITGVKRQSKSEHETTDAKKSVEDRGKRCPT 576

Query: 456 ----------VPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETER 496
                     +P  SV       +L ++K + + G     T  ++ E+TER
Sbjct: 577 PEMQKQSAGDIPHASVAGDSGSGKLVKIKGQPESGILKTGTFRENTEDTER 627


>gi|197294457|ref|YP_001798998.1| hypothetical protein PAa_0382 [Candidatus Phytoplasma australiense]
 gi|171853784|emb|CAM11717.1| Conserved hypothetical protein [Candidatus Phytoplasma
           australiense]
          Length = 1164

 Score = 43.2 bits (100), Expect = 0.28,   Method: Composition-based stats.
 Identities = 64/242 (26%), Positives = 106/242 (43%), Gaps = 30/242 (12%)

Query: 392 TVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIK-AEGDDFG 450
           T LA  N +     +EQE + +  +E  D   K+K + E+  K L+E+  +   E     
Sbjct: 364 TNLASRNEELNNLEKEQEVQAELRQELYDVINKDKENLEQKTKQLEEQKNLSDTEKQQLT 423

Query: 451 LGLPSVPTHSVKLPPKEEEL----EEVKDEGKKGKEPGTTETDDREETERKNQDILDNSL 506
             +  + T+   L  K EEL    +++++E KK      TE +D  +T+ K    +  S 
Sbjct: 424 KQIEDINTN---LASKNEELNNLNQKLEEEAKK-----QTELNDVIQTQEKKLKQIQISS 475

Query: 507 LAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREK-PLASDIGVGESDYAGI---- 561
              +    N+   I T     A+  +    +  Q Q +K  L + +   + D   +    
Sbjct: 476 EEKQQELNNKIKDIQTTLDKQAKVTEDKNKELEQMQSQKIQLENQLASNKQDLQNLQKEI 535

Query: 562 -----KLTKKEKELQEQEENLRVAEIIQQS----RMQSEDLQEKAWDSYKEWKSLSPDEI 612
                KL  KEKEL EQ +NL  AE  Q +     ++++  QEK   +Y+   SL  +EI
Sbjct: 536 FNKEAKLEDKEKELAEQ-KNLSDAEKQQLTSEINNLKNDINQEKV--NYQAQVSLKEEEI 592

Query: 613 KQ 614
           KQ
Sbjct: 593 KQ 594


>gi|257432212|ref|ZP_05608575.1| immunoglobulin G-binding protein A [Staphylococcus aureus subsp.
           aureus E1410]
 gi|257435171|ref|ZP_05611222.1| immunoglobulin G-binding protein A [Staphylococcus aureus subsp.
           aureus M876]
 gi|257283091|gb|EEV13223.1| immunoglobulin G-binding protein A [Staphylococcus aureus subsp.
           aureus E1410]
 gi|257285767|gb|EEV15883.1| immunoglobulin G-binding protein A [Staphylococcus aureus subsp.
           aureus M876]
          Length = 454

 Score = 43.2 bits (100), Expect = 0.28,   Method: Composition-based stats.
 Identities = 58/228 (25%), Positives = 87/228 (38%), Gaps = 31/228 (13%)

Query: 341 QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSE--------LKQAT 392
           + K+L D A   KAD         N+F  E + A+  I ++ N T E        LK   
Sbjct: 212 EAKKLND-AQAPKAD---------NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDP 261

Query: 393 VLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQE--KTPIKAEGDDFG 450
            +++    E K+  + +A ++ D  K  KE   K  +E  +K  +E  K P K +G+  G
Sbjct: 262 SVSKEILAEAKKLNDAQAPKEEDNNKPGKEDNNKPGKEDGNKPGKEDNKKPGKEDGNKPG 321

Query: 451 LGLPSVP-THSVKLPPKEEELEEVKDEGKK-GKE---------PGTTETDDREETERKNQ 499
                 P       P KE+  +  K++G K GKE         PG T  D  +       
Sbjct: 322 KEDNKKPGKEDGNKPGKEDGNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTAD 381

Query: 500 DILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPL 547
            I  ++ LA K   K     +   K P   A        P+   E P 
Sbjct: 382 KIAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEENPF 429


>gi|296219013|ref|XP_002755694.1| PREDICTED: src substrate cortactin isoform 2 [Callithrix jacchus]
          Length = 513

 Score = 43.2 bits (100), Expect = 0.29,   Method: Composition-based stats.
 Identities = 35/132 (26%), Positives = 57/132 (43%), Gaps = 11/132 (8%)

Query: 369 AETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKAD 428
           A+   AY     V   TS+    T   RAN +   + +EQE + KA+ E+A + AKE+ +
Sbjct: 291 AQVSSAYQKTVPVEAVTSK----TSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQE 346

Query: 429 REKADKDLQEKTPIKAEGDDFGLG-------LPSVPTHSVKLPPKEEELEEVKDEGKKGK 481
           +E+A + L+E+   K +              LP+ P +    P K E        G + +
Sbjct: 347 QEEARRKLEEQARAKTQTPPSSPPPQPAEERLPTSPVYEDAAPFKAEMTYRSPVSGPEPE 406

Query: 482 EPGTTETDDREE 493
              + E  D  E
Sbjct: 407 PVYSVEATDYRE 418


>gi|221481211|gb|EEE19612.1| ubiquitin ligase E3 alpha, putative [Toxoplasma gondii GT1]
          Length = 3454

 Score = 43.2 bits (100), Expect = 0.29,   Method: Composition-based stats.
 Identities = 31/113 (27%), Positives = 50/113 (44%), Gaps = 19/113 (16%)

Query: 392  TVLARANAQEEKQRREQEAKEKADREKADKEAKEKA-------DREKADKDLQEKTPIKA 444
            T   RA AQE  +R E     + D E+A++EA EKA        R++A++ L+E+  + +
Sbjct: 1160 TTQTRAAAQETSRREEGVTSTEKDNEEAEREAGEKAALYVAMGRRDRAERFLEEEREVGS 1219

Query: 445  EGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERK 497
            +G   G G             K+ ELE    +G         + + RE  E +
Sbjct: 1220 DGAREGSG------------EKKRELEVDAKQGDGENAENGMQVETREALEER 1260


>gi|237844415|ref|XP_002371505.1| hypothetical protein TGME49_095660 [Toxoplasma gondii ME49]
 gi|211969169|gb|EEB04365.1| hypothetical protein TGME49_095660 [Toxoplasma gondii ME49]
 gi|221501759|gb|EEE27519.1| ubiquitin ligase E3 alpha, putative [Toxoplasma gondii VEG]
          Length = 3454

 Score = 43.2 bits (100), Expect = 0.29,   Method: Composition-based stats.
 Identities = 31/113 (27%), Positives = 50/113 (44%), Gaps = 19/113 (16%)

Query: 392  TVLARANAQEEKQRREQEAKEKADREKADKEAKEKA-------DREKADKDLQEKTPIKA 444
            T   RA AQE  +R E     + D E+A++EA EKA        R++A++ L+E+  + +
Sbjct: 1160 TTQTRAAAQETSRREEGVTSTEKDNEEAEREAGEKAALYVAMGRRDRAERFLEEEREVGS 1219

Query: 445  EGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERK 497
            +G   G G             K+ ELE    +G         + + RE  E +
Sbjct: 1220 DGAREGSG------------EKKRELEVDAKQGDGENAENGMQVETREALEER 1260


>gi|95007066|emb|CAJ20282.1| hypothetical protein TgIa.0270 [Toxoplasma gondii RH]
          Length = 3352

 Score = 43.2 bits (100), Expect = 0.29,   Method: Composition-based stats.
 Identities = 31/113 (27%), Positives = 50/113 (44%), Gaps = 19/113 (16%)

Query: 392 TVLARANAQEEKQRREQEAKEKADREKADKEAKEKA-------DREKADKDLQEKTPIKA 444
           T   RA AQE  +R E     + D E+A++EA EKA        R++A++ L+E+  + +
Sbjct: 285 TTQTRAAAQETSRREEGVTSTEKDNEEAEREAGEKAALYVAMGRRDRAERFLEEEREVGS 344

Query: 445 EGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERK 497
           +G   G G             K+ ELE    +G         + + RE  E +
Sbjct: 345 DGAREGSG------------EKKRELEVDAKQGDGENAENGMQVETREALEER 385


>gi|332265086|ref|XP_003281557.1| PREDICTED: myosin-11 [Nomascus leucogenys]
          Length = 1358

 Score = 43.2 bits (100), Expect = 0.30,   Method: Composition-based stats.
 Identities = 61/273 (22%), Positives = 123/273 (45%), Gaps = 33/273 (12%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE--ITHHTRRLVKEDPK-------RGKSESY 764
             E+ ++K   E+L    Q + ++    + E  I+  T  L +E+ K       + K ES 
Sbjct: 956  AEAKIKKLEDEILVMDDQNNKLSKERKLLEERISDLTTNLAEEEEKAKNLTKLKNKHESM 1015

Query: 765  LSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTIIS-------GSEKILQGD 816
            +S++   L+K  K+  ++ ++K +L G   D  ++   L   I+         E+ LQ  
Sbjct: 1016 ISELEVRLKKEEKSRQELEKLKRKLEGEASDFHEQIADLQAQIAELKMQLAKKEEELQA- 1074

Query: 817  YTFPPLSSLDVQ-SKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAE 875
                 L+ LD + ++ +++  K+ E+   +   + ++E+      A  ++ K +  L  E
Sbjct: 1075 ----ALARLDDEIAQKNNALKKIREL---EGHISDLQEDLDSERAARNKAEKQKRDLGEE 1127

Query: 876  VERLSGLAQQPSDSTADLKELQ-------TQLSRAKKYKESNDERIVSFIRSEFEREIKE 928
            +E L    +   DSTA  +EL+       T L +A   +  + E  V  +R +  + ++E
Sbjct: 1128 LEALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEE 1187

Query: 929  LKSVIEADAKENPNPNKNQKKLQKTREKLVAQL 961
            L   +E   +   N +KN++ L+K    L  +L
Sbjct: 1188 LTEQLEQFKRAKANLDKNKQTLEKENADLAGEL 1220


>gi|298704970|emb|CBJ28460.1| Putative Leucine Rich Repeat Protein [Ectocarpus siliculosus]
          Length = 1145

 Score = 43.2 bits (100), Expect = 0.30,   Method: Composition-based stats.
 Identities = 50/233 (21%), Positives = 109/233 (46%), Gaps = 15/233 (6%)

Query: 390  QATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDF 449
            QA + A  + +EE+Q      K   +++K+  EA E +++EK    ++E   +++  +  
Sbjct: 835  QAELEALKSDKEEQQAELAALKSAMEKQKSRIEAVE-SEKEKKQSKIEE---VESAKEKQ 890

Query: 450  GLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAG 509
               L  + +   K   ++ ELE +K   +K +    ++ +  E    K Q  L+ +L + 
Sbjct: 891  QAELEVLQSAKEK---QQNELEALKSTQEKQQ----SKIEAAESAREKQQAELE-ALQSA 942

Query: 510  KTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKE 569
            K   + E  A+ +AK       + ++  K Q Q +  + +     E  +A +     +KE
Sbjct: 943  KEKQQAELEALQSAKVKQQNELEALKSAKEQQQSK--IEAVESAKEKQHAELAALHFDKE 1000

Query: 570  LQEQE-ENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAK 621
             Q+   E L+ A+  QQS++++ +  ++      E  + + DE++++ +K  K
Sbjct: 1001 KQQAALEALKSAKEKQQSKIEAVESAKEKQQEELEGLTAAKDELERKVKKLEK 1053


>gi|296219011|ref|XP_002755693.1| PREDICTED: src substrate cortactin isoform 1 [Callithrix jacchus]
          Length = 550

 Score = 43.2 bits (100), Expect = 0.30,   Method: Composition-based stats.
 Identities = 35/132 (26%), Positives = 57/132 (43%), Gaps = 11/132 (8%)

Query: 369 AETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKAD 428
           A+   AY     V   TS+    T   RAN +   + +EQE + KA+ E+A + AKE+ +
Sbjct: 328 AQVSSAYQKTVPVEAVTSK----TSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQE 383

Query: 429 REKADKDLQEKTPIKAEGDDFGLG-------LPSVPTHSVKLPPKEEELEEVKDEGKKGK 481
           +E+A + L+E+   K +              LP+ P +    P K E        G + +
Sbjct: 384 QEEARRKLEEQARAKTQTPPSSPPPQPAEERLPTSPVYEDAAPFKAEMTYRSPVSGPEPE 443

Query: 482 EPGTTETDDREE 493
              + E  D  E
Sbjct: 444 PVYSVEATDYRE 455


>gi|150865152|ref|XP_001384253.2| chromosome condensation and segregation protein [Scheffersomyces
           stipitis CBS 6054]
 gi|149386408|gb|ABN66224.2| chromosome condensation and segregation protein [Scheffersomyces
           stipitis CBS 6054]
          Length = 1011

 Score = 43.2 bits (100), Expect = 0.30,   Method: Composition-based stats.
 Identities = 39/129 (30%), Positives = 62/129 (48%), Gaps = 18/129 (13%)

Query: 863 ERSLKNQAHLNAEV-ERLSGLAQQPSD---STADLKELQTQLSRAKKYKESNDERIVSFI 918
           E+ + N  +    + E L+ + ++ SD    +ADLK+ Q+ L ++KK  E N        
Sbjct: 175 EKEMNNSTYKKQRIDETLASIDERLSDLQIESADLKKFQS-LDKSKKILEYN-------- 225

Query: 919 RSEFEREIKELKSVI-EADAKENPNPNKNQKKLQK--TREKLVAQLSSRLKELNIDNAYG 975
              F+RE  +LK+ I E D   N    ++Q+ LQ    REKL  QLS  + +L I     
Sbjct: 226 --LFDREFTDLKTSIDETDETYNELLTESQQDLQDLDNREKLCQQLSDTINDLKISIKVS 283

Query: 976 LWNEYKEDF 984
             N+ + D 
Sbjct: 284 QLNKEQSDL 292


>gi|148686300|gb|EDL18247.1| cortactin, isoform CRA_b [Mus musculus]
          Length = 381

 Score = 43.2 bits (100), Expect = 0.31,   Method: Composition-based stats.
 Identities = 35/132 (26%), Positives = 60/132 (45%), Gaps = 11/132 (8%)

Query: 396 RANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPS 455
           RAN +   + REQE + KA+ E+A + AKE+ ++E+A + L+E+   K +        P+
Sbjct: 186 RANFENLAKEREQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKKQTP------PA 239

Query: 456 VPT-HSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTK 514
            P+   ++  P    + E  D      EP    ++   E   +   I +     G T+T 
Sbjct: 240 SPSPQPIEDRPPSSPIYE--DAAPFKAEPSYRGSEPEPEYSIEAAGIPEAGSQQGLTYTS 297

Query: 515 NETPAIPTAKAP 526
              P   T +AP
Sbjct: 298 E--PVYETTEAP 307


>gi|297267228|ref|XP_002799500.1| PREDICTED: src substrate cortactin-like isoform 2 [Macaca mulatta]
          Length = 513

 Score = 43.2 bits (100), Expect = 0.31,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 46/97 (47%), Gaps = 14/97 (14%)

Query: 374 AYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKAD 433
           AY     V   TS+    T   RAN +   + +EQE + KA+ E+A + AKE+ ++E+A 
Sbjct: 296 AYQKTVPVEAVTSK----TSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEAR 351

Query: 434 KDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEEL 470
           + L+E+   K +           P  S    P EE L
Sbjct: 352 RKLEEQARAKTQ----------TPPASPAPQPTEERL 378


>gi|224051629|ref|XP_002200161.1| PREDICTED: thyroid hormone receptor interactor 11 [Taeniopygia
            guttata]
          Length = 1946

 Score = 43.2 bits (100), Expect = 0.31,   Method: Composition-based stats.
 Identities = 86/445 (19%), Positives = 181/445 (40%), Gaps = 61/445 (13%)

Query: 88   EAGLKDLKEVGDTLKRLAETGEVILSDKSDRLLCRFMDMVETEDEHKINKQVRDALESAG 147
            E+ ++ +KE  D L++     ++++  KSD+LL    ++   E+E+++ KQ    L+   
Sbjct: 1360 ESEMRQIKEKHDVLQKSLREKDILIKSKSDQLLSVSENLSNKENENELLKQAVTNLKERN 1419

Query: 148  FDLESTQENIRKVESALINNNMKDAFRFLELAQ---------KSKETADSHIIEAIDVGT 198
              LE     +++    ++    +    F  L +         K KE     + E      
Sbjct: 1420 LILEMDIRKLKEENETIVARCREKETEFCALQETNMQFSMMLKEKEFESHSMKEKALAFE 1479

Query: 199  KLKENTPPTTFTSISKVLLKSNNMQDVVFTKIKEVVKKHVNAELGHRKLRGLAF----DH 254
            KL ++        ++++L +  +MQ+   T  +E  +  V   L  +++   A      H
Sbjct: 1480 KLLKDKEQGKTGELNQLLNEVKSMQEKAVTFQQE--RDQVMVALKQKQMESSALQSEVQH 1537

Query: 255  TYFND-KLNQFLKEIKNHQKEYDESEKGSSKARYHAAYAHIYWDLANDWVNGRVGDKSDE 313
             +  + +LNQ L+ ++NH  E ++S    + A                 +  +V    ++
Sbjct: 1538 LHEKEQRLNQELERLRNHLLEMEDSYTREALAAEDREVK----------LRKKVLILEEK 1587

Query: 314  WARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKAETRL 373
             A +ST + +             +  + +++  +L SK + +                  
Sbjct: 1588 LASSSTAVEN-------ASHQASLQVESLQEQLNLVSKQRDE------------------ 1622

Query: 374  AYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKAD 433
               T+  +     ++KQ   L+ AN Q   ++ +QE K     E  ++  K+ A+ +K  
Sbjct: 1623 ---TVLQLTISQDQVKQ-YALSLANLQMVLEQFQQEEKAMYSAE-LERHQKQSAEWKKKA 1677

Query: 434  KDLQEK-TPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDD-- 490
            ++L+EK   ++   ++    L +    + +L  KEE++EE+K EG+  +E      +   
Sbjct: 1678 ENLEEKVVSLQVSLEEANAALDAASRLTEQLDIKEEQIEELKKEGEIKREMLEDVQNKLM 1737

Query: 491  --REETERKNQDILDNSLLAGKTHT 513
                 TE K   +L  +L  G  HT
Sbjct: 1738 NLMNSTEGKVDKLLMRNLFIGHFHT 1762


>gi|255523897|ref|ZP_05390861.1| methyl-accepting chemotaxis sensory transducer [Clostridium
           carboxidivorans P7]
 gi|296185947|ref|ZP_06854352.1| methyl-accepting chemotaxis protein signaling domain protein
           [Clostridium carboxidivorans P7]
 gi|255512459|gb|EET88735.1| methyl-accepting chemotaxis sensory transducer [Clostridium
           carboxidivorans P7]
 gi|296049215|gb|EFG88644.1| methyl-accepting chemotaxis protein signaling domain protein
           [Clostridium carboxidivorans P7]
          Length = 570

 Score = 43.2 bits (100), Expect = 0.31,   Method: Composition-based stats.
 Identities = 40/180 (22%), Positives = 81/180 (45%), Gaps = 12/180 (6%)

Query: 3   ELATSIDYQTNNLDQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYIVG 62
           E+ +S+   TN++ +    SE++A ++  +  +I  L       S++ N  K R   +  
Sbjct: 293 EIDSSVKNITNSVQESSASSEEIAASIEEVDSSINELSIKAADGSNNANQSKKRATTVEE 352

Query: 63  PIEQRLKKVSERYERVVSRDLTLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLLCR 122
             +  + KV   YE    +++ + IEAG     +V D ++ +A+T   I    +   L  
Sbjct: 353 NGKNAITKVRNLYEE-KEKNMIMAIEAG-----KVVDNIRVMADTIASISEQTNLLALNA 406

Query: 123 FMDMVETEDEHK----INKQVRDALESAGFDLESTQENIRKVESAL--INNNMKDAFRFL 176
            ++     ++ K    +  +VRD  E +   +   Q+ I KV+ A   I+ N  +  +F+
Sbjct: 407 AIEAARAGEQGKGFAVVADEVRDLAEQSSQAVAGIQDTILKVQDAFKNISENGNEILKFI 466


>gi|109105115|ref|XP_001100193.1| PREDICTED: src substrate cortactin-like isoform 1 [Macaca mulatta]
          Length = 550

 Score = 43.2 bits (100), Expect = 0.31,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 46/97 (47%), Gaps = 14/97 (14%)

Query: 374 AYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKAD 433
           AY     V   TS+    T   RAN +   + +EQE + KA+ E+A + AKE+ ++E+A 
Sbjct: 333 AYQKTVPVEAVTSK----TSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEAR 388

Query: 434 KDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEEL 470
           + L+E+   K +           P  S    P EE L
Sbjct: 389 RKLEEQARAKTQ----------TPPASPAPQPTEERL 415


>gi|42779687|ref|NP_976934.1| internalin, putative [Bacillus cereus ATCC 10987]
 gi|42735604|gb|AAS39542.1| internalin, putative [Bacillus cereus ATCC 10987]
          Length = 1088

 Score = 43.2 bits (100), Expect = 0.31,   Method: Composition-based stats.
 Identities = 50/229 (21%), Positives = 95/229 (41%), Gaps = 33/229 (14%)

Query: 384  FTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIK 443
            F+ E+ Q  V    N  E K+   +   E+  +E+  K   E+  +E+  K + E+ P K
Sbjct: 843  FSGEVIQNVV----NKTESKEETPKPVVEEKPKEETTKPVVEEKPKEETSKPVVEEKP-K 897

Query: 444  AEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILD 503
             E         S P   V+  PKEE  + V +E  K KE  T    + +  E   + +++
Sbjct: 898  EE--------TSKPV--VEEKPKEETTKPVMEE--KPKEETTKPVVEEKPKEETTKPVVE 945

Query: 504  NSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKL 563
                      K ET      + P  +  K   ++KP+++  KP+  +    E+    ++ 
Sbjct: 946  EK-------PKEETSKPVVEEKPKEETTKPAVEEKPKEETSKPVVEEKPKEETTKPAVEE 998

Query: 564  TKKEKE----LQEQEENLRVAEIIQQSR-----MQSEDLQEKAWDSYKE 603
              KE+     ++E+ +      ++++ R     +  E+   K  D+ KE
Sbjct: 999  KSKEETPKLVMEEKSKEGTSKPVVEERRKEGNKLAKENESNKQVDNKKE 1047


>gi|316971127|gb|EFV54956.1| phosphatidylinositol 4-kinase beta [Trichinella spiralis]
          Length = 1312

 Score = 43.2 bits (100), Expect = 0.32,   Method: Composition-based stats.
 Identities = 35/125 (28%), Positives = 60/125 (48%), Gaps = 9/125 (7%)

Query: 401 EEKQRREQEAKEKADREK------ADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLP 454
           E+K+R+  +A  KA  EK      + K+ K++      DK  QE   +   G + G  LP
Sbjct: 652 EQKKRKADDALLKASGEKEKMQKISSKKGKDRTKGRDVDKVEQEGV-VHGNGSENGGSLP 710

Query: 455 SVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTK 514
           SV   +VK   + +++EE K     G+   +T +DD  + +    D++++     K H K
Sbjct: 711 SV-HKTVKRRKRNKKVEEEK-LVHIGRGRSSTPSDDENDQQNVEADLINDDEEEIKLHKK 768

Query: 515 NETPA 519
           N+  A
Sbjct: 769 NQNTA 773


>gi|312215999|emb|CBX95951.1| similar to DUF814 domain-containing protein [Leptosphaeria
           maculans]
          Length = 1115

 Score = 43.2 bits (100), Expect = 0.32,   Method: Composition-based stats.
 Identities = 36/136 (26%), Positives = 56/136 (41%), Gaps = 6/136 (4%)

Query: 379 ANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQE 438
           ++++N      QAT ++ A   E+    E+E  E AD E  D+    K D    D +  +
Sbjct: 689 SSISNHQKHRIQATAVSAAEMTEDSTNAEEERNE-ADSEHDDEFPDAKLDSGSDDDEFPD 747

Query: 439 KTPIKAEGDDF---GLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETE 495
                AE  D       L + P  S K+  K +   E +D+     +P  TE+ D  E  
Sbjct: 748 AKIDDAEDSDAESEAGALRTNPLQSHKMVDKHDS--ETEDDTSPNNKPAGTESHDIREAP 805

Query: 496 RKNQDILDNSLLAGKT 511
            K   + D +   GKT
Sbjct: 806 AKESTVDDGAESVGKT 821


>gi|114650792|ref|XP_001150590.1| PREDICTED: hypothetical protein [Pan troglodytes]
          Length = 678

 Score = 43.2 bits (100), Expect = 0.32,   Method: Composition-based stats.
 Identities = 44/216 (20%), Positives = 88/216 (40%), Gaps = 18/216 (8%)

Query: 389 KQATVLARANAQEEKQRREQE-AKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGD 447
           +QA   A+  A+E+ Q+  QE A+E+A +    +E  +K  +E+A +  +E+T I+A+G 
Sbjct: 319 EQAQKGAQERAREQAQKGAQERAREQAQKGARAREQTQKGAQERAREQGREQTHIEAQGQ 378

Query: 448 DFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLL 507
                         +    E+   E + + +KG +    E   +   ER    + + + +
Sbjct: 379 -----AQKGAQERARDQGWEQTQIETQRQTQKGAQERAREQAQKGAQERARDQVWEQTQI 433

Query: 508 AGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKE 567
             +  T+         +    QA KG Q++      E+      G  +         +  
Sbjct: 434 EAQRQTQKG-----AQERAREQAQKGAQERARDQGWEQTHIEAQGQAQKGAQKGAQERAR 488

Query: 568 KELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKE 603
            ++ EQ +       I+  R   +  QE+AW+  +E
Sbjct: 489 DQVWEQTQ-------IEAQRQTQKGAQERAWEQGRE 517


>gi|12707551|gb|AAF08305.2| proliferation-related protein P80 [Homo sapiens]
          Length = 1825

 Score = 43.2 bits (100), Expect = 0.32,   Method: Composition-based stats.
 Identities = 58/266 (21%), Positives = 108/266 (40%), Gaps = 27/266 (10%)

Query: 402  EKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDD-FGLGLPSVPTHS 460
            E++ R+ E K+ A  +K      +  D E+ DK L++K  I  E D        ++    
Sbjct: 1409 EQKGRDLEQKDTALEQKDKALEPKDKDLEEKDKALEQKDKIPEEKDKALEQKDTALEQKD 1468

Query: 461  VKLPPKEEELEEVKDEGKKGKEPGTTETDDR--EETERKNQDILDNSLLAGKTHTKNETP 518
              L PK+++LE+ KD   + KE    E D    ++         ++++   K     +T 
Sbjct: 1469 KALEPKDKDLEQ-KDRVLEQKEKIPEEKDKALDQKVRSVEHKAPEDTVAEMKDRDLEQTD 1527

Query: 519  AIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLR 578
              P  K    +    + +KK Q   +K  A    +G+ D A       E+ +Q  EEN  
Sbjct: 1528 KAPEQKHQAQEQKDKVSEKKDQALEQKYWA----LGQKDEA------LEQNIQALEEN-- 1575

Query: 579  VAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQ 638
                  Q++ Q   +QE      K  +  SP+++K   +K   +  ++ +       G +
Sbjct: 1576 -----HQTQEQESLVQEDKTRKPKMLEEKSPEKVKAMEEKLEALLEKTKA------LGLE 1624

Query: 639  ESDKAINHFLDNDFGYYRIHNFLSQW 664
            ES        + +  Y+R  + + +W
Sbjct: 1625 ESLVQEGRAREQEEKYWRGQDVVQEW 1650


>gi|325115372|emb|CBZ50927.1| conserved hypothetical protein [Neospora caninum Liverpool]
          Length = 1132

 Score = 43.2 bits (100), Expect = 0.33,   Method: Composition-based stats.
 Identities = 35/127 (27%), Positives = 49/127 (38%), Gaps = 9/127 (7%)

Query: 395  ARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLP 454
            ARA   EE +R+     E  DR     E  ++ D++  D    E  P+       G    
Sbjct: 948  ARAKDAEEDERKLPREGELGDRSS---EEDDEGDKKAGDD--AEAAPVAFASQGCG---K 999

Query: 455  SVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTK 514
              P H  K P    E E  K+E ++GK   + ETDD      +  D  +     G     
Sbjct: 1000 RRPRHLWK-PEGVGEAEPGKEETREGKAEASEETDDGPRDTERRTDTREARRSPGAESAT 1058

Query: 515  NETPAIP 521
            + TPA P
Sbjct: 1059 SHTPAYP 1065


>gi|307068320|ref|YP_003877286.1| neuraminidase [Streptococcus pneumoniae AP200]
 gi|306409857|gb|ADM85284.1| Neuraminidase (sialidase) [Streptococcus pneumoniae AP200]
          Length = 965

 Score = 43.2 bits (100), Expect = 0.33,   Method: Composition-based stats.
 Identities = 55/224 (24%), Positives = 89/224 (39%), Gaps = 38/224 (16%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 42   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 93

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N +  Q+            LSS L +L  ++NA  +  
Sbjct: 94   DYYARDLENVETVIEKEDVET-NASNGQR----------VDLSSELDKLKKLENA-TVHM 141

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGDPSLMMDYEKVEPS 1038
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D     +     P 
Sbjct: 142  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSDGKQFYNNYNDAPL 198

Query: 1039 DVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSYVN 1082
             V  G              W         P    P+  V  YVN
Sbjct: 199  KVKPG-------------QWNSVTFTVEKPTAELPNGRVRLYVN 229


>gi|301794672|emb|CBW37123.1| sialidase A (neuraminidase A) [Streptococcus pneumoniae INV104]
          Length = 965

 Score = 43.2 bits (100), Expect = 0.33,   Method: Composition-based stats.
 Identities = 55/224 (24%), Positives = 89/224 (39%), Gaps = 38/224 (16%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 42   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 93

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N +  Q+            LSS L +L  ++NA  +  
Sbjct: 94   DYYARDLENVETVIEKEDVET-NASNGQR----------VDLSSELDKLKKLENA-TVHM 141

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGDPSLMMDYEKVEPS 1038
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D     +     P 
Sbjct: 142  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSDGKQFYNNYNDAPL 198

Query: 1039 DVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSYVN 1082
             V  G              W         P    P+  V  YVN
Sbjct: 199  KVKPG-------------QWNSVTFTVEKPTAELPNGRVRLYVN 229


>gi|237650726|ref|ZP_04524978.1| neuraminidase [Streptococcus pneumoniae CCRI 1974]
          Length = 942

 Score = 43.2 bits (100), Expect = 0.33,   Method: Composition-based stats.
 Identities = 55/224 (24%), Positives = 89/224 (39%), Gaps = 38/224 (16%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 19   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 70

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N +  Q+            LSS L +L  ++NA  +  
Sbjct: 71   DYYARDLENVETVIEKEDVET-NASNGQR----------VDLSSELDKLKKLENA-TVHM 118

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGDPSLMMDYEKVEPS 1038
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D     +     P 
Sbjct: 119  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSDGKQFYNNYNDAPL 175

Query: 1039 DVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSYVN 1082
             V  G              W         P    P+  V  YVN
Sbjct: 176  KVKPG-------------QWNSVTFTVEKPTAELPNGRVRLYVN 206


>gi|217039599|gb|ACJ76928.1| neuraminidase A [Streptococcus pneumoniae]
          Length = 980

 Score = 43.2 bits (100), Expect = 0.33,   Method: Composition-based stats.
 Identities = 55/224 (24%), Positives = 89/224 (39%), Gaps = 38/224 (16%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 57   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 108

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N +  Q+            LSS L +L  ++NA  +  
Sbjct: 109  DYYARDLENVETVIEKEDVET-NASNGQR----------VDLSSELDKLKKLENA-TVHM 156

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGDPSLMMDYEKVEPS 1038
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D     +     P 
Sbjct: 157  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSDGKQFYNNYNDAPL 213

Query: 1039 DVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSYVN 1082
             V  G              W         P    P+  V  YVN
Sbjct: 214  KVKPG-------------QWNSVTFTVEKPTAELPNGRVRLYVN 244


>gi|217039587|gb|ACJ76922.1| neuraminidase A [Streptococcus pneumoniae]
          Length = 980

 Score = 43.2 bits (100), Expect = 0.33,   Method: Composition-based stats.
 Identities = 55/224 (24%), Positives = 89/224 (39%), Gaps = 38/224 (16%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 57   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 108

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N +  Q+            LSS L +L  ++NA  +  
Sbjct: 109  DYYARDLENVETVIEKEDVET-NASNGQR----------VDLSSELDKLKKLENA-TVHM 156

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGDPSLMMDYEKVEPS 1038
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D     +     P 
Sbjct: 157  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSDGKQFYNNYNDAPL 213

Query: 1039 DVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSYVN 1082
             V  G              W         P    P+  V  YVN
Sbjct: 214  KVKPG-------------QWNSVTFTVEKPTAELPNGRVRLYVN 244


>gi|217039559|gb|ACJ76908.1| neuraminidase A [Streptococcus pneumoniae]
 gi|217039575|gb|ACJ76916.1| neuraminidase A [Streptococcus pneumoniae]
          Length = 980

 Score = 43.2 bits (100), Expect = 0.33,   Method: Composition-based stats.
 Identities = 55/224 (24%), Positives = 89/224 (39%), Gaps = 38/224 (16%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 57   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 108

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N +  Q+            LSS L +L  ++NA  +  
Sbjct: 109  DYYARDLENVETVIEKEDVET-NASNGQR----------VDLSSELDKLKKLENA-TVHM 156

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGDPSLMMDYEKVEPS 1038
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D     +     P 
Sbjct: 157  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSDGKQFYNNYNDAPL 213

Query: 1039 DVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSYVN 1082
             V  G              W         P    P+  V  YVN
Sbjct: 214  KVKPG-------------QWNSVTFTVEKPTAELPNGRVRLYVN 244


>gi|217039541|gb|ACJ76899.1| neuraminidase A [Streptococcus pseudopneumoniae]
          Length = 980

 Score = 43.2 bits (100), Expect = 0.33,   Method: Composition-based stats.
 Identities = 55/224 (24%), Positives = 89/224 (39%), Gaps = 38/224 (16%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 57   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 108

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N +  Q+            LSS L +L  ++NA  +  
Sbjct: 109  DYYARDLENVETVIEKEDVET-NASNGQR----------VDLSSELDKLKKLENA-TVHM 156

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGDPSLMMDYEKVEPS 1038
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D     +     P 
Sbjct: 157  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSDGKQFYNNYNDAPL 213

Query: 1039 DVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSYVN 1082
             V  G              W         P    P+  V  YVN
Sbjct: 214  KVKPG-------------QWNSVTFTVEKPTAELPNGRVRLYVN 244


>gi|217039537|gb|ACJ76897.1| neuraminidase A [Streptococcus pseudopneumoniae]
 gi|217039539|gb|ACJ76898.1| neuraminidase A [Streptococcus pseudopneumoniae]
          Length = 980

 Score = 43.2 bits (100), Expect = 0.33,   Method: Composition-based stats.
 Identities = 55/224 (24%), Positives = 89/224 (39%), Gaps = 38/224 (16%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 57   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 108

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N +  Q+            LSS L +L  ++NA  +  
Sbjct: 109  DYYARDLENVETVIEKEDVET-NASNGQR----------VDLSSELDKLKKLENA-TVHM 156

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGDPSLMMDYEKVEPS 1038
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D     +     P 
Sbjct: 157  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSDGKQFYNNYNDAPL 213

Query: 1039 DVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSYVN 1082
             V  G              W         P    P+  V  YVN
Sbjct: 214  KVKPG-------------QWNSVTFTVEKPTAELPNGRVRLYVN 244


>gi|217039535|gb|ACJ76896.1| neuraminidase A [Streptococcus mitis]
          Length = 980

 Score = 43.2 bits (100), Expect = 0.33,   Method: Composition-based stats.
 Identities = 55/224 (24%), Positives = 89/224 (39%), Gaps = 38/224 (16%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 57   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 108

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N +  Q+            LSS L +L  ++NA  +  
Sbjct: 109  DYYARDLENVETVIEKEDVET-NASNGQR----------VDLSSELDKLKKLENA-TVHM 156

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGDPSLMMDYEKVEPS 1038
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D     +     P 
Sbjct: 157  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSDGKQFYNNYNDAPL 213

Query: 1039 DVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSYVN 1082
             V  G              W         P    P+  V  YVN
Sbjct: 214  KVKPG-------------QWNSVTFTVEKPTAELPNGRVRLYVN 244


>gi|217039533|gb|ACJ76895.1| neuraminidase A [Streptococcus pseudopneumoniae]
 gi|217039607|gb|ACJ76932.1| neuraminidase A [Streptococcus pneumoniae]
          Length = 980

 Score = 43.2 bits (100), Expect = 0.33,   Method: Composition-based stats.
 Identities = 55/224 (24%), Positives = 89/224 (39%), Gaps = 38/224 (16%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 57   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 108

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N +  Q+            LSS L +L  ++NA  +  
Sbjct: 109  DYYARDLENVETVIEKEDVET-NASNGQR----------VDLSSELDKLKKLENA-TVHM 156

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGDPSLMMDYEKVEPS 1038
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D     +     P 
Sbjct: 157  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSDGKQFYNNYNDAPL 213

Query: 1039 DVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSYVN 1082
             V  G              W         P    P+  V  YVN
Sbjct: 214  KVKPG-------------QWNSVTFTVEKPTAELPNGRVRLYVN 244


>gi|149021212|ref|ZP_01835458.1| sialidase A precursor [Streptococcus pneumoniae SP23-BS72]
 gi|147930313|gb|EDK81297.1| sialidase A precursor [Streptococcus pneumoniae SP23-BS72]
          Length = 942

 Score = 43.2 bits (100), Expect = 0.33,   Method: Composition-based stats.
 Identities = 55/224 (24%), Positives = 89/224 (39%), Gaps = 38/224 (16%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 19   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 70

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N +  Q+            LSS L +L  ++NA  +  
Sbjct: 71   DYYARDLENVETVIEKEDVET-NASNGQR----------VDLSSELDKLKKLENA-TVHM 118

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGDPSLMMDYEKVEPS 1038
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D     +     P 
Sbjct: 119  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSDGKQFYNNYNDAPL 175

Query: 1039 DVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSYVN 1082
             V  G              W         P    P+  V  YVN
Sbjct: 176  KVKPG-------------QWNSVTFTVEKPTAELPNGRVRLYVN 206


>gi|148997745|ref|ZP_01825309.1| sialidase A precursor [Streptococcus pneumoniae SP11-BS70]
 gi|148999059|ref|ZP_01826490.1| sialidase A precursor [Streptococcus pneumoniae SP11-BS70]
 gi|168575118|ref|ZP_02721081.1| neuraminidase [Streptococcus pneumoniae MLV-016]
 gi|147755098|gb|EDK62154.1| sialidase A precursor [Streptococcus pneumoniae SP11-BS70]
 gi|147756244|gb|EDK63286.1| sialidase A precursor [Streptococcus pneumoniae SP11-BS70]
 gi|183578848|gb|EDT99376.1| neuraminidase [Streptococcus pneumoniae MLV-016]
          Length = 942

 Score = 43.2 bits (100), Expect = 0.33,   Method: Composition-based stats.
 Identities = 55/224 (24%), Positives = 89/224 (39%), Gaps = 38/224 (16%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 19   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 70

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N +  Q+            LSS L +L  ++NA  +  
Sbjct: 71   DYYARDLENVETVIEKEDVET-NASNGQR----------VDLSSELDKLKKLENA-TVHM 118

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGDPSLMMDYEKVEPS 1038
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D     +     P 
Sbjct: 119  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSDGKQFYNNYNDAPL 175

Query: 1039 DVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSYVN 1082
             V  G              W         P    P+  V  YVN
Sbjct: 176  KVKPG-------------QWNSVTFTVEKPTAELPNGRVRLYVN 206


>gi|315049833|ref|XP_003174291.1| myosin type-2 heavy chain 2 [Arthroderma gypseum CBS 118893]
 gi|311342258|gb|EFR01461.1| myosin type-2 heavy chain 2 [Arthroderma gypseum CBS 118893]
          Length = 2406

 Score = 43.2 bits (100), Expect = 0.33,   Method: Composition-based stats.
 Identities = 75/312 (24%), Positives = 127/312 (40%), Gaps = 41/312 (13%)

Query: 310  KSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKA 369
            KS  W R    +   +G  TRT G      ++I+QL   A +        +I    R + 
Sbjct: 908  KSSPWWRLFATMKPLLGE-TRTAGEVKKRDEKIQQLEAKAQQ--------DIAERQRIEE 958

Query: 370  ETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADR 429
            + R   + +  V   T E +++  L +    +  Q RE E  +K     AD+E+ E    
Sbjct: 959  DRRKIEAEMHRVRK-TLESERSLALDKEEIFKRLQLREVELSDKLAGAIADQESLE---- 1013

Query: 430  EKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEE-VKDEGKKGKEPGTTET 488
            ++ D+ +  K  I+ E D     L        +L  +++EL+E + D  K+ K   TT +
Sbjct: 1014 DQLDELIAAKKKIEHELDLRRGQLEQAAQIMERLEGEKKELQERISDMEKQLKSVETTHS 1073

Query: 489  DDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLA 548
            +  E+ E  NQ+I  N+L                       +H  ++DKK QD   K L+
Sbjct: 1074 EYDEKIEALNQEI--NTL----------------------NSHLNLKDKKLQDLEAKLLS 1109

Query: 549  SDIGVG-ESDYAGIKLTKKEKELQE-QEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKS 606
            SD  +  E  +   +L   +K++++  E+N  +   I      S   +E       E   
Sbjct: 1110 SDQQLDLELAHTTKELEASKKQIKQLLEDNREIQRQIADLSSTSTGYEELVRRKEGEVAI 1169

Query: 607  LSPDEIKQRFQK 618
            L  D  K  F+K
Sbjct: 1170 LKADLKKHEFEK 1181


>gi|197101627|ref|NP_001127021.1| src substrate cortactin [Pongo abelii]
 gi|55733549|emb|CAH93452.1| hypothetical protein [Pongo abelii]
          Length = 513

 Score = 43.2 bits (100), Expect = 0.33,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 10/75 (13%)

Query: 396 RANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPS 455
           RAN +   + +EQE + KA+ E+A + AKE+ ++E+A + L+E+   K +          
Sbjct: 314 RANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQ---------- 363

Query: 456 VPTHSVKLPPKEEEL 470
            P  S    P EE L
Sbjct: 364 TPPASPAPQPNEERL 378


>gi|301091103|ref|XP_002895743.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gi|262096655|gb|EEY54707.1| conserved hypothetical protein [Phytophthora infestans T30-4]
          Length = 924

 Score = 43.2 bits (100), Expect = 0.33,   Method: Composition-based stats.
 Identities = 29/77 (37%), Positives = 39/77 (50%), Gaps = 6/77 (7%)

Query: 366 RFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADK---- 421
           R++AE R     I           +A  LARA+   E+QR  +EAK + ++EK DK    
Sbjct: 549 RYRAEHRAKKRLIKEKEEEERTAMEAAELARAH--REQQRAREEAKSREEQEKRDKKERR 606

Query: 422 EAKEKADREKADKDLQE 438
           E KEK  REKA +   E
Sbjct: 607 EMKEKLKREKAKQRQAE 623


>gi|25151529|ref|NP_508848.2| Lin-5 (Five) Interacting protein family member (lfi-1)
           [Caenorhabditis elegans]
 gi|21629445|gb|AAM69078.1|U64862_3 Lin-5 (five) interacting protein protein 1, isoform a
           [Caenorhabditis elegans]
          Length = 2396

 Score = 43.2 bits (100), Expect = 0.33,   Method: Composition-based stats.
 Identities = 108/469 (23%), Positives = 195/469 (41%), Gaps = 69/469 (14%)

Query: 99  DTLKRLAETGEVILSDKSDRL--LCRFMDMVETEDEHKINKQVRDALESA---GFDLES- 152
           +T+KR+  TG    +  +D L  L +      +E + +++K++    E +     +LES 
Sbjct: 475 ETIKRMNGTGGAGSASSADLLEELRKIRGGGSSEGDAELHKELMTKYEESIERNIELESR 534

Query: 153 ---TQENIRKVESALINNNMK-----DAFRFL-ELAQKSKETADSHI-IEAIDVGTKLKE 202
              +Q  I ++E+ L  N  K      A + L E+AQ S++  D  + I+     +  K 
Sbjct: 535 GDDSQRKIAELEAELRRNREKLNEAQGALKKLHEMAQDSEKNVDGTVSIKRTRSLSPGKT 594

Query: 203 NTPPT--------TFTSISKVLLKSNNMQDVVFTKIKEVVKKHVNAELGHRKLRGLAFDH 254
             PP+        TF +    + +      +  +++KE + K  NA+   R+L     D 
Sbjct: 595 PLPPSEALRAVRNTFRNKDNDIQQLERKLKIAESQVKEFLNKFENADEARRRL-----DK 649

Query: 255 TYFNDKLNQFLKEIKNHQKEYDESEKGSSKA--RYHAAYAH-IYWDLANDWVNGRVGDKS 311
            + + K     +EI N QK  DE+E+ S +   +  A+ A  +  + A  ++   +    
Sbjct: 650 QFADAK-----REISNLQKSVDEAERNSRRTDDKLRASEAERVAAEKARKFLEDELAKLQ 704

Query: 312 DEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKAET 371
             + ++ST+ A  + R    E    +  +   ++ +L  +V+       +R  NR K+E 
Sbjct: 705 ASFQKSSTDDARKL-RDEMDEHTNSIQEEFKTRIDELNRRVE-----NLLRENNRLKSEV 758

Query: 372 ---RLAYSTIANVANFTS---ELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKE 425
              +  Y  + N  N T    E K+  +    + +   Q+   + +EK DR   D E K 
Sbjct: 759 NPLKDKYRDLENEYNSTQRRIEEKETQIRYSDDIRRNIQKDLDDLREKYDRVHTDNE-KI 817

Query: 426 KADREKADKDL----QEKTPIKAEGDDFGLGLPSVPTHSVKLPPK-EEELEEVKDEGKKG 480
             + E A K      Q+   IK + DD+         H   +  K E E++  +D  K G
Sbjct: 818 LGELEHAQKAAHLAEQQLKEIKIQRDDYQKQKDEHARHLFDIRHKLETEIKGRQDLEKNG 877

Query: 481 KEPGTTETDDREET----------ERKNQDILDNSLLA--GK-THTKNE 516
                 E D   +T           R++ D LD ++    GK TH +NE
Sbjct: 878 AR-NNDELDKLRQTISDYESQINLLRRHNDELDTTIKGHQGKITHLENE 925


>gi|145606216|ref|XP_365754.2| hypothetical protein MGG_02456 [Magnaporthe oryzae 70-15]
 gi|172044424|sp|A4R2R1|NST1_MAGO7 RecName: Full=Stress response protein NST1
 gi|145013935|gb|EDJ98576.1| hypothetical protein MGG_02456 [Magnaporthe oryzae 70-15]
          Length = 1319

 Score = 43.2 bits (100), Expect = 0.34,   Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 34/50 (68%), Gaps = 6/50 (12%)

Query: 399 AQEEKQRREQEAKEKADREKADKEAKEKADRE------KADKDLQEKTPI 442
           A+E K+R  +E KEKAD+E+ +KEAK KA++E      KA++  Q+ T +
Sbjct: 743 ARELKEREARERKEKADKERLEKEAKIKAEKEAREAQRKAERASQKATTL 792


>gi|255716066|ref|XP_002554314.1| KLTH0F02376p [Lachancea thermotolerans]
 gi|238935697|emb|CAR23877.1| KLTH0F02376p [Lachancea thermotolerans]
          Length = 1976

 Score = 42.8 bits (99), Expect = 0.35,   Method: Composition-based stats.
 Identities = 42/170 (24%), Positives = 77/170 (45%), Gaps = 24/170 (14%)

Query: 822 LSSLDVQSKFDSSYSKLFEIFYGD-WTNNAIKEERYWT-----IYAFERSLKNQ------ 869
           ++S+D+QS F+S+  +L++    D     AI E R W      I A   +LK +      
Sbjct: 670 MASVDMQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKADRDNLKEKLSNAEG 729

Query: 870 ---AHLNAEVERLSGLAQQPSDSTADLK----ELQTQLSRAKKYKESNDERIVSFIRSEF 922
                L  EV +   + ++     A L+    E + +L  AK   E    + ++ + S F
Sbjct: 730 GLVGQLQDEVRQRDHILEKSQRVNAQLQHELDESKKKLILAKHEHEVELRKTLTAMNSNF 789

Query: 923 EREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKELNIDN 972
           E       ++ +    ENP P + ++KL   ++ L A+L    KE+N+++
Sbjct: 790 EGS----HNMRDEKGSENPRPLRPERKL-AIQKALQAKLEKTSKEINVES 834


>gi|46691|emb|CAA43604.1| protein A [Staphylococcus aureus]
 gi|384170|prf||1905280A protein A
          Length = 454

 Score = 42.8 bits (99), Expect = 0.35,   Method: Composition-based stats.
 Identities = 58/228 (25%), Positives = 87/228 (38%), Gaps = 31/228 (13%)

Query: 341 QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSE--------LKQAT 392
           + K+L D A   KAD         N+F  E + A+  I ++ N T E        LK   
Sbjct: 212 EAKKLND-AQAPKAD---------NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDP 261

Query: 393 VLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQE--KTPIKAEGDDFG 450
            +++    E K+  + +A ++ D  K  KE   K  +E  +K  +E  K P K +G+  G
Sbjct: 262 SVSKEILAEAKKLNDAQAPKEEDNNKPGKEDNNKPGKEDGNKPGKEDNKKPGKEDGNKPG 321

Query: 451 LGLPSVP-THSVKLPPKEEELEEVKDEGKK-GKE---------PGTTETDDREETERKNQ 499
                 P       P KE+  +  K++G K GKE         PG T  D  +       
Sbjct: 322 KEDNKKPGKEDGNKPGKEDGNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTAD 381

Query: 500 DILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPL 547
            I  ++ LA K   K     +   K P   A        P+   E P 
Sbjct: 382 KIAVDNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEENPF 429


>gi|300118301|ref|ZP_07056048.1| cell wall anchor domain-containing protein [Bacillus cereus SJ1]
 gi|298724270|gb|EFI64965.1| cell wall anchor domain-containing protein [Bacillus cereus SJ1]
          Length = 300

 Score = 42.8 bits (99), Expect = 0.35,   Method: Composition-based stats.
 Identities = 37/163 (22%), Positives = 71/163 (43%), Gaps = 26/163 (15%)

Query: 334 LGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATV 393
           + G T   +  + D +++V AD +        + K+   + +  +++  N + E  Q T+
Sbjct: 93  MAGATSGWLYDVNDQSAEVGADSY--------KLKSGDVVVFRFVSDWNNMSQETLQQTL 144

Query: 394 LARANAQE-EKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLG 452
                 +  E+ + +   +EK +  K D   +EK +  K D   QEK P + + DD    
Sbjct: 145 DKFGTCKTVEEPKTDDPKQEKPEEPKTDDPKQEKPEEPKTDDPKQEK-PEEPKTDD---- 199

Query: 453 LPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETE 495
                       PK+E+ EE K +  K + P  T+T ++ + E
Sbjct: 200 ------------PKQEKPEEPKTDDSKQENPDGTKTPEQPKQE 230


>gi|239925809|gb|ACS35539.1| myosin C [Phaeodactylum tricornutum]
          Length = 1157

 Score = 42.8 bits (99), Expect = 0.35,   Method: Composition-based stats.
 Identities = 61/281 (21%), Positives = 119/281 (42%), Gaps = 60/281 (21%)

Query: 381  VANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKT 440
            V+    E K+A    +   +  + R E+EAKE+ADRE  +K    KA  E+  ++  E  
Sbjct: 866  VSREKKERKEAAKRKKQAEEARRMREEKEAKERADREVREK----KAAAERKRRERAENE 921

Query: 441  PIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQD 500
              + E  DF                 +E+L+++K +  +G E          E +RK+ D
Sbjct: 922  AREREEADF-----------------QEQLDKLKSK-IRGMESSL-------EAKRKDND 956

Query: 501  ILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAG 560
                      +  + E   I   K      HK + ++  +  ++   A+   + ESD   
Sbjct: 957  -------KKISKAEKEVDEIEAEKNELDAKHKKMMEEAAKIPKKDIAANKKKIEESDKIV 1009

Query: 561  IKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQE------KAWDSY-KEWKSLSP--DE 611
              L K+ K++++Q E ++  + +Q+ + Q+  L E       + DS  K+ K+LS   ++
Sbjct: 1010 NYLRKENKKVRDQTEKMK--DDLQELKEQNNRLIEANASAGASLDSLEKQKKNLSTHNEK 1067

Query: 612  IKQRFQKYA-------------KVFYRSYSPVDGSYKGTQE 639
            +++  +KY                +Y++ + +   Y+ T E
Sbjct: 1068 LEENLKKYKAQNAQLKSDLANRNAYYKAETKIRSEYETTME 1108


>gi|73955671|ref|XP_860825.1| PREDICTED: similar to myosin, heavy polypeptide 10, non-muscle
            isoform 7 [Canis familiaris]
          Length = 2006

 Score = 42.8 bits (99), Expect = 0.35,   Method: Composition-based stats.
 Identities = 65/283 (22%), Positives = 119/283 (42%), Gaps = 53/283 (18%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   E+L  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 1006 AEAKIKKMEEEILLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 1060

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTII-------SGSEK 811
            K E  +SD+   L+K  KT  ++ + K +L G   D+  +   L   I       +  E+
Sbjct: 1061 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKVQLAKKEE 1120

Query: 812  ILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERS 865
             LQG      D T    ++L V  +  +  ++L E F  +      K  R        ++
Sbjct: 1121 ELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFESE------KASR-------NKA 1167

Query: 866  LKNQAHLNAEVERLSGLAQQPSDSTADLKELQT-------QLSRAKKYKESNDERIVSFI 918
             K +  L+ E+E L    +   D+TA  +EL+T       +L +A + +  + E  +  +
Sbjct: 1168 EKQKRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEEETRSHEAQIQDM 1227

Query: 919  RSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQL 961
            R      ++EL   +E   +   N  KN++ L+   ++L  ++
Sbjct: 1228 RQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEV 1270


>gi|283959559|ref|ZP_06377000.1| immunoglobulin G binding protein A [Staphylococcus aureus subsp.
           aureus A017934/97]
 gi|283789151|gb|EFC27978.1| immunoglobulin G binding protein A [Staphylococcus aureus subsp.
           aureus A017934/97]
          Length = 512

 Score = 42.8 bits (99), Expect = 0.35,   Method: Composition-based stats.
 Identities = 58/228 (25%), Positives = 87/228 (38%), Gaps = 31/228 (13%)

Query: 341 QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSE--------LKQAT 392
           + K+L D A   KAD         N+F  E + A+  I ++ N T E        LK   
Sbjct: 270 EAKKLND-AQAPKAD---------NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDP 319

Query: 393 VLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQE--KTPIKAEGDDFG 450
            +++    E K+  + +A ++ D  K  KE   K  +E  +K  +E  K P K +G+  G
Sbjct: 320 SVSKEILAEAKKLNDAQAPKEEDNNKPGKEDNNKPGKEDGNKPGKEDNKKPGKEDGNKPG 379

Query: 451 LGLPSVP-THSVKLPPKEEELEEVKDEGKK-GKE---------PGTTETDDREETERKNQ 499
                 P       P KE+  +  K++G K GKE         PG T  D  +       
Sbjct: 380 KEDNKKPGKEDGNKPGKEDGNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTAD 439

Query: 500 DILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPL 547
            I  ++ LA K   K     +   K P   A        P+   E P 
Sbjct: 440 KIAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEENPF 487


>gi|297741865|emb|CBI33245.3| unnamed protein product [Vitis vinifera]
          Length = 870

 Score = 42.8 bits (99), Expect = 0.35,   Method: Composition-based stats.
 Identities = 34/131 (25%), Positives = 56/131 (42%), Gaps = 20/131 (15%)

Query: 389 KQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDD 448
           K+   ++     E+K++R  + +E    EK   E +   D+E   +D QE +P K E   
Sbjct: 736 KEEKSVSEGKQVEDKEKRPSDTEESEKEEKPYSEGRPVEDKEGICQDAQE-SPEKKE--- 791

Query: 449 FGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLA 508
                    ++S     +E E EE K +   G+E    E  D EET+ +N +   N    
Sbjct: 792 ---------SYS-----EEREPEESKRDSPSGEEANKEEQSDSEETQAENLE--SNPTDM 835

Query: 509 GKTHTKNETPA 519
            K+  K   P+
Sbjct: 836 DKSSKKTSDPS 846


>gi|242372426|ref|ZP_04818000.1| triacylglycerol lipase [Staphylococcus epidermidis M23864:W1]
 gi|242349848|gb|EES41449.1| triacylglycerol lipase [Staphylococcus epidermidis M23864:W1]
          Length = 740

 Score = 42.8 bits (99), Expect = 0.35,   Method: Composition-based stats.
 Identities = 43/181 (23%), Positives = 73/181 (40%), Gaps = 35/181 (19%)

Query: 398 NAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVP 457
           +A++  Q   +  KEKA  + A  EA++ A  EKA+           E  D         
Sbjct: 146 DARKTDQTSTENTKEKAQNQNAKTEAEDAAPMEKAEHH---------ESAD--------- 187

Query: 458 THSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNET 517
            +  ++P K E   +      +G +   +ET D+++T+   Q+  D           +ET
Sbjct: 188 -NQTQIPSKTENKSD-----NQGNQVSESETQDKQQTKENAQNSKDEDAQTLTKENTDET 241

Query: 518 PA-------IPTAKAPPAQAHKGIQDKKPQ-DQREKPLASDIGVGESDYAGIKLTKKEKE 569
            +         T K+P A + K   D +P+ D  +K  A D    E+  A  K + + K 
Sbjct: 242 KSSKDTDDTTATVKSPKATSQK---DNQPEADNHQKVTAQDDATSEATLATTKDSDESKS 298

Query: 570 L 570
           L
Sbjct: 299 L 299


>gi|83682337|emb|CAJ28158.1| immunoglobulin G binding protein A precursor [Staphylococcus
           aureus]
          Length = 451

 Score = 42.8 bits (99), Expect = 0.36,   Method: Composition-based stats.
 Identities = 51/204 (25%), Positives = 80/204 (39%), Gaps = 21/204 (10%)

Query: 365 NRFKAETRLAYSTIANVANFTSE--------LKQATVLARANAQEEKQRREQEAKEKADR 416
           N+F  E + A+  I ++ N T E        LK    +++    E K+  + +A ++ D 
Sbjct: 245 NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDN 304

Query: 417 EKADKEAKEKADREKADKDLQE--KTPIKAEGDDFGLGLPSVP-THSVKLPPKEEELEEV 473
           +K  KE   K  +E  +K  +E  K P K +G+  G    + P       P KE+  +  
Sbjct: 305 KKPGKEDGNKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDNNKPGKEDGNKPGKEDNNKPG 364

Query: 474 KDEGKK-GKE---------PGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTA 523
           K++G K GKE         PG T  D  +        I  ++ LA K   K     +   
Sbjct: 365 KEDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIKPGQELVVDK 424

Query: 524 KAPPAQAHKGIQDKKPQDQREKPL 547
           K P   A        P+   E P 
Sbjct: 425 KQPANHADANKAQALPETGEENPF 448


>gi|323491073|ref|ZP_08096265.1| translation initiation factor IF-2 [Vibrio brasiliensis LMG 20546]
 gi|323314737|gb|EGA67809.1| translation initiation factor IF-2 [Vibrio brasiliensis LMG 20546]
          Length = 895

 Score = 42.8 bits (99), Expect = 0.36,   Method: Composition-based stats.
 Identities = 30/70 (42%), Positives = 40/70 (57%), Gaps = 12/70 (17%)

Query: 389 KQATVLARANAQEEKQRREQEAKEKADRE-KADKEAKEKADR---EKADKDLQEK----- 439
           ++A  LA+  A E+ QR   EA+EKA RE  A +EA+EKA R   +KA KD+  K     
Sbjct: 125 REAEELAKREAAEKAQR---EAEEKAKREADAKREAEEKAKRVQADKAKKDMNAKNADAN 181

Query: 440 TPIKAEGDDF 449
           T  K E D+ 
Sbjct: 182 TQAKKEADEL 191


>gi|297298033|ref|XP_002805134.1| PREDICTED: nesprin-2-like [Macaca mulatta]
          Length = 6810

 Score = 42.8 bits (99), Expect = 0.36,   Method: Composition-based stats.
 Identities = 37/129 (28%), Positives = 64/129 (49%), Gaps = 14/129 (10%)

Query: 848  NNAIKEERYWTIYAFERSLKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYK 907
            N  I  +R+ T YA       +  L  ++E    + ++ S    + K+++ QL++  K  
Sbjct: 5649 NKEIHFQRWRTTYALTVKAGEKLLLTTDLETKESVGRRISQLQDNWKDMEPQLAKMIKQF 5708

Query: 908  ESNDERIVSFIRSEFEREIKELKS---VIEADAKENPNPN-----KNQKKLQKTREKLVA 959
            +S  E        + E++IKELKS   V++A + E+P P       N+K+L K  E+ +A
Sbjct: 5709 QSTVE-----TWDQCEKKIKELKSRLQVLKAQS-EDPLPELHEDLHNEKELIKELEQSLA 5762

Query: 960  QLSSRLKEL 968
              +  LKEL
Sbjct: 5763 SWTQNLKEL 5771


>gi|296219015|ref|XP_002755695.1| PREDICTED: src substrate cortactin isoform 3 [Callithrix jacchus]
          Length = 439

 Score = 42.8 bits (99), Expect = 0.37,   Method: Composition-based stats.
 Identities = 35/132 (26%), Positives = 57/132 (43%), Gaps = 11/132 (8%)

Query: 369 AETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKAD 428
           A+   AY     V   TS+    T   RAN +   + +EQE + KA+ E+A + AKE+ +
Sbjct: 217 AQVSSAYQKTVPVEAVTSK----TSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQE 272

Query: 429 REKADKDLQEKTPIKAEGDDFGLG-------LPSVPTHSVKLPPKEEELEEVKDEGKKGK 481
           +E+A + L+E+   K +              LP+ P +    P K E        G + +
Sbjct: 273 QEEARRKLEEQARAKTQTPPSSPPPQPAEERLPTSPVYEDAAPFKAEMTYRSPVSGPEPE 332

Query: 482 EPGTTETDDREE 493
              + E  D  E
Sbjct: 333 PVYSVEATDYRE 344


>gi|323486192|ref|ZP_08091521.1| hypothetical protein HMPREF9474_03272 [Clostridium symbiosum
           WAL-14163]
 gi|323400518|gb|EGA92887.1| hypothetical protein HMPREF9474_03272 [Clostridium symbiosum
           WAL-14163]
          Length = 1405

 Score = 42.8 bits (99), Expect = 0.37,   Method: Composition-based stats.
 Identities = 49/189 (25%), Positives = 87/189 (46%), Gaps = 18/189 (9%)

Query: 16  DQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYIVGPIEQRLKKVSERY 75
           +Q++   E V +TL S ++ ++ L+  II ++S +   K R    +   +QR  + ++ Y
Sbjct: 443 EQNRKEQETVRETLKSKEERLEELQNQIIDYASRMAGQKTR----IAVFDQRENRFNKMY 498

Query: 76  ERVVSRDLTLVIEAGLKDLKEVGDTLKRLAETGEVILSDK-SDRLLCRFMDMVETEDEHK 134
              + R+L    E G          L+ L +  E  L D   +RL  R     ETE++ K
Sbjct: 499 GESLKRNLLGEYEPG---------ALQILLQIYEKTLEDVIKERLTLRQKQETETEEKKK 549

Query: 135 INKQVRDALESAGFDLESTQENIR-KVESALINNNMKDAFRFLELAQKSKETADSHIIEA 193
           + +++ D  +  G + E  +E +R   E     +  +   R+LEL        D+ I++A
Sbjct: 550 LERRLEDLKQELGRNGEEQRELLRIGREYGEELSERRKILRYLELKDSLVFEQDA-ILQA 608

Query: 194 IDVGTKLKE 202
              G KLKE
Sbjct: 609 --SGRKLKE 615


>gi|239995974|ref|ZP_04716498.1| TolA-like protein [Alteromonas macleodii ATCC 27126]
          Length = 297

 Score = 42.8 bits (99), Expect = 0.38,   Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 29/38 (76%)

Query: 394 LARANAQEEKQRREQEAKEKADREKADKEAKEKADREK 431
           L R  AQ+E++R+E+EAK KA+ E+  KEA E+A+ E+
Sbjct: 150 LERLAAQKEQERKEREAKAKAEAERKKKEAAERAEMER 187


>gi|154736692|gb|ABS84873.1| immunoglobulin G binding protein A [Staphylococcus aureus]
 gi|154736694|gb|ABS84874.1| immunoglobulin G binding protein A [Staphylococcus aureus]
 gi|154736710|gb|ABS84882.1| immunoglobulin G binding protein A [Staphylococcus aureus]
          Length = 391

 Score = 42.8 bits (99), Expect = 0.38,   Method: Composition-based stats.
 Identities = 59/243 (24%), Positives = 92/243 (37%), Gaps = 50/243 (20%)

Query: 341 QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSE--------LKQAT 392
           + K+L D A   KAD         N+F  E + A+  I ++ N T E        LK   
Sbjct: 174 EAKKLND-AQAPKAD---------NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDP 223

Query: 393 VLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQE--KTPIKAEGDDFG 450
            +++    E K+  + +A ++ D  K  KE   K  +E  +K  +E  K P K +G+   
Sbjct: 224 SVSKEILAEAKKLNDAQAPKEEDNNKPGKEDNNKPGKEDGNKPGKEDNKKPGKEDGNK-- 281

Query: 451 LGLPSVPTHSVKLPPKEEELEEVKDEGKK-GKE---------PGTTETDDREETERKNQD 500
                        P KE+  +  K++G K GKE         PG T  D  +        
Sbjct: 282 -------------PGKEDGNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADK 328

Query: 501 ILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAG 560
           I  ++ LA K   K     +   K P   A        P+   E P      +G + + G
Sbjct: 329 IAADNKLADKNIIKPGQELVVDKKQPANHADANKAQALPETGEENPF-----IGTTVFGG 383

Query: 561 IKL 563
           + L
Sbjct: 384 LSL 386


>gi|119595176|gb|EAW74770.1| cortactin, isoform CRA_d [Homo sapiens]
          Length = 556

 Score = 42.8 bits (99), Expect = 0.38,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 46/97 (47%), Gaps = 14/97 (14%)

Query: 374 AYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKAD 433
           AY     V   TS+    T   RAN +   + +EQE + KA+ E+A + AKE+ ++E+A 
Sbjct: 339 AYQKTVPVEAVTSK----TSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEAR 394

Query: 434 KDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEEL 470
           + L+E+   K +           P  S    P EE L
Sbjct: 395 RKLEEQARAKTQ----------TPPVSPAPQPTEERL 421


>gi|58390368|ref|XP_317674.2| AGAP007826-PA [Anopheles gambiae str. PEST]
 gi|55237888|gb|EAA12256.2| AGAP007826-PA [Anopheles gambiae str. PEST]
          Length = 1376

 Score = 42.8 bits (99), Expect = 0.38,   Method: Composition-based stats.
 Identities = 51/242 (21%), Positives = 104/242 (42%), Gaps = 33/242 (13%)

Query: 566  KEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLS-PDEIKQRFQKYA---K 621
            K++E++ +  ++ VA + QQ     E +    W + +  ++ S P++++    K A   +
Sbjct: 808  KQQEMELKRMHMDVASLTQQMPRLKEQVD---WQAERVARTHSDPEKVRALEAKVAECKQ 864

Query: 622  VFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSPLGLMYEKDELHGVEA 681
             F  S +  D   K      + IN   ++     ++    ++ + LG   +K     + A
Sbjct: 865  AFDSSSTKADAMQKNVDRYTEQINEITNS-----KVKVLQTKINGLGKQIDK-----LSA 914

Query: 682  VYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGESSVRK----------------HSFEV 725
               KL V  +    N++ +K+ +++M   VEA +S++RK                   E 
Sbjct: 915  NISKLTVEIKTSERNVQKSKDKINSMEDEVEAAQSAIRKGNDERTQLEEEANKLREELEE 974

Query: 726  LSSKHQKSVIAVNNFIKEITHHTRRLVKEDPKRGKSESYLSDIRSELQKVNKTVMDIRIK 785
            +    +K+    ++  KEI    +R  +   KR + E  L  I ++LQ+   T+   R K
Sbjct: 975  MKLAIEKAHEGSSSIKKEIVALQKREAEGKMKRLEFEQILQTIETKLQETKDTLPHWRDK 1034

Query: 786  LR 787
            L+
Sbjct: 1035 LK 1036


>gi|270156856|ref|ZP_06185513.1| hypothetical protein LLB_0292 [Legionella longbeachae D-4968]
 gi|289164706|ref|YP_003454844.1| Hypothetical protein, weakly similar to eukaryotic proteins
           [Legionella longbeachae NSW150]
 gi|269988881|gb|EEZ95135.1| hypothetical protein LLB_0292 [Legionella longbeachae D-4968]
 gi|288857879|emb|CBJ11731.1| Hypothetical protein, weakly similar to eukaryotic proteins
           [Legionella longbeachae NSW150]
          Length = 772

 Score = 42.8 bits (99), Expect = 0.38,   Method: Composition-based stats.
 Identities = 40/169 (23%), Positives = 71/169 (42%), Gaps = 18/169 (10%)

Query: 827 VQSKFDSSYSKLFE------IFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAEVERLS 880
           +Q K+D S     E      IF        +  +R+W  Y       N+  +N   + L 
Sbjct: 380 IQQKYDESRKPFHEKQKRMAIFSKFMKQIPLNMDRFWINYP------NEKKMNQLCDDL- 432

Query: 881 GLAQQPSDSTADLKELQTQLSR--AKKYKESNDERIVSFIRSEFEREIKELKSVIEADAK 938
           GL          L  +++ L     KK+       +   + S   +EI+   S +++D +
Sbjct: 433 GLEPDSIQREQLLTHVRSSLGSYLNKKFNPWGPPTLPDILHS---KEIEAANSKVQSDLE 489

Query: 939 ENPNPNKNQKKLQKTREKLVAQLSSRLKELNIDNAYGLWNEYKEDFKAS 987
           ++  P  NQKK  +  EK + QL S L E++ID   G   ++++   +S
Sbjct: 490 QSLTPFTNQKKQIEELEKELKQLDSTLPEISIDEWIGSQQQFQQSINSS 538


>gi|291220978|ref|XP_002730500.1| PREDICTED: AT-rich interactive domain-containing protein 4B-like
            [Saccoglossus kowalevskii]
          Length = 1433

 Score = 42.8 bits (99), Expect = 0.38,   Method: Composition-based stats.
 Identities = 50/187 (26%), Positives = 82/187 (43%), Gaps = 24/187 (12%)

Query: 413  KADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEE 472
            K  +EK  K  KEKA +   DK+L+EK  ++AE         S+     +   K+EE   
Sbjct: 854  KPVKEKISKSQKEKAAKVSKDKELEEKKHVEAE---------SIKDEESEKMIKQEERRR 904

Query: 473  VKDE---GKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQ 529
             + E    KK K P T E   +++ +    ++   S    K   K  T  I  A+    Q
Sbjct: 905  DRKEAMLAKKEKSP-TPEPSKKDKVQESVTEVKAKSESKAKEDKKESTGKI-RARKEKKQ 962

Query: 530  AHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQ 589
            + +G   ++  D  EK   S     +S  A     KK+KE   +E +    E +++S+ +
Sbjct: 963  SLEGRNKREKHDTAEKKENSK----KSSEA-----KKDKESTSRELDF-TNEFVEESKAE 1012

Query: 590  SEDLQEK 596
            + + QEK
Sbjct: 1013 TMEKQEK 1019


>gi|290992083|ref|XP_002678664.1| predicted protein [Naegleria gruberi]
 gi|284092277|gb|EFC45920.1| predicted protein [Naegleria gruberi]
          Length = 561

 Score = 42.8 bits (99), Expect = 0.38,   Method: Composition-based stats.
 Identities = 60/262 (22%), Positives = 104/262 (39%), Gaps = 54/262 (20%)

Query: 393 VLARANAQEEKQRRE---QEAKEKADREKADKEAKEK-----ADREKADKDLQEKTPIKA 444
           V +  NA  +K  +E    + KE+ +R +  K  +E+      D++   + +    P+K 
Sbjct: 69  VFSSVNASTKKALKEFVFLKQKEQIERAQIKKMLEERNAQLLIDKKNRRRKVPNSIPLKQ 128

Query: 445 EGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDN 504
           E +      P + T      PK +++E +         P  T   +R+   +K   I  N
Sbjct: 129 EQNSVKFEPPQIET------PKPKQVEIL---------PEPTPQPNRKSIPQKKATIAQN 173

Query: 505 SLLAGK------THTKNETPA----IPTAKAPPAQAHKGIQD-----KKPQDQREKPLAS 549
           S  A K       + KN+TP     IP    P +   K ++D     +K + + E+P   
Sbjct: 174 STPAKKGTVSKTVNEKNKTPPVESNIPEKPKPVSNQKKKLEDILAMARKIRTREEEPATR 233

Query: 550 DIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSP 609
            +   E  Y  I+  +K+   +E E        IQQS               +E   LS 
Sbjct: 234 TVVENEEKYVNIEPVQKQILNEETEPEEEPQNSIQQS---------------EEEPKLSF 278

Query: 610 DEIKQRFQKYAKVFYRSYSPVD 631
             I +RFQ +  V  +S++ V+
Sbjct: 279 VTIDERFQHFVSVL-QSFNDVN 299


>gi|118379597|ref|XP_001022964.1| TPR Domain containing protein [Tetrahymena thermophila]
 gi|89304731|gb|EAS02719.1| TPR Domain containing protein [Tetrahymena thermophila SB210]
          Length = 2086

 Score = 42.8 bits (99), Expect = 0.39,   Method: Composition-based stats.
 Identities = 51/273 (18%), Positives = 124/273 (45%), Gaps = 32/273 (11%)

Query: 387  ELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEG 446
            +L++A    +    EEK+++++  +++  +E  DK+ +++A+ +K  ++ +EK  I+   
Sbjct: 839  KLQEAEERKKQQEAEEKRKQQEAEEKRKQQEAEDKKRQQEAEEKKKQQEAEEKKKIQE-- 896

Query: 447  DDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDR-EETERKNQDILDNS 505
                          +KL  + EE +++++  +K K+    E   + E  E+K Q  +D+ 
Sbjct: 897  -----------AEELKLKQQAEENKKLQEAQEKQKQHEAEERKKQLEAEEKKKQQEMDDK 945

Query: 506  LLAGKTHTKNETPAIPTAKAPPAQAHKGIQD------KKPQDQREKPLASDIGVGESD-Y 558
                +     +       +      +K IQD      ++ Q+ + K L ++    +++  
Sbjct: 946  KKKQEEEELKKKQQQDEQQKLLEVQNKKIQDEEMKKNQETQNDKNKQLKNEQSSDKNNQI 1005

Query: 559  AGIKLTKKEKELQEQ---EENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQR 615
             GI+L + EK   E    ++N++ +E   + +++S +   +        KS+S   ++Q+
Sbjct: 1006 VGIELDQNEKNKGEHSLNKQNIKNSENDNKKQIESNNQNTQN-------KSISAQNVQQK 1058

Query: 616  FQKYAKVFYRSYSPVDGSYKG-TQESDKAINHF 647
              + +    ++    + S K  +QE+ K  N  
Sbjct: 1059 ESQSSAEVNQTAKVQEASVKSESQENQKNKNQL 1091


>gi|118359597|ref|XP_001013038.1| Leucine Rich Repeat family protein [Tetrahymena thermophila]
 gi|89294805|gb|EAR92793.1| Leucine Rich Repeat family protein [Tetrahymena thermophila SB210]
          Length = 5099

 Score = 42.8 bits (99), Expect = 0.39,   Method: Composition-based stats.
 Identities = 57/254 (22%), Positives = 100/254 (39%), Gaps = 68/254 (26%)

Query: 407  EQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPK 466
            + ++ EK D+E  +    E+ + E+   + Q+   +K++G+DF                +
Sbjct: 3814 QNQSDEKIDQEDQEINNFEQENDEEQHLNSQQNEDVKSDGEDF---------------QQ 3858

Query: 467  EEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAP 526
            +++ +E+KDE  K    G  ++   +E +R N                            
Sbjct: 3859 KQKQDEIKDEENKFLSNGDNQSQREQEQKRDND--------------------------- 3891

Query: 527  PAQAHKGIQDKKPQDQREKPLA-----SDIGVGESDYAGIKLTKKEKELQEQEEN----L 577
              QA   I D+K QD  +  L+     +D      +   I    K  E QE +E     +
Sbjct: 3892 --QASDRISDEKNQDIDQNILSQQNEKADENEKAEENEKIDENDKVDEQQEGQETTTSKM 3949

Query: 578  RVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSYKGT 637
            +  + IQ+ +  S +  EK  D+ K   SL  D++KQ+   Y K+      P D SY  +
Sbjct: 3950 QTYQTIQKLKFGSTN--EK--DNLKGALSLE-DDLKQQNNIYKKIVL----PQDSSYINS 4000

Query: 638  ------QESDKAIN 645
                  Q  +K IN
Sbjct: 4001 ANAAIQQSENKTIN 4014


>gi|332259365|ref|XP_003278758.1| PREDICTED: mitotic spindle assembly checkpoint protein MAD1-like
           [Nomascus leucogenys]
          Length = 1272

 Score = 42.8 bits (99), Expect = 0.39,   Method: Composition-based stats.
 Identities = 50/199 (25%), Positives = 90/199 (45%), Gaps = 25/199 (12%)

Query: 403 KQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVK 462
           + ++ QEA +K    +A +EA+  AD E+  KDL++K  ++ +  D  + + ++ +  V+
Sbjct: 269 QHKKCQEANQKIQELQASQEAR--ADHEQQIKDLEQKLSLQEQ--DAAI-VKNMKSELVR 323

Query: 463 LPPKEEELEEVKDEGKKGKEPGTTETDDREETE---RK--NQDILDNSLLAGKTHTKNET 517
           LP  E EL+++++E  + +E   T    +EE E   RK   Q+ +  +L+      +NE 
Sbjct: 324 LPRLERELKQLREESARLREMRETNGLLQEELEGLQRKLGRQEKMQETLVG--LELENER 381

Query: 518 PAIPTAKAPPAQAHKGIQDKKPQD---------QREKPLASDIGVGESDYAGIKLTKKEK 568
                          G+  + P+D         QRE  L        S   G++  +   
Sbjct: 382 LLAKLQSWERLDQTTGLSIRTPEDLSRFVVELQQRELALKDKNSAVTSSSRGLEQGRH-- 439

Query: 569 ELQEQEENLRVAEIIQQSR 587
             Q QEE   V+  I +SR
Sbjct: 440 --QLQEEVNSVSGCINRSR 456


>gi|242220203|ref|XP_002475871.1| predicted protein [Postia placenta Mad-698-R]
 gi|220724928|gb|EED78941.1| predicted protein [Postia placenta Mad-698-R]
          Length = 498

 Score = 42.8 bits (99), Expect = 0.39,   Method: Composition-based stats.
 Identities = 37/145 (25%), Positives = 58/145 (40%), Gaps = 9/145 (6%)

Query: 364 GNRFKAETRLAYSTIANVAN-------FTSELKQATVLARANAQEEKQR-REQEAKEKAD 415
           GN F     L     A  AN          EL+     A + A++ ++R R  EA+EK  
Sbjct: 72  GNEFSTILTLVRGMQAARANKEITPNPIMEELEARAREADSRARKAEERVRAAEAREKES 131

Query: 416 REK-ADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVK 474
           R+K A + AKE A R++ D+   E    KAE D+         T       +E      +
Sbjct: 132 RQKEARRAAKENAKRDEQDRAFAESAKRKAESDEASRQKTRAETQRKAAAAEESRRRVAE 191

Query: 475 DEGKKGKEPGTTETDDREETERKNQ 499
           DE ++       E   R+   ++ +
Sbjct: 192 DEQRRESARTVAEEQARQAKPKEKK 216


>gi|587474|emb|CAA55207.1| membrane protein [Mycoplasma hominis]
          Length = 1079

 Score = 42.8 bits (99), Expect = 0.39,   Method: Composition-based stats.
 Identities = 90/407 (22%), Positives = 160/407 (39%), Gaps = 89/407 (21%)

Query: 1   MNELATSIDYQTN----NLDQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDR 56
           +N+   S++ Q N    N  +D+    D+ K L   ++N K + E            K++
Sbjct: 35  LNKKIESLEKQLNEAKANSQKDQAQINDLMKQLQETKNNSKTIEE------------KEK 82

Query: 57  YDYIVGPIEQRLKKVSE----RYERVVSRDLTLVIEA--GLKDLKEVGDTLKRLAE--TG 108
              +V  +++ L K+ +    +Y+  ++     ++E     K+L++  D LK   E  + 
Sbjct: 83  ---LVKKLQEDLNKIQQERTAKYQTELNAANKAIVEIPNKYKELEQKNDDLKDQLENLSK 139

Query: 109 EVILSDKSDRLLCRFMDMVETEDEHKINKQVRDALESAGFDLESTQENIRKVESAL--IN 166
           E++ S    R L      ++T  E    KQ+   L     DL   +  + K+   L  +N
Sbjct: 140 ELVPSRMQSRSL---EGKIKTSSEKA--KQLEQELTKNETDLGGLKSQLDKLNEDLKALN 194

Query: 167 NNMKDAFRFLELAQKSKETADSHIIEAIDVGTKLKENTPPTTFTSISKVLLKSNNMQDVV 226
               D  +  E+  K K+      I+A ++  K  E               K+N +Q  +
Sbjct: 195 KANTDGSKNAEIEAKYKD------IDAQNLKIKTAEE--------------KNNKLQKEL 234

Query: 227 FTKIKEVVKKHVNAELGHRKLRGLAFDHTYFNDKLNQFLKEIKNHQKEYDESEKGS---- 282
            TK  E++KK         K+  L  +    +++++   KE++   KEY +S K S    
Sbjct: 235 KTKKDEIIKKTSEKSKLDLKIAELETNKNKVSEQIDANKKELEALNKEYADSVKKSDELS 294

Query: 283 ---------SKARYHAAYAHIYW---DLANDWVNGRVGDKSDEWARTSTNIASWIGRITR 330
                    S A   AA  HI     DL N+  N ++ D S   A  S  I+   G+   
Sbjct: 295 KLLSKENDNSPASQEAAARHILELKDDLENELENAKLDDISAPTAEQSKKISEIYGKYI- 353

Query: 331 TEGLGGVTYDQIKQLRD-------LASKVKADYHW--AEIRHGNRFK 368
                    ++I ++ D       LA K    Y W  A+  H N+ +
Sbjct: 354 ---------EKISKINDASLTSDSLAWKYAIKYDWEIAKGHHDNQLR 391


>gi|126343507|ref|XP_001365825.1| PREDICTED: hypothetical protein [Monodelphis domestica]
          Length = 1176

 Score = 42.8 bits (99), Expect = 0.40,   Method: Composition-based stats.
 Identities = 67/288 (23%), Positives = 121/288 (42%), Gaps = 55/288 (19%)

Query: 692 HCIENLRANKNA-VDAMSKAVEAGESSVRKHSFEVLSS--KHQKSV-IAVNNFIKEITHH 747
           H +E    N+ A + A  + V + E  VR++  E + S  +H K + I V N  KEI   
Sbjct: 666 HNLEKDMENRMARLSAFQEQVRSLEKDVRENR-ETIDSHYRHLKEIKINVINITKEI--- 721

Query: 748 TRRLVKEDPKRGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLYTIIS 807
            R L  E+  R  S S L D   E Q+ N+ +  +R KL+     QD+   + P      
Sbjct: 722 -RDLEDEEDSRAISLSVLED---EAQEYNEELKRVREKLKARN--QDLESLRKP------ 769

Query: 808 GSEKILQGDYTFPPLSSLDVQSKFD------SSYSKLFEIFYGDWTNNAIKEERYWTIYA 861
                            L+ + +F+      +  S+L E         ++ EE+  T+  
Sbjct: 770 ----------------KLEAEERFEELTLRCNQVSELME---------SLIEEQNQTVLE 804

Query: 862 FERSLKNQAHLNAEV-ERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRS 920
            E   ++  H +  + E L  L  +  +     +EL+ + ++A       + +IV+   S
Sbjct: 805 VEAKHQSMLHYDCRLKEHLDSLQVKKEEMAMKERELERETAQAIYI--CPERKIVTKSAS 862

Query: 921 EFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL 968
              REI  LK  I+++   + N     ++ Q+ +E+ +  L  ++K L
Sbjct: 863 VLSREINALKERIQSENYTHRNREDVMRQYQEAKERYL-DLDGKVKNL 909


>gi|156045565|ref|XP_001589338.1| hypothetical protein SS1G_09973 [Sclerotinia sclerotiorum 1980]
 gi|154694366|gb|EDN94104.1| hypothetical protein SS1G_09973 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 583

 Score = 42.8 bits (99), Expect = 0.41,   Method: Composition-based stats.
 Identities = 41/142 (28%), Positives = 58/142 (40%), Gaps = 24/142 (16%)

Query: 402 EKQRREQEAKEKADREKADKEAKEKADREKADK----------DLQEKTPIKAEGDDFG- 450
           +++    E  E+ + E+ D E     D  KAD            L +KT +K E DD G 
Sbjct: 396 KEEEPSSEMIEELELEQEDSETVIHDDDSKADSTGSWDSMSGDSLGDKTEVKQENDDTGE 455

Query: 451 -LGLPSVPTHSVKLPPKEEEL----EEVKDEGKKGKEPGTTETDDREETERKNQDILDNS 505
               P V     +L P  E +     E   E K   EP +TET    + E++ Q+  DNS
Sbjct: 456 EKAEPVVKEPVTELKPGAEAVPVPETEPIPESKLESEPPSTETGGEADEEQEVQEQKDNS 515

Query: 506 LLAGKTHTKNETPAIPTAKAPP 527
             +   HT       P  +APP
Sbjct: 516 --SEDEHTS------PPKEAPP 529


>gi|301800502|emb|CBW33141.1| sialidase A (neuraminidase A) [Streptococcus pneumoniae OXC141]
          Length = 1020

 Score = 42.8 bits (99), Expect = 0.41,   Method: Composition-based stats.
 Identities = 55/224 (24%), Positives = 88/224 (39%), Gaps = 38/224 (16%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 42   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 93

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N +  Q+            LSS L +L  ++NA  +  
Sbjct: 94   DYYARDLENVETVIEKEDVET-NASNGQR----------VDLSSELDKLKKLENA-TVHM 141

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGDPSLMMDYEKVEPS 1038
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D     +     P 
Sbjct: 142  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSDGKQFYNNYNDAPL 198

Query: 1039 DVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSYVN 1082
             V  G              W         P    P   V  YVN
Sbjct: 199  KVKPG-------------QWNSVTFTVEKPTAELPKGRVRLYVN 229


>gi|169833592|ref|YP_001695070.1| neuraminidase [Streptococcus pneumoniae Hungary19A-6]
 gi|168996094|gb|ACA36706.1| neuraminidase [Streptococcus pneumoniae Hungary19A-6]
          Length = 942

 Score = 42.8 bits (99), Expect = 0.41,   Method: Composition-based stats.
 Identities = 55/224 (24%), Positives = 88/224 (39%), Gaps = 38/224 (16%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 19   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 70

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N +  Q+            LSS L +L  ++NA  +  
Sbjct: 71   DYYARDLENVETVIEKEDVET-NASNGQR----------VDLSSELDKLKKLENA-TVHM 118

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGDPSLMMDYEKVEPS 1038
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D     +     P 
Sbjct: 119  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSDGKQFYNNYNDAPL 175

Query: 1039 DVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSYVN 1082
             V  G              W         P    P   V  YVN
Sbjct: 176  KVKPG-------------QWNSVTFTVEKPTAELPKGRVRLYVN 206


>gi|168491425|ref|ZP_02715568.1| neuraminidase [Streptococcus pneumoniae CDC0288-04]
 gi|183574245|gb|EDT94773.1| neuraminidase [Streptococcus pneumoniae CDC0288-04]
          Length = 942

 Score = 42.8 bits (99), Expect = 0.41,   Method: Composition-based stats.
 Identities = 55/224 (24%), Positives = 88/224 (39%), Gaps = 38/224 (16%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 19   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 70

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N +  Q+            LSS L +L  ++NA  +  
Sbjct: 71   DYYARDLENVETVIEKEDVET-NASNGQR----------VDLSSELDKLKKLENA-TVHM 118

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGDPSLMMDYEKVEPS 1038
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D     +     P 
Sbjct: 119  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSDGKQFYNNYNDAPL 175

Query: 1039 DVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSYVN 1082
             V  G              W         P    P   V  YVN
Sbjct: 176  KVKPG-------------QWNSVTFTVEKPTAELPKGRVRLYVN 206


>gi|116517141|ref|YP_816960.1| sialidase A precursor [Streptococcus pneumoniae D39]
 gi|148984134|ref|ZP_01817429.1| sialidase A precursor [Streptococcus pneumoniae SP3-BS71]
 gi|116077717|gb|ABJ55437.1| sialidase A precursor [Streptococcus pneumoniae D39]
 gi|147923423|gb|EDK74536.1| sialidase A precursor [Streptococcus pneumoniae SP3-BS71]
          Length = 997

 Score = 42.8 bits (99), Expect = 0.41,   Method: Composition-based stats.
 Identities = 55/224 (24%), Positives = 88/224 (39%), Gaps = 38/224 (16%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 19   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 70

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N +  Q+            LSS L +L  ++NA  +  
Sbjct: 71   DYYARDLENVETVIEKEDVET-NASNGQR----------VDLSSELDKLKKLENA-TVHM 118

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGDPSLMMDYEKVEPS 1038
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D     +     P 
Sbjct: 119  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSDGKQFYNNYNDAPL 175

Query: 1039 DVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSYVN 1082
             V  G              W         P    P   V  YVN
Sbjct: 176  KVKPG-------------QWNSVTFTVEKPTAELPKGRVRLYVN 206


>gi|15903579|ref|NP_359129.1| sialidase A precursor (neuraminidase A) [Streptococcus pneumoniae R6]
 gi|50402230|sp|P62575|NANA_STRPN RecName: Full=Sialidase A; AltName: Full=Neuraminidase A; Flags:
            Precursor
 gi|50402231|sp|P62576|NANA_STRR6 RecName: Full=Sialidase A; AltName: Full=Neuraminidase A; Flags:
            Precursor
 gi|587553|emb|CAA51473.1| neuraminidase [Streptococcus pneumoniae]
 gi|15459200|gb|AAL00340.1| Sialidase A precursor (neuraminidase A) [Streptococcus pneumoniae R6]
 gi|217039549|gb|ACJ76903.1| neuraminidase A [Streptococcus pneumoniae]
 gi|217039573|gb|ACJ76915.1| neuraminidase A [Streptococcus pneumoniae]
 gi|217039591|gb|ACJ76924.1| neuraminidase A [Streptococcus pneumoniae OXC141]
 gi|217039593|gb|ACJ76925.1| neuraminidase A [Streptococcus pneumoniae]
          Length = 1035

 Score = 42.8 bits (99), Expect = 0.41,   Method: Composition-based stats.
 Identities = 55/224 (24%), Positives = 88/224 (39%), Gaps = 38/224 (16%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 57   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 108

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N +  Q+            LSS L +L  ++NA  +  
Sbjct: 109  DYYARDLENVETVIEKEDVET-NASNGQR----------VDLSSELDKLKKLENA-TVHM 156

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGDPSLMMDYEKVEPS 1038
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D     +     P 
Sbjct: 157  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSDGKQFYNNYNDAPL 213

Query: 1039 DVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSYVN 1082
             V  G              W         P    P   V  YVN
Sbjct: 214  KVKPG-------------QWNSVTFTVEKPTAELPKGRVRLYVN 244


>gi|111656945|ref|ZP_01407762.1| hypothetical protein SpneT_02001817 [Streptococcus pneumoniae TIGR4]
          Length = 785

 Score = 42.8 bits (99), Expect = 0.41,   Method: Composition-based stats.
 Identities = 55/224 (24%), Positives = 88/224 (39%), Gaps = 38/224 (16%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 42   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 93

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N +  Q+            LSS L +L  ++NA  +  
Sbjct: 94   DYYARDLENVETVIEKEDVET-NASNGQR----------VDLSSELDKLKKLENA-TVHM 141

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGDPSLMMDYEKVEPS 1038
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D     +     P 
Sbjct: 142  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSDGKQFYNNYNDAPL 198

Query: 1039 DVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSYVN 1082
             V  G              W         P    P   V  YVN
Sbjct: 199  KVKPG-------------QWNSVTFTVEKPTAELPKGRVRLYVN 229


>gi|325120690|emb|CBZ56245.1| putative flap endonuclease-1 [Neospora caninum Liverpool]
          Length = 545

 Score = 42.8 bits (99), Expect = 0.41,   Method: Composition-based stats.
 Identities = 25/93 (26%), Positives = 49/93 (52%), Gaps = 12/93 (12%)

Query: 407 EQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPK 466
           E+ AK++  R++ + E  +KA  E A+K+ + +TP K E           P    +    
Sbjct: 408 EERAKKRVKRDETESEGAKKAATE-AEKESETETPEKTE-----------PKDETEKTEA 455

Query: 467 EEELEEVKDEGKKGKEPGTTETDDREETERKNQ 499
           +E+ +  K+E ++G++   TE  D+E TE +++
Sbjct: 456 KEDTKTAKEEKEQGEKTEETEKVDKEATENESK 488


>gi|291222520|ref|XP_002731264.1| PREDICTED: LPS-responsive beige-like anchor-like [Saccoglossus
            kowalevskii]
          Length = 2956

 Score = 42.8 bits (99), Expect = 0.42,   Method: Composition-based stats.
 Identities = 53/237 (22%), Positives = 91/237 (38%), Gaps = 30/237 (12%)

Query: 379  ANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQE 438
            A V   ++     T L   +A  E+     +A   A+  + +K   E+ D  + + DL +
Sbjct: 1044 AQVERTSNNDANTTNLTSVDASHERN----DASVIAESSQKNKPKDEQVDSMEKEADLGD 1099

Query: 439  KTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKN 498
            +T +                   KL  +E++L E  D      EP  +   D   T  K 
Sbjct: 1100 ETKVI----------------ETKLVGEEKQLAEEADS--SAAEPSLSSHSD---TVGKK 1138

Query: 499  QDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDY 558
             D ++          K+ET A    K   A +H  ++  K  D+R    AS   +   D 
Sbjct: 1139 TDKVEEDKAGDNAGDKSETSAKADKKVDAASSHVSLEGNKLDDERNAAEAS--AISSEDN 1196

Query: 559  AGIKLTKKEKELQE-QEENLRVAEIIQQSRMQSEDL--QEKAWDSYKEWKSLSPDEI 612
              I + ++  E+ E  E+N      +++    SE +  Q+ +  S  E  S +PD I
Sbjct: 1197 VTIPVVEEHTEVPEASEDNTAKVTTLEEHSKISEAVCNQDNSHVSMVEEHSKAPDNI 1253


>gi|289583151|ref|YP_003481617.1| chromosome segregation ATPase-like protein [Natrialba magadii ATCC
           43099]
 gi|289532704|gb|ADD07055.1| Chromosome segregation ATPase-like protein [Natrialba magadii ATCC
           43099]
          Length = 1153

 Score = 42.8 bits (99), Expect = 0.42,   Method: Composition-based stats.
 Identities = 43/167 (25%), Positives = 83/167 (49%), Gaps = 19/167 (11%)

Query: 1   MNELATSIDYQTNNLDQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYI 60
           M+EL T+++   ++LD+     E   +TL  ++D +  L +   A +++++  + R D +
Sbjct: 607 MSELGTTLEDLASDLDETVAELETDRETLADLEDTVADLAD-ESATTAEVDALESRVDAV 665

Query: 61  VGPIEQRLKKVSERY---ERVVSRDLTLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSD 117
              I+  L+ VSER    E  V+ D+   ++A   ++ E  ++++   E+ E  L+ + D
Sbjct: 666 DETIDDELESVSERVGSAESAVA-DVEADLDAHAAEIAETVNSIEDALESTEEALASRLD 724

Query: 118 RLLCRFMDMVETEDEHKINKQVRDALESAGFDLESTQENI-RKVESA 163
                     ETE       +  DALES    L+ T+ N+  ++ESA
Sbjct: 725 ----------ETEAAVSTQAEDVDALESR---LDETESNLGSRIESA 758


>gi|221056294|ref|XP_002259285.1| hypothetical protein, conserved in Plasmodium species [Plasmodium
            knowlesi strain H]
 gi|193809356|emb|CAQ40058.1| hypothetical protein, conserved in Plasmodium species [Plasmodium
            knowlesi strain H]
          Length = 2293

 Score = 42.8 bits (99), Expect = 0.42,   Method: Composition-based stats.
 Identities = 37/113 (32%), Positives = 50/113 (44%), Gaps = 24/113 (21%)

Query: 407  EQEAKEKADREKADKEA--KEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLP 464
            ++E KE AD+E ADKE   KE  D+E+ DK+  +K  +  EG D                
Sbjct: 1057 KEEIKEGADKEGADKEGTDKEGVDKEEVDKEEVDKEGVDKEGVD---------------- 1100

Query: 465  PKEEELEEVKDEGKKGKEPGTTETDD-REETERKNQDILDNSLLAGKTHTKNE 516
             KEE  EE  D+ K  +E     T+   E TE  N    D   +     T+NE
Sbjct: 1101 -KEEVTEEGADKEKVDEEEVNVVTEQVTEPTETMN----DAPPVVASMATENE 1148


>gi|170086095|ref|XP_001874271.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164651823|gb|EDR16063.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 1626

 Score = 42.8 bits (99), Expect = 0.43,   Method: Composition-based stats.
 Identities = 58/243 (23%), Positives = 90/243 (37%), Gaps = 46/243 (18%)

Query: 395 ARANAQEEKQRREQEA-KEKADREKADKEAKEKADREKADKDLQEKTPIKAE---GDDFG 450
           ARA  + +++  E+EA KE+A R+ A+ E K KA+ EKA +      P  A+   G+D  
Sbjct: 616 ARAKQRRQQEEAEREAQKERARRKAAELEEKMKAEAEKAKQKESHDAPTTAQVSIGEDVV 675

Query: 451 LGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGK 510
           + +                +EE        K P  T    R    R +     + LL+  
Sbjct: 676 IAV----------------IEEAVKSVTASKSP--TSESSRLIPSRASVATPTSPLLSPA 717

Query: 511 THTKNETPAI-PTAKAPPAQAHKGIQDK----KPQDQREKPLASDIGVGESD-------- 557
           T T +    + P     P+   + IQ +             L   I  G ++        
Sbjct: 718 TQTSSWRVKVNPQPLPSPSSTLRQIQPRPPAPSFHPPPRSALEESIADGANEDLEVVDFS 777

Query: 558 ----YAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIK 613
               + GI   KKE    E E NL  A + + SR  + D  E    S     +++P   K
Sbjct: 778 DMGKFVGIPEAKKES--SETEFNLSAAAVQRTSRAVASDFFEDKLTS-----TIAPAPTK 830

Query: 614 QRF 616
             F
Sbjct: 831 TDF 833


>gi|319898337|ref|YP_004158430.1| translation initiation factor IF-2 [Bartonella clarridgeiae 73]
 gi|319402301|emb|CBI75840.1| translation initiation factor IF-2 [Bartonella clarridgeiae 73]
          Length = 847

 Score = 42.8 bits (99), Expect = 0.44,   Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 45/90 (50%), Gaps = 9/90 (10%)

Query: 386 SELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAE 445
           S L  A + AR  A EE   +E+  ++KA++EK DKE +E    +       ++T I  E
Sbjct: 86  SNLSSAEIEARRRALEEAHIQEKITRKKAEKEKRDKEREESLYLQT-----HQETQILQE 140

Query: 446 GDDFGLGLPSVPTHSVKLPPKEE-ELEEVK 474
                  L  +PTH+  L P E  E+ +VK
Sbjct: 141 NKS---ALEQIPTHTSALSPTEPIEVIDVK 167


>gi|325479148|gb|EGC82245.1| LPXTG-motif cell wall anchor domain protein [Anaerococcus prevotii
           ACS-065-V-Col13]
          Length = 4524

 Score = 42.8 bits (99), Expect = 0.44,   Method: Composition-based stats.
 Identities = 36/144 (25%), Positives = 69/144 (47%), Gaps = 21/144 (14%)

Query: 386 SELKQATVLARANAQEEK-----QRREQEAKE--KADREKADKE-----AKEKADREKAD 433
           +E ++  V   +N +EEK     ++  Q +KE  KA+ +KADKE      K+ AD+++  
Sbjct: 372 AEKEEKPVEDDSNKEEEKNPAESKKENQVSKENQKANNQKADKEISKDPQKDLADKKETQ 431

Query: 434 KDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREE 493
           K+ +E+ P + + +         P  + K    +++  E     K+GKE  + + + +EE
Sbjct: 432 KENKEEAPKEVKEEK--------PQETTKKEKSDDKTIEENSGQKEGKETESNKDNSKEE 483

Query: 494 -TERKNQDILDNSLLAGKTHTKNE 516
            + +K  +     L   K  T N+
Sbjct: 484 ASNQKAAEDFSKELAKVKEETAND 507


>gi|60653093|gb|AAX29241.1| cortactin [synthetic construct]
          Length = 514

 Score = 42.8 bits (99), Expect = 0.44,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 46/97 (47%), Gaps = 14/97 (14%)

Query: 374 AYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKAD 433
           AY     V   TS+    T   RAN +   + +EQE + KA+ E+A + AKE+ ++E+A 
Sbjct: 296 AYQKTVPVEAVTSK----TSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEAR 351

Query: 434 KDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEEL 470
           + L+E+   K +           P  S    P EE L
Sbjct: 352 RKLEEQARAKTQ----------TPPVSPAPQPTEERL 378


>gi|302749993|gb|ADL64170.1| immunoglobulin G binding protein A [Staphylococcus aureus subsp.
           aureus str. JKD6008]
          Length = 438

 Score = 42.8 bits (99), Expect = 0.45,   Method: Composition-based stats.
 Identities = 56/227 (24%), Positives = 85/227 (37%), Gaps = 45/227 (19%)

Query: 341 QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSE--------LKQAT 392
           + K+L D A   KAD         N+F  E + A+  I ++ N T E        LK   
Sbjct: 212 EAKKLND-AQAPKAD---------NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDP 261

Query: 393 VLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQE--KTPIKAEGDDFG 450
            +++    E K+  + +A ++ D  K  KE   K  +E  +K  +E  K P K +G+   
Sbjct: 262 SVSKEILAEAKKLNDAQAPKEEDNNKPGKEDNNKPGKEDGNKPGKEDNKKPGKEDGNK-- 319

Query: 451 LGLPSVPTHSVKLPPKEEELEEVKDEGKK-GKE---------PGTTETDDREETERKNQD 500
                        P KE+  +  K++G K GKE         PG T  D  +        
Sbjct: 320 -------------PGKEDGNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADK 366

Query: 501 ILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPL 547
           I  ++ LA K   K     +   K P   A        P+   E P 
Sbjct: 367 IAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEENPF 413


>gi|67483616|ref|XP_657028.1| myosin heavy chain [Entamoeba histolytica HM-1:IMSS]
 gi|56474266|gb|EAL51645.1| myosin heavy chain [Entamoeba histolytica HM-1:IMSS]
          Length = 2151

 Score = 42.8 bits (99), Expect = 0.45,   Method: Composition-based stats.
 Identities = 135/681 (19%), Positives = 277/681 (40%), Gaps = 78/681 (11%)

Query: 1    MNELATSIDYQTNNLDQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYI 60
            + +    +D  T + ++ K  ++D+   L  +QDN     E  +A +  LN  K + D  
Sbjct: 1281 LKDTQKKLDDMTADNEKLKAKAKDLEAQLNEVQDN----HEKAVADAELLNKKKAQSDKE 1336

Query: 61   VGPIEQRLKKVSERYERVVSRD---------LTLVIEAGLKDLKEVGDTLKR----LAET 107
            +  ++  L+ +++    V S++         L+  I+   + LK +   L++    L E 
Sbjct: 1337 LNSLKAELEALTKAKSVVESKNKDSENEKAALSEEIDQANEKLKNIQADLRKATADLQEA 1396

Query: 108  GE--VILSDKSDRLLCRFMDMVETEDEHKINKQ--------VRDALESAGFDLESTQENI 157
             E    +  + D+L+     M +T +E K   +            L+    DLE   EN+
Sbjct: 1397 NEKKAEVEAQRDKLVADNKKMTKTLEEIKARDEENTYKVENYEKVLKRKEADLEEANENL 1456

Query: 158  RKVESALINNNMKDAFRFLELAQKSKETADSHIIEAIDVGTKLKENTPPTTFTSISKVLL 217
              +E     N  K   +     +++K+  ++ I E   + T  K++        ++K + 
Sbjct: 1457 -DIEKKDRMNKEKQVKKLEGELKETKDKLNAAIAEKDSIFTAKKQSD--ADLEELNKTVE 1513

Query: 218  KSNNMQDVVFTKIKEVVKKHVNAELGHRKLRGLAFDHTYFNDKLNQFLKEIKNHQKEYDE 277
            + + +   + T+I ++ + + +AE    +LR  A       DK  + + E++    E + 
Sbjct: 1514 EHDEVVAKLNTQITKLTRDNQSAEEELNELRSKA-------DKDKKKISELEEQVNELES 1566

Query: 278  SEKGSSKARYHAAYAHIYWDLANDWVNGRVGDKSDEWARTSTNIASWIGRIT-RTEGLGG 336
               G+  A  +            +      GD++++   T+  + +    +T + E    
Sbjct: 1567 RPVGTGNADENEIKIRDAQIADLNKALEMKGDQNNQLQATNKELKAKNNDLTSKIE---- 1622

Query: 337  VTYDQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELK----QAT 392
            +T +++K+L +   +++ D   A+         +T         V   T+E++    Q  
Sbjct: 1623 ITENEMKKLENAKKRLEQDKDEAD----KAVSEQTIKRKGLEEEVKKLTTEIQALKFQIN 1678

Query: 393  VLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLG 452
              +    +EEKQR E +  E   +E+ ++E    A+ E       E+  I+AE D+    
Sbjct: 1679 APSSVAQEEEKQRLESDIAEL--KEQLEQERTTAANAEA------ERKKIQAELDEVKFN 1730

Query: 453  LPSVPTHSVKLPPK----EEELEEVKDEGKKGKEPGTTETDDR-------EETERKNQDI 501
            L  V     KL  K    + E++ +K+E K  ++     TDD        +  +RK   +
Sbjct: 1731 LEDVTNQREKLVAKNSENDAEIDSLKEEKKALEDEIEKITDDNNKLNEEIDSLDRKYNAL 1790

Query: 502  LD--NSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVG-ESDY 558
            LD  +S ++ K   ++E      A     + H      K + ++E   A+++ V  E+  
Sbjct: 1791 LDSKDSDVSMKEKFQDELKVTKDALETEKKNHAETMRLKGRLEKE---AAEVQVRLEALQ 1847

Query: 559  AGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQK 618
              + L ++EK   +  ++ R A+   +S M   D  +   D  ++  +   DE+    QK
Sbjct: 1848 KNLDLAQQEK--AKATKDYRAADGELKSLMNELDDVKDQLDKAQDDLADKEDELATLDQK 1905

Query: 619  YAKVFYRSYSPVDGSYKGTQE 639
            Y K   +  S  D   +  QE
Sbjct: 1906 Y-KTLVKQKSVFDSRIQEMQE 1925


>gi|237821223|ref|ZP_04597068.1| neuraminidase [Streptococcus pneumoniae CCRI 1974M2]
          Length = 942

 Score = 42.4 bits (98), Expect = 0.45,   Method: Composition-based stats.
 Identities = 55/224 (24%), Positives = 89/224 (39%), Gaps = 38/224 (16%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 19   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 70

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N +  Q+            LSS L +L  ++NA  +  
Sbjct: 71   DYYARDLENVETVIEKEDVET-NASNGQR----------VDLSSELYKLKKLENA-TVHM 118

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGDPSLMMDYEKVEPS 1038
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D     +     P 
Sbjct: 119  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSDGKQFYNNYNDAPL 175

Query: 1039 DVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSYVN 1082
             V  G              W         P    P+  V  YVN
Sbjct: 176  KVKPG-------------QWNSVTFTVEKPTAELPNGRVRLYVN 206


>gi|73955663|ref|XP_860692.1| PREDICTED: similar to myosin, heavy polypeptide 10, non-muscle
            isoform 3 [Canis familiaris]
          Length = 1983

 Score = 42.4 bits (98), Expect = 0.45,   Method: Composition-based stats.
 Identities = 65/283 (22%), Positives = 119/283 (42%), Gaps = 53/283 (18%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   E+L  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 983  AEAKIKKMEEEILLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 1037

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTII-------SGSEK 811
            K E  +SD+   L+K  KT  ++ + K +L G   D+  +   L   I       +  E+
Sbjct: 1038 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKVQLAKKEE 1097

Query: 812  ILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERS 865
             LQG      D T    ++L V  +  +  ++L E F  +      K  R        ++
Sbjct: 1098 ELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFESE------KASR-------NKA 1144

Query: 866  LKNQAHLNAEVERLSGLAQQPSDSTADLKELQT-------QLSRAKKYKESNDERIVSFI 918
             K +  L+ E+E L    +   D+TA  +EL+T       +L +A + +  + E  +  +
Sbjct: 1145 EKQKRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEEETRSHEAQIQDM 1204

Query: 919  RSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQL 961
            R      ++EL   +E   +   N  KN++ L+   ++L  ++
Sbjct: 1205 RQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEV 1247


>gi|73955669|ref|XP_860794.1| PREDICTED: similar to myosin, heavy polypeptide 10, non-muscle
            isoform 6 [Canis familiaris]
          Length = 1982

 Score = 42.4 bits (98), Expect = 0.45,   Method: Composition-based stats.
 Identities = 65/283 (22%), Positives = 119/283 (42%), Gaps = 53/283 (18%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   E+L  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 982  AEAKIKKMEEEILLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 1036

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTII-------SGSEK 811
            K E  +SD+   L+K  KT  ++ + K +L G   D+  +   L   I       +  E+
Sbjct: 1037 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKVQLAKKEE 1096

Query: 812  ILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERS 865
             LQG      D T    ++L V  +  +  ++L E F  +      K  R        ++
Sbjct: 1097 ELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFESE------KASR-------NKA 1143

Query: 866  LKNQAHLNAEVERLSGLAQQPSDSTADLKELQT-------QLSRAKKYKESNDERIVSFI 918
             K +  L+ E+E L    +   D+TA  +EL+T       +L +A + +  + E  +  +
Sbjct: 1144 EKQKRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEEETRSHEAQIQDM 1203

Query: 919  RSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQL 961
            R      ++EL   +E   +   N  KN++ L+   ++L  ++
Sbjct: 1204 RQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEV 1246


>gi|73955673|ref|XP_860854.1| PREDICTED: similar to myosin, heavy polypeptide 10, non-muscle
            isoform 8 [Canis familiaris]
          Length = 1997

 Score = 42.4 bits (98), Expect = 0.45,   Method: Composition-based stats.
 Identities = 65/283 (22%), Positives = 119/283 (42%), Gaps = 53/283 (18%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   E+L  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 997  AEAKIKKMEEEILLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 1051

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTII-------SGSEK 811
            K E  +SD+   L+K  KT  ++ + K +L G   D+  +   L   I       +  E+
Sbjct: 1052 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKVQLAKKEE 1111

Query: 812  ILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERS 865
             LQG      D T    ++L V  +  +  ++L E F  +      K  R        ++
Sbjct: 1112 ELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFESE------KASR-------NKA 1158

Query: 866  LKNQAHLNAEVERLSGLAQQPSDSTADLKELQT-------QLSRAKKYKESNDERIVSFI 918
             K +  L+ E+E L    +   D+TA  +EL+T       +L +A + +  + E  +  +
Sbjct: 1159 EKQKRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEEETRSHEAQIQDM 1218

Query: 919  RSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQL 961
            R      ++EL   +E   +   N  KN++ L+   ++L  ++
Sbjct: 1219 RQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEV 1261


>gi|269970286|gb|ACZ55128.1| merozoite surface protein-5 [Plasmodium knowlesi]
          Length = 374

 Score = 42.4 bits (98), Expect = 0.46,   Method: Composition-based stats.
 Identities = 49/223 (21%), Positives = 90/223 (40%), Gaps = 33/223 (14%)

Query: 314 WARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKAETRL 373
           W     ++  +  R+ R EG      D ++Q+   +  +       EI+  +  + ++  
Sbjct: 29  WREEKIHLQIYTNRLLREEG----KNDHVEQME--SPSISGTEGKKEIQMISHLQLQSG- 81

Query: 374 AYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKAD 433
            +  ++ ++   S LK A   A A + E +++ + E  +K+D E   K  +EK D     
Sbjct: 82  KHDQVSFLSGNDSNLKGANEEASAESGENEKKSDGENGKKSDEENGKKSDEEKKDANSNT 141

Query: 434 KDLQ----EKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEEL--EEVKDEGKKG------- 480
           KD +    EK P+  E     L      T+  K    EE+   E+ KD+GK         
Sbjct: 142 KDAESAKGEKNPVSPENQMKTLNNEEDKTNDGKKNGDEEDKKGEKGKDDGKGEEGSEEKM 201

Query: 481 -----KEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETP 518
                KE G TE +   E++    ++ +        H ++ TP
Sbjct: 202 EESAKKEEGNTEANKNLESKHAEAEVSE--------HKQDVTP 236


>gi|161508379|ref|YP_001574038.1| immunoglobulin G binding protein A [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|160367188|gb|ABX28159.1| immunoglobulin G binding protein A [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
          Length = 504

 Score = 42.4 bits (98), Expect = 0.46,   Method: Composition-based stats.
 Identities = 57/227 (25%), Positives = 86/227 (37%), Gaps = 37/227 (16%)

Query: 341 QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSE--------LKQAT 392
           + K+L D A   KAD         N+F  E + A+  I ++ N T E        LK   
Sbjct: 270 EAKKLND-AQAPKAD---------NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDP 319

Query: 393 VLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKT--PIKAEGDDFG 450
            +++    E K+  + +A ++ D  K  KE   K  +E  +K  +E    P K +G+  G
Sbjct: 320 SVSKEILAEAKKLNDAQAPKEEDNNKPGKEDNNKPGKEDNNKPGKEDNNKPGKEDGNKPG 379

Query: 451 LGLPSVPTHSVKLPPKEEELEEVKDEGKK-GKE---------PGTTETDDREETERKNQD 500
                      K P KE+  +  K++G K GKE         PG T  D  +        
Sbjct: 380 -------KEDNKKPGKEDGNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADK 432

Query: 501 ILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPL 547
           I  ++ LA K   K     +   K P   A        P+   E P 
Sbjct: 433 IAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEENPF 479


>gi|149019167|gb|EDL77808.1| myosin VC (predicted), isoform CRA_b [Rattus norvegicus]
          Length = 1750

 Score = 42.4 bits (98), Expect = 0.46,   Method: Composition-based stats.
 Identities = 43/196 (21%), Positives = 85/196 (43%), Gaps = 16/196 (8%)

Query: 360  EIRHGNR-FKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREK 418
            EI H  + F+ ET +  S    V   TSE        +  ++ E+Q+++ E++ K   EK
Sbjct: 1187 EINHLQKLFREETDINESIRHEVTRLTSENMMIPDFKQQISELERQKQDLESRLKEQAEK 1246

Query: 419  ADKEAKEK--------ADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEEL 470
             + + +E          +  +  K ++ ++    EG +  +G    P  ++K P K+ E 
Sbjct: 1247 MEGKQEEPFSHLNRGLEEEGRQGKAVEAQSETHPEGKERLVGKIQEPQEAIKFPKKQAEA 1306

Query: 471  EEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPP--- 527
            EE + E    +E      ++R+  E    D+ D  +   +   K  T  I  A + P   
Sbjct: 1307 EE-EVESILRQEASRLSLENRDLEEE--LDMKDRMIRKLQDQVKTLTRTIEKANSVPLPS 1363

Query: 528  -AQAHKGIQDKKPQDQ 542
             ++ + G+ + K +D+
Sbjct: 1364 GSREYLGMLEYKKEDE 1379


>gi|20357556|ref|NP_612632.1| src substrate cortactin isoform b [Homo sapiens]
 gi|14250668|gb|AAH08799.1| Cortactin [Homo sapiens]
 gi|60656143|gb|AAX32635.1| cortactin [synthetic construct]
 gi|119595174|gb|EAW74768.1| cortactin, isoform CRA_c [Homo sapiens]
 gi|119595175|gb|EAW74769.1| cortactin, isoform CRA_c [Homo sapiens]
 gi|158255630|dbj|BAF83786.1| unnamed protein product [Homo sapiens]
 gi|190690497|gb|ACE87023.1| cortactin protein [synthetic construct]
 gi|190691871|gb|ACE87710.1| cortactin protein [synthetic construct]
          Length = 513

 Score = 42.4 bits (98), Expect = 0.46,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 46/97 (47%), Gaps = 14/97 (14%)

Query: 374 AYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKAD 433
           AY     V   TS+    T   RAN +   + +EQE + KA+ E+A + AKE+ ++E+A 
Sbjct: 296 AYQKTVPVEAVTSK----TSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEAR 351

Query: 434 KDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEEL 470
           + L+E+   K +           P  S    P EE L
Sbjct: 352 RKLEEQARAKTQ----------TPPVSPAPQPTEERL 378


>gi|221483497|gb|EEE21816.1| hypothetical protein TGGT1_071620 [Toxoplasma gondii GT1]
          Length = 1801

 Score = 42.4 bits (98), Expect = 0.47,   Method: Composition-based stats.
 Identities = 55/215 (25%), Positives = 93/215 (43%), Gaps = 34/215 (15%)

Query: 359  AEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEK----A 414
            + +  G R +A T +   T    A  T   K    ++    ++EK+  E E K++    A
Sbjct: 1560 SSLNQGARREAPTTVVEGTSPASAETTE--KNVVKVSPPPPKDEKEGVETEEKKEGKPPA 1617

Query: 415  DREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKL--PPKEEELEE 472
              E  +K   + +     D+    +T  K EG     G  +   + VK+  PP ++E E 
Sbjct: 1618 TDETTEKNVVKVSPPPPKDEKEGVETEEKKEGKQPDTG-ETTEKNVVKVSPPPPKDEKEG 1676

Query: 473  VKDEGKK-GKEPGTTET--------------DDRE--ETERKNQDILDNSLLAGKTHTKN 515
            V+ E KK GK P T ET              D++E  ETE K +    ++   G+T  KN
Sbjct: 1677 VETEEKKEGKPPATDETTEKNVVKVSPPPPKDEKEGVETEEKKEGKQPDT---GETTEKN 1733

Query: 516  ETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASD 550
                +  +  PP    +G++ ++ ++   KP A+D
Sbjct: 1734 ---VVKVSAPPPKDEKEGVETEEKKEG--KPPATD 1763


>gi|20357552|ref|NP_005222.2| src substrate cortactin isoform a [Homo sapiens]
 gi|215273892|sp|Q14247|SRC8_HUMAN RecName: Full=Src substrate cortactin; AltName: Full=Amplaxin;
           AltName: Full=Oncogene EMS1
 gi|119595173|gb|EAW74767.1| cortactin, isoform CRA_b [Homo sapiens]
 gi|261857858|dbj|BAI45451.1| cortactin [synthetic construct]
          Length = 550

 Score = 42.4 bits (98), Expect = 0.47,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 46/97 (47%), Gaps = 14/97 (14%)

Query: 374 AYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKAD 433
           AY     V   TS+    T   RAN +   + +EQE + KA+ E+A + AKE+ ++E+A 
Sbjct: 333 AYQKTVPVEAVTSK----TSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEAR 388

Query: 434 KDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEEL 470
           + L+E+   K +           P  S    P EE L
Sbjct: 389 RKLEEQARAKTQ----------TPPVSPAPQPTEERL 415


>gi|8163720|gb|AAF73822.1|AF154045_1 surface protein PspC [Streptococcus pneumoniae]
          Length = 680

 Score = 42.4 bits (98), Expect = 0.47,   Method: Composition-based stats.
 Identities = 55/217 (25%), Positives = 91/217 (41%), Gaps = 58/217 (26%)

Query: 395 ARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLP 454
           A A  + +K    +  K K DREKA++EAK +AD       LQE   +   G D      
Sbjct: 205 AGAKVESKKAEATKLEKIKTDREKAEEEAKRRADA------LQEAN-VATSGQD------ 251

Query: 455 SVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTK 514
                            E K   K+G  PG   T D++E + K+ D          +   
Sbjct: 252 -----------------ESKRRAKRGV-PGELATPDKKENDAKSSD----------SSVG 283

Query: 515 NETPAIPTAK---------APPAQAHKGIQDKKPQDQREKPLAS----DIGVGESDYAGI 561
            ET   P+ K             +A K  +D+K +D+R  P  +    ++ + ESD   +
Sbjct: 284 EETLPSPSLKPEKKVAEAEKKVEEAKKKAEDQKEEDRRNYPTNTYKTLELEIAESD---V 340

Query: 562 KLTKKEKEL-QEQEENLRVAEIIQQSRMQSEDLQEKA 597
           ++ K E EL +E+ +  R  E ++Q++ + E  + +A
Sbjct: 341 EVKKAELELVKEEAKEPRNEEKVKQAKAEVESKKAEA 377


>gi|324499989|gb|ADY40009.1| Myosin-3 [Ascaris suum]
          Length = 1906

 Score = 42.4 bits (98), Expect = 0.47,   Method: Composition-based stats.
 Identities = 93/442 (21%), Positives = 173/442 (39%), Gaps = 66/442 (14%)

Query: 17   QDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDY---IVGPIEQRLKKVSE 73
            QD++ ++D  + +  +    KH  E       DL   +D+ +Y   +   +EQ+L  + E
Sbjct: 909  QDEMSNQD--ENIARVNKEKKHQEEVNRKLMEDLQAEEDKVNYMNKLKSKLEQQLDDMEE 966

Query: 74   RYER--VVSRDLTLV---IEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLLCRFMDMVE 128
              ER     +DL      +E  LK   E  D + +     E  L  K   L+     + E
Sbjct: 967  TVERDKRARQDLEKAKRKVEGELKVAMENVDEIMKQKHDIEQNLKKKEADLMAASSKLEE 1026

Query: 129  TED-EHKINKQVRDALESAGFDLESTQENIRKVESALINNNMKDAFRFLELAQKSKETAD 187
             +    K+ KQ++D LE+   +LE   E  R+  S       +      EL+++  E   
Sbjct: 1027 EQSLVSKLQKQIKD-LETRISELEEDLEQERQSRSKSDRTRSELQRELEELSERLDEQGG 1085

Query: 188  SHIIEAIDVGTKLKENTPPTTFTSISKVLLKSNNMQDVVFTKIKEVVKKHVNA--ELGHR 245
            +          +++ N       +  K  L+ NNM   +  +I  + KKH +A  EL  +
Sbjct: 1086 A-------TAAQIELNKKREAEMAKLKRDLEENNMNHEM--QIAALRKKHNDAVGELSDQ 1136

Query: 246  KLRGLAFDHTYFNDKLNQFLKEIKNHQKEYDESEKGSSKARYHAAYAHIYWDLANDWVNG 305
              +          DK  Q L+++++     D   +   +    +    + +         
Sbjct: 1137 LEQLQKLKAKTDKDKA-QLLRDVEDAHANADAESRARQEFEKQSKLVEMQF--------A 1187

Query: 306  RVGDKSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHGN 365
             +  K+DE  R   ++ +   R+T   G      D  +QL DL ++V + +         
Sbjct: 1188 ELQTKADEQTRLINDLTALKTRLTNENG------DLSRQLEDLENQVNSLH--------- 1232

Query: 366  RFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKE 425
            R KA+               S+L++A    R  A+EE + R+  A +  + E  ++  + 
Sbjct: 1233 RLKAQ-------------LMSQLEEA----RHTAEEEARERQSLAAQVKNLEHENENLRI 1275

Query: 426  KADREKADKD--LQEKTPIKAE 445
             AD E   K   L++ + + AE
Sbjct: 1276 HADEEAEGKAECLRQMSKLNAE 1297


>gi|270266177|gb|ACZ65021.1| PspC [Streptococcus pneumoniae]
          Length = 687

 Score = 42.4 bits (98), Expect = 0.47,   Method: Composition-based stats.
 Identities = 59/243 (24%), Positives = 90/243 (37%), Gaps = 69/243 (28%)

Query: 395 ARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEK------------TPI 442
           A+A  + E+    +  K K DREKA++EAK +AD ++ D+  + K            TP 
Sbjct: 211 AKAKVESEQAEATRLKKIKTDREKAEEEAKRRADAKEQDESKRRKSRGKRGALGEQATPD 270

Query: 443 KAEGD----DFGLGLPSVPTHSVK------------------------------------ 462
           K E D    D  +G  ++P+ S+K                                    
Sbjct: 271 KKENDAKSSDSSVGEETLPSPSLKPGKKVAEAEKKVEEAEKKAKAQKEEDRRNYPTNTYK 330

Query: 463 ----------LPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTH 512
                     +  KE ELE VK+E K+ +     E   +E+ + +++      L   KT 
Sbjct: 331 TLELEIAESDVKVKEAELELVKEEAKESR---NEEKIKQEKAKVESKKAEATRLEKIKTD 387

Query: 513 TKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLA--SDIGVGESDYAGIKLTKKEKEL 570
            K    A    KA      K     KP+   E+P A  +D    E DYA     K  +  
Sbjct: 388 RKKAEEA--KRKAAEEDKVKEKPAPKPEKPAEQPKAEKTDDQQAEEDYARRSEEKYNRLT 445

Query: 571 QEQ 573
           Q+Q
Sbjct: 446 QQQ 448


>gi|325911033|gb|ADZ45245.1| pneumococcal surface protein C [Streptococcus pneumoniae]
          Length = 681

 Score = 42.4 bits (98), Expect = 0.47,   Method: Composition-based stats.
 Identities = 59/243 (24%), Positives = 90/243 (37%), Gaps = 69/243 (28%)

Query: 395 ARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEK------------TPI 442
           A+A  + E+    +  K K DREKA++EAK +AD ++ D+  + K            TP 
Sbjct: 211 AKAKVESEQAEATRLKKIKTDREKAEEEAKRRADAKEQDESKRRKSRGKRGALGEQATPD 270

Query: 443 KAEGD----DFGLGLPSVPTHSVK------------------------------------ 462
           K E D    D  +G  ++P+ S+K                                    
Sbjct: 271 KKENDAKSSDSSVGEETLPSPSLKPGKKVAEAEKKVEEAEKKAKAQKEEDRRNYPTNTYK 330

Query: 463 ----------LPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTH 512
                     +  KE ELE VK+E K+ +     E   +E+ + +++      L   KT 
Sbjct: 331 TLELEIAESDVKVKEAELELVKEEAKESR---NEEKIKQEKAKVESKKAEATRLEKIKTD 387

Query: 513 TKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLA--SDIGVGESDYAGIKLTKKEKEL 570
            K    A    KA      K     KP+   E+P A  +D    E DYA     K  +  
Sbjct: 388 RKKAEEA--KRKAAEEDKVKEKPAPKPEKPAEQPKAEKTDDQQAEEDYARRSEEKYNRLT 445

Query: 571 QEQ 573
           Q+Q
Sbjct: 446 QQQ 448


>gi|182087|gb|AAA58455.1| amplaxin [Homo sapiens]
 gi|299626|gb|AAB26248.1| EMS1 gene product [human, Peptide, 550 aa]
          Length = 550

 Score = 42.4 bits (98), Expect = 0.47,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 46/97 (47%), Gaps = 14/97 (14%)

Query: 374 AYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKAD 433
           AY     V   TS+    T   RAN +   + +EQE + KA+ E+A + AKE+ ++E+A 
Sbjct: 333 AYQKTVPVEAVTSK----TSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEAR 388

Query: 434 KDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEEL 470
           + L+E+   K +           P  S    P EE L
Sbjct: 389 RKLEEQARAKTQ----------TPPVSPAPQPTEERL 415


>gi|50285605|ref|XP_445231.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49524535|emb|CAG58137.1| unnamed protein product [Candida glabrata]
          Length = 1110

 Score = 42.4 bits (98), Expect = 0.49,   Method: Composition-based stats.
 Identities = 50/188 (26%), Positives = 76/188 (40%), Gaps = 29/188 (15%)

Query: 396 RANAQEEKQRREQE--AKEKADREKADKEAKEKADREKADKD---------------LQE 438
           R   +EEK R++QE  A +K   E+  K  +EKA +E  +KD                 E
Sbjct: 69  RRKVEEEKIRKQQEIEALKKQHEEQLKKYEEEKALKEATNKDELTNTASSFSSTGIIKPE 128

Query: 439 KTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDR----EET 494
             P+K   D+     PS   H   LP +      +K E  + K+  +T+ + +    E  
Sbjct: 129 PVPLKKSDDNTIFKAPSPKKH---LPQQSTTPSNMKTEDAEHKKLDSTDNNPKLNLGESL 185

Query: 495 ER-KNQDILDNSLLAGKTHTK-NETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIG 552
            R K +D+L           K +E    PT  A P +  +G   +  Q +R   L  D  
Sbjct: 186 SREKLKDMLKTKNPRNYDEVKDDELSDTPTEPASPPKPRRGRLVRGDQIERSSSLHKD-- 243

Query: 553 VGESDYAG 560
            G S +AG
Sbjct: 244 -GASSFAG 250


>gi|325120232|emb|CBZ55786.1| Liver stage antigen, related [Neospora caninum Liverpool]
          Length = 2135

 Score = 42.4 bits (98), Expect = 0.49,   Method: Composition-based stats.
 Identities = 47/222 (21%), Positives = 97/222 (43%), Gaps = 39/222 (17%)

Query: 389  KQATVLARANAQEEKQRREQEAKEKADREKADKEAKE-KADREKADKD--------LQEK 439
            ++ T + R   Q + QR ++  +  A++E+  K+  E + +R+    D        L+ +
Sbjct: 1125 QEVTRMQRNIEQIQSQRDQESRRHAAEKERLRKQIDELELERQAMHADATARLEEHLKAE 1184

Query: 440  TPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKK------GKEPGTTETDDREE 493
              ++ E  +             +L   + EL+ +KDE K       GK    TE + +++
Sbjct: 1185 EKLREEAQNLRAQQRKKTNVEEELLATKTELQHLKDELKDLLAEEVGKRAALTEENAKQQ 1244

Query: 494  TERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGV 553
            TE +N+  L  SLL  K+  + +                 +Q+ +   +RE  L  D+  
Sbjct: 1245 TELENKHHLVRSLLQQKSTLEVK-----------------LQESQ---RRELNLQKDVRS 1284

Query: 554  GESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQE 595
            GE +   +K +  + +L+  ++ L     IQ+S ++ E L++
Sbjct: 1285 GEEERLELKQSVADLQLERDQQKL----AIQRSELEVERLKQ 1322


>gi|149061812|gb|EDM12235.1| cortactin, isoform CRA_b [Rattus norvegicus]
          Length = 245

 Score = 42.4 bits (98), Expect = 0.50,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 33/50 (66%)

Query: 396 RANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAE 445
           RAN +   + REQE + KA+ E+A + A+E+ ++E+A + L+E+   K +
Sbjct: 50  RANFENLAKEREQEDRRKAEAERAQRMAQERQEQEEARRKLEEQARAKKQ 99


>gi|324499917|gb|ADY39976.1| Myosin-3 [Ascaris suum]
          Length = 1961

 Score = 42.4 bits (98), Expect = 0.50,   Method: Composition-based stats.
 Identities = 93/442 (21%), Positives = 173/442 (39%), Gaps = 66/442 (14%)

Query: 17   QDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDY---IVGPIEQRLKKVSE 73
            QD++ ++D  + +  +    KH  E       DL   +D+ +Y   +   +EQ+L  + E
Sbjct: 987  QDEMSNQD--ENIARVNKEKKHQEEVNRKLMEDLQAEEDKVNYMNKLKSKLEQQLDDMEE 1044

Query: 74   RYER--VVSRDLTLV---IEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLLCRFMDMVE 128
              ER     +DL      +E  LK   E  D + +     E  L  K   L+     + E
Sbjct: 1045 TVERDKRARQDLEKAKRKVEGELKVAMENVDEIMKQKHDIEQNLKKKEADLMAASSKLEE 1104

Query: 129  TED-EHKINKQVRDALESAGFDLESTQENIRKVESALINNNMKDAFRFLELAQKSKETAD 187
             +    K+ KQ++D LE+   +LE   E  R+  S       +      EL+++  E   
Sbjct: 1105 EQSLVSKLQKQIKD-LETRISELEEDLEQERQSRSKSDRTRSELQRELEELSERLDEQGG 1163

Query: 188  SHIIEAIDVGTKLKENTPPTTFTSISKVLLKSNNMQDVVFTKIKEVVKKHVNA--ELGHR 245
            +          +++ N       +  K  L+ NNM   +  +I  + KKH +A  EL  +
Sbjct: 1164 A-------TAAQIELNKKREAEMAKLKRDLEENNMNHEM--QIAALRKKHNDAVGELSDQ 1214

Query: 246  KLRGLAFDHTYFNDKLNQFLKEIKNHQKEYDESEKGSSKARYHAAYAHIYWDLANDWVNG 305
              +          DK  Q L+++++     D   +   +    +    + +         
Sbjct: 1215 LEQLQKLKAKTDKDKA-QLLRDVEDAHANADAESRARQEFEKQSKLVEMQF--------A 1265

Query: 306  RVGDKSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHGN 365
             +  K+DE  R   ++ +   R+T   G      D  +QL DL ++V + +         
Sbjct: 1266 ELQTKADEQTRLINDLTALKTRLTNENG------DLSRQLEDLENQVNSLH--------- 1310

Query: 366  RFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKE 425
            R KA+               S+L++A    R  A+EE + R+  A +  + E  ++  + 
Sbjct: 1311 RLKAQ-------------LMSQLEEA----RHTAEEEARERQSLAAQVKNLEHENENLRI 1353

Query: 426  KADREKADKD--LQEKTPIKAE 445
             AD E   K   L++ + + AE
Sbjct: 1354 HADEEAEGKAECLRQMSKLNAE 1375


>gi|239615284|gb|EEQ92271.1| conserved hypothetical protein [Ajellomyces dermatitidis ER-3]
          Length = 781

 Score = 42.4 bits (98), Expect = 0.50,   Method: Composition-based stats.
 Identities = 20/64 (31%), Positives = 39/64 (60%), Gaps = 1/64 (1%)

Query: 385 TSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKA-DREKADKDLQEKTPIK 443
           T E ++A    R  AQE+++    E +   ++E+AD+E +E+A ++E+AD++ +E+   K
Sbjct: 37  TQEKERADREKRERAQEKERADRNEHERTQEKERADREKRERAQEKERADRNERERAQEK 96

Query: 444 AEGD 447
              D
Sbjct: 97  ERAD 100


>gi|73955659|ref|XP_536636.2| PREDICTED: similar to myosin, heavy polypeptide 10, non-muscle
            isoform 1 [Canis familiaris]
          Length = 1976

 Score = 42.4 bits (98), Expect = 0.51,   Method: Composition-based stats.
 Identities = 65/283 (22%), Positives = 119/283 (42%), Gaps = 53/283 (18%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   E+L  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 976  AEAKIKKMEEEILLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 1030

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTII-------SGSEK 811
            K E  +SD+   L+K  KT  ++ + K +L G   D+  +   L   I       +  E+
Sbjct: 1031 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKVQLAKKEE 1090

Query: 812  ILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERS 865
             LQG      D T    ++L V  +  +  ++L E F  +      K  R        ++
Sbjct: 1091 ELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFESE------KASR-------NKA 1137

Query: 866  LKNQAHLNAEVERLSGLAQQPSDSTADLKELQT-------QLSRAKKYKESNDERIVSFI 918
             K +  L+ E+E L    +   D+TA  +EL+T       +L +A + +  + E  +  +
Sbjct: 1138 EKQKRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEEETRSHEAQIQDM 1197

Query: 919  RSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQL 961
            R      ++EL   +E   +   N  KN++ L+   ++L  ++
Sbjct: 1198 RQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEV 1240


>gi|73955667|ref|XP_860759.1| PREDICTED: similar to myosin, heavy polypeptide 10, non-muscle
            isoform 5 [Canis familiaris]
          Length = 1992

 Score = 42.4 bits (98), Expect = 0.51,   Method: Composition-based stats.
 Identities = 65/283 (22%), Positives = 119/283 (42%), Gaps = 53/283 (18%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   E+L  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 992  AEAKIKKMEEEILLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 1046

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTII-------SGSEK 811
            K E  +SD+   L+K  KT  ++ + K +L G   D+  +   L   I       +  E+
Sbjct: 1047 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKVQLAKKEE 1106

Query: 812  ILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERS 865
             LQG      D T    ++L V  +  +  ++L E F  +      K  R        ++
Sbjct: 1107 ELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFESE------KASR-------NKA 1153

Query: 866  LKNQAHLNAEVERLSGLAQQPSDSTADLKELQT-------QLSRAKKYKESNDERIVSFI 918
             K +  L+ E+E L    +   D+TA  +EL+T       +L +A + +  + E  +  +
Sbjct: 1154 EKQKRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEEETRSHEAQIQDM 1213

Query: 919  RSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQL 961
            R      ++EL   +E   +   N  KN++ L+   ++L  ++
Sbjct: 1214 RQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEV 1256


>gi|73955661|ref|XP_850098.1| PREDICTED: similar to myosin, heavy polypeptide 10, non-muscle
            isoform 2 [Canis familiaris]
          Length = 2007

 Score = 42.4 bits (98), Expect = 0.51,   Method: Composition-based stats.
 Identities = 65/283 (22%), Positives = 119/283 (42%), Gaps = 53/283 (18%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   E+L  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 1007 AEAKIKKMEEEILLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 1061

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTII-------SGSEK 811
            K E  +SD+   L+K  KT  ++ + K +L G   D+  +   L   I       +  E+
Sbjct: 1062 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKVQLAKKEE 1121

Query: 812  ILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERS 865
             LQG      D T    ++L V  +  +  ++L E F  +      K  R        ++
Sbjct: 1122 ELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFESE------KASR-------NKA 1168

Query: 866  LKNQAHLNAEVERLSGLAQQPSDSTADLKELQT-------QLSRAKKYKESNDERIVSFI 918
             K +  L+ E+E L    +   D+TA  +EL+T       +L +A + +  + E  +  +
Sbjct: 1169 EKQKRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEEETRSHEAQIQDM 1228

Query: 919  RSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQL 961
            R      ++EL   +E   +   N  KN++ L+   ++L  ++
Sbjct: 1229 RQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEV 1271


>gi|148991952|ref|ZP_01821726.1| choline binding protein A [Streptococcus pneumoniae SP9-BS68]
 gi|147929001|gb|EDK80012.1| choline binding protein A [Streptococcus pneumoniae SP9-BS68]
          Length = 410

 Score = 42.4 bits (98), Expect = 0.52,   Method: Composition-based stats.
 Identities = 49/203 (24%), Positives = 86/203 (42%), Gaps = 28/203 (13%)

Query: 395 ARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEK------------TPI 442
           A+A  + EK    +  K K DREKA++EAK +AD ++ D+  + K            TP 
Sbjct: 211 AKAKVESEKAEATRLKKIKTDREKAEEEAKRRADAKEQDESKRRKSRGKRGALGEQATPD 270

Query: 443 KAEGD----DFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKN 498
           K E D    D  +G  ++P+ S+K   K  E E+  +E  K  +    E  DR       
Sbjct: 271 KKENDAKSSDSSVGEETLPSPSLKPGKKVAEAEKKVEEADKKAKAQKEE--DRRNYPTNT 328

Query: 499 QDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDY 558
              L+  +       K     +   +A  ++  + I+  K + + +K  A+         
Sbjct: 329 YKTLELEIAESDVKVKEAELELVKEEAKESRNEEKIKQAKAKVESKKAEATR-------- 380

Query: 559 AGIKLTKKEKELQEQEENLRVAE 581
             ++  K +++  E+E N + AE
Sbjct: 381 --LEKIKTDRKKAEEEANRKAAE 401


>gi|194756214|ref|XP_001960374.1| GF13333 [Drosophila ananassae]
 gi|190621672|gb|EDV37196.1| GF13333 [Drosophila ananassae]
          Length = 4865

 Score = 42.4 bits (98), Expect = 0.52,   Method: Composition-based stats.
 Identities = 56/249 (22%), Positives = 112/249 (44%), Gaps = 28/249 (11%)

Query: 369  AETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKA-DKEAKEK- 426
            +E R+  S    V    ++  QA  L +   +E K+   +E++ K D+ KA +K++ E+ 
Sbjct: 3711 SEERVEESKKPEVKESEAKPDQAKALEK-QVEESKKPEVKESEAKPDQAKALEKQSLEEQ 3769

Query: 427  ---ADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEP 483
               A  +K  +   EK P  AE  +      S     V   P+ +E E   D+ K  ++ 
Sbjct: 3770 QLDAKTQKQAESASEKKPETAEVSEVLAEKISEEKAEVFKQPEVKESEAKPDQAKALEKQ 3829

Query: 484  GTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQA----HKGIQDKKP 539
               E    E+T+++ +   DN        +K   P +  ++A P QA     + ++++K 
Sbjct: 3830 SLEEQKLDEKTQKQGELEFDNK-------SKKAEPEVKESEAKPDQAKALVKQALEEQKL 3882

Query: 540  QDQREKPL--ASDIGVGESDYAGIKLTK---------KEKELQEQEENLRVAEIIQQSRM 588
            +++ EK +   SD    +++ + +   K         K+ E +E E     A+ +++  +
Sbjct: 3883 EEKTEKQVKTKSDKKSEKAEVSEVLAEKISEKKPEEAKQPEAKESESKPDQAKALEKRAL 3942

Query: 589  QSEDLQEKA 597
            + + L+EKA
Sbjct: 3943 EEQKLEEKA 3951



 Score = 39.7 bits (91), Expect = 3.8,   Method: Composition-based stats.
 Identities = 47/208 (22%), Positives = 103/208 (49%), Gaps = 28/208 (13%)

Query: 396  RANAQEEKQRREQEAKEKADRE---KADKEAKEKADREKADKDLQEKTPIKAEGDDFGLG 452
            +A A E++   EQ+ +EKA ++   K++K++++    E   + + EK P +A+       
Sbjct: 3933 QAKALEKRALEEQKLEEKAKKQVKTKSEKKSEQAEVSEVLAEKISEKKPEEAKQ------ 3986

Query: 453  LPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTH 512
             P V     K   + + LE+   E +K +E   TE   + ++++K++    + +LA K  
Sbjct: 3987 -PEVKDSETK-SDQAKALEKQALEEQKLEE--KTEKQVKTKSDKKSEKAEVSEVLAEKIS 4042

Query: 513  TKN----ETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEK 568
             K     + P +  ++A P QA K ++ +  ++Q+ K ++      +++ A      K+ 
Sbjct: 4043 EKKLEEAKQPEVKESEAKPDQA-KALEKRALEEQKRKKISEK----KAEEA------KQP 4091

Query: 569  ELQEQEENLRVAEIIQQSRMQSEDLQEK 596
            E++E E     A+  ++  ++ + L+EK
Sbjct: 4092 EVKESETKSDQAKAFEKQALEEQKLEEK 4119



 Score = 38.9 bits (89), Expect = 5.0,   Method: Composition-based stats.
 Identities = 52/248 (20%), Positives = 118/248 (47%), Gaps = 27/248 (10%)

Query: 391  ATVLARANAQEEKQRREQEAKEKADREKA-DKEA-KEKADREKADKDLQEKTPIKAEGDD 448
            A  ++   A+E KQ   ++++ K+D+ KA +K+A +E+   EK +K ++ K+  K+E  +
Sbjct: 4262 AEKISEKKAEEAKQPEVKDSETKSDQAKALEKQALEEQKLEEKTEKQVKTKSDKKSEKAE 4321

Query: 449  FGLGLPSVPTHSVKLPPKEEELEEVK---DEGKKGKEPGTTETDDRE---ETERKNQDIL 502
                L    +       K+ E++E +   D+ K  +E    E  +++   ++E+K +   
Sbjct: 4322 VSEVLAEKISEKKAEEAKQPEVKESETKPDQAKALEEQKLEEKANKQVKTKSEKKPEQAE 4381

Query: 503  DNSLLAGKTHTKN----ETPAIPTAKAPPAQA----HKGIQDKKPQDQREKPL--ASDIG 552
             + +LA K   K     + P +  ++A P Q      + ++++K +++ EK +   SD  
Sbjct: 4382 VSEVLAEKISEKKPEEAKQPEVKESEAKPDQPKALEKQALEEQKLEEKTEKQVKTKSDKK 4441

Query: 553  VGESDYAGIKLTK---------KEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKE 603
              +++ + +   K         K+ E++E E     A+ +++  ++ + L+E A    K 
Sbjct: 4442 SEKAEVSEVLAEKISEKKPEEAKQPEVKESEAKPDQAKALEKRALEEQKLEEMAKKQVKT 4501

Query: 604  WKSLSPDE 611
                 P++
Sbjct: 4502 KSEKKPEK 4509


>gi|72003683|ref|NP_001024981.1| Lin-5 (Five) Interacting protein family member (lfi-1)
           [Caenorhabditis elegans]
 gi|37515173|gb|AAQ91890.1| Lin-5 (five) interacting protein protein 1, isoform d
           [Caenorhabditis elegans]
          Length = 2350

 Score = 42.4 bits (98), Expect = 0.52,   Method: Composition-based stats.
 Identities = 108/469 (23%), Positives = 195/469 (41%), Gaps = 69/469 (14%)

Query: 99  DTLKRLAETGEVILSDKSDRL--LCRFMDMVETEDEHKINKQVRDALESA---GFDLES- 152
           +T+KR+  TG    +  +D L  L +      +E + +++K++    E +     +LES 
Sbjct: 402 ETIKRMNGTGGAGSASSADLLEELRKIRGGGSSEGDAELHKELMTKYEESIERNIELESR 461

Query: 153 ---TQENIRKVESALINNNMK-----DAFRFL-ELAQKSKETADSHI-IEAIDVGTKLKE 202
              +Q  I ++E+ L  N  K      A + L E+AQ S++  D  + I+     +  K 
Sbjct: 462 GDDSQRKIAELEAELRRNREKLNEAQGALKKLHEMAQDSEKNVDGTVSIKRTRSLSPGKT 521

Query: 203 NTPPT--------TFTSISKVLLKSNNMQDVVFTKIKEVVKKHVNAELGHRKLRGLAFDH 254
             PP+        TF +    + +      +  +++KE + K  NA+   R+L     D 
Sbjct: 522 PLPPSEALRAVRNTFRNKDNDIQQLERKLKIAESQVKEFLNKFENADEARRRL-----DK 576

Query: 255 TYFNDKLNQFLKEIKNHQKEYDESEKGSSKA--RYHAAYAH-IYWDLANDWVNGRVGDKS 311
            + + K     +EI N QK  DE+E+ S +   +  A+ A  +  + A  ++   +    
Sbjct: 577 QFADAK-----REISNLQKSVDEAERNSRRTDDKLRASEAERVAAEKARKFLEDELAKLQ 631

Query: 312 DEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKAET 371
             + ++ST+ A  + R    E    +  +   ++ +L  +V+       +R  NR K+E 
Sbjct: 632 ASFQKSSTDDARKL-RDEMDEHTNSIQEEFKTRIDELNRRVE-----NLLRENNRLKSEV 685

Query: 372 ---RLAYSTIANVANFTS---ELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKE 425
              +  Y  + N  N T    E K+  +    + +   Q+   + +EK DR   D E K 
Sbjct: 686 NPLKDKYRDLENEYNSTQRRIEEKETQIRYSDDIRRNIQKDLDDLREKYDRVHTDNE-KI 744

Query: 426 KADREKADKDL----QEKTPIKAEGDDFGLGLPSVPTHSVKLPPK-EEELEEVKDEGKKG 480
             + E A K      Q+   IK + DD+         H   +  K E E++  +D  K G
Sbjct: 745 LGELEHAQKAAHLAEQQLKEIKIQRDDYQKQKDEHARHLFDIRHKLETEIKGRQDLEKNG 804

Query: 481 KEPGTTETDDREET----------ERKNQDILDNSLLA--GK-THTKNE 516
                 E D   +T           R++ D LD ++    GK TH +NE
Sbjct: 805 AR-NNDELDKLRQTISDYESQINLLRRHNDELDTTIKGHQGKITHLENE 852


>gi|163939465|ref|YP_001644349.1| 1A family penicillin-binding protein [Bacillus weihenstephanensis
           KBAB4]
 gi|163861662|gb|ABY42721.1| penicillin-binding protein, 1A family [Bacillus weihenstephanensis
           KBAB4]
          Length = 914

 Score = 42.4 bits (98), Expect = 0.52,   Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 44/66 (66%), Gaps = 5/66 (7%)

Query: 386 SELKQATVLARANAQEEKQRR-EQEAKEKAD---REKADKEAKEKADREKADKDLQEKTP 441
           ++ K A   A+  A EE +R+ ++EAK KAD   R+KAD+EA++KA+ ++  ++  E TP
Sbjct: 844 AQKKAADEEAKKKADEEAKRKADEEAKRKADEEARKKADEEARKKAEEQQQQQNTGEDTP 903

Query: 442 IKAEGD 447
             A+G+
Sbjct: 904 -HADGN 908


>gi|311252631|ref|XP_003125192.1| PREDICTED: LOW QUALITY PROTEIN: spectrin beta chain, brain 1-like
            [Sus scrofa]
          Length = 2364

 Score = 42.4 bits (98), Expect = 0.52,   Method: Composition-based stats.
 Identities = 126/588 (21%), Positives = 234/588 (39%), Gaps = 110/588 (18%)

Query: 407  EQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPK 466
            + +A+   D  KA+   +  AD +K    L+ +     + DD+G  L SV      L  K
Sbjct: 1370 QTKAQRLFDANKAELFTQSCADLDKWLHGLESQI----QSDDYGKDLTSVNI----LLKK 1421

Query: 467  EEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKT------HTKNETPAI 520
            ++ LE   +  KK  E   ++     + E K+ D +D+  L  +T         NE    
Sbjct: 1422 QQMLENQMEVRKKEIEELQSQAQALSQ-EGKSTDEVDSKRLTVQTKFMELLEPLNERKQN 1480

Query: 521  PTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVA 580
              A     Q ++ ++D+        PLA+    G +      L KK + LQ++       
Sbjct: 1481 LLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKE------- 1533

Query: 581  EIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQES 640
              IQ  + + +D+ E++ +   +  SLS + I+QR     +++ +     +  ++  +E+
Sbjct: 1534 --IQGHQPRIDDIFERSQNIVADSSSLSAEAIRQRLADLKQLWGQLIEETEKRHRRLEEA 1591

Query: 641  DKAINHFLDNDFGYYRIHNFLSQWSPLGLMYE---KDELHGVEAVYQKLDVLFRHCIENL 697
             +A  ++ D          ++S+   L +M E   KDE   V  +  K   +    +E+ 
Sbjct: 1592 HRAQQYYFDA----AEAEAWMSE-QELYMMSEEKAKDEQSAVSML--KKHQILEQAVEDY 1644

Query: 698  RANKNAVDAMSKAVEAGESSVRKHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKEDPK 757
                + +   S+A+ A +S        +  SK  K    + +  +E             +
Sbjct: 1645 AETVHQLSKTSRALVA-DSHPESERISMRQSKVDKLYAGLKDLAEE-------------R 1690

Query: 758  RGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLYTIISGSEKILQGDY 817
            RGK      D R  L ++N+ V D+          Q I + +     +++GS ++ Q DY
Sbjct: 1691 RGK-----LDERHRLFQLNREVDDLE---------QWIAERE-----VVAGSHELGQ-DY 1730

Query: 818  TFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAEV- 876
                +    +Q +F          F  D  N  I +ER  T+      L N  H +A   
Sbjct: 1731 EHVTM----LQERFRE--------FARDTGN--IGQERVDTVNHMADELINSGHSDAATI 1776

Query: 877  -ERLSGLAQQPSDSTADLKEL---QTQLSRAKKYKESNDERIVSFIRSEFEREIKELKSV 932
             E   GL    +++ ADL EL   +TQ+  A            S+   +F  + KE+   
Sbjct: 1777 AEWKDGL----NEAWADLLELIDTRTQILAA------------SYELHKFYHDAKEIFGR 1820

Query: 933  IEADAKENP-------NPNKNQKKLQKTREKLVAQLSSRLKELNIDNA 973
            I+   K+ P       N  +  +++  T E  +  L +++++L  D A
Sbjct: 1821 IQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAA 1868


>gi|260911649|ref|ZP_05918230.1| DNA mismatch repair protein MutS2 [Prevotella sp. oral taxon 472
           str. F0295]
 gi|260634255|gb|EEX52364.1| DNA mismatch repair protein MutS2 [Prevotella sp. oral taxon 472
           str. F0295]
          Length = 846

 Score = 42.4 bits (98), Expect = 0.52,   Method: Composition-based stats.
 Identities = 43/182 (23%), Positives = 78/182 (42%), Gaps = 47/182 (25%)

Query: 16  DQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNP-HKDRYDYIVGPIEQRLKKVSER 74
           D  +I  ED  ++   +QD ++  R     W +     HK          E+ L+ V ER
Sbjct: 526 DASRIVGEDYIQSDKYLQDIVRDKR----YWENKRTTIHKQ---------EKELQAVIER 572

Query: 75  YERVVSRDLTLVIEAGLKDLKEVG----DTLKRLAETGEVILSDKSDRLLCRFMDMVETE 130
           YE               KD++E+G    D LKR  E  E +L + + R+     ++ E +
Sbjct: 573 YE---------------KDIEEIGKTRKDVLKRAKEQAEELLRESNKRIETTIREIKEAQ 617

Query: 131 DEHKINKQVRDALESAGFDLESTQENIRKVESALINNNMKDAF--RFLELAQKSKETADS 188
            E +  K++R+       +L   + ++ +V++A       D F  + +E  ++ KE  + 
Sbjct: 618 AEKERTKRIRE-------ELSDFRTSVEQVDAA-----ANDEFIAKKIEQIKRRKERHEK 665

Query: 189 HI 190
           HI
Sbjct: 666 HI 667


>gi|119470822|ref|ZP_01613433.1| translation initiation factor IF-2 [Alteromonadales bacterium TW-7]
 gi|119446049|gb|EAW27328.1| translation initiation factor IF-2 [Alteromonadales bacterium TW-7]
          Length = 885

 Score = 42.4 bits (98), Expect = 0.52,   Method: Composition-based stats.
 Identities = 31/113 (27%), Positives = 52/113 (46%), Gaps = 2/113 (1%)

Query: 386 SELKQATVLARANAQEEKQRREQEAKEKADRE-KADKEAKEKADREKADKDLQEKTPIKA 444
           S ++Q     R  A+E+ +  EQ+  E+A  E KA +EA+ KA +E AD+  +E+   KA
Sbjct: 100 SAMEQEQEQQRLAAEEKARLEEQQKAEQAAAELKAKQEAERKA-KEDADRKAKEEAKRKA 158

Query: 445 EGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERK 497
           + +         P  S K      E E ++ E ++       E   R+  E +
Sbjct: 159 DAERKAKQKQMTPEQSAKSEKDRIEAERLQKEAEEAALKKAEEEAKRQAEEAR 211


>gi|198451683|ref|XP_002137339.1| GA26604 [Drosophila pseudoobscura pseudoobscura]
 gi|198131598|gb|EDY67897.1| GA26604 [Drosophila pseudoobscura pseudoobscura]
          Length = 2855

 Score = 42.4 bits (98), Expect = 0.53,   Method: Composition-based stats.
 Identities = 38/150 (25%), Positives = 62/150 (41%), Gaps = 19/150 (12%)

Query: 360  EIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKA 419
            E+   + FK+ T    S        ++E  +A + A  +    KQ +  E  +KA  EK 
Sbjct: 917  EVPAEDAFKSGTAKPVSAEKPAEESSTETDEAEIEASTSTPIHKQDQPDETTDKAQDEKE 976

Query: 420  DKEAKEKADREKADK-----DLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELE--- 471
            + E   +A   K+D      D++  T +  EG +     PS    SV LPP  E+     
Sbjct: 977  EDETSTEAVPAKSDSVPPVLDIKPSTSLPVEGGEVSTDKPS----SVYLPPAGEKDSTES 1032

Query: 472  -------EVKDEGKKGKEPGTTETDDREET 494
                    +K+E  K +EP TT   + + +
Sbjct: 1033 AEDATEPAIKEEPSKSEEPATTPLPEEQSS 1062


>gi|89892359|gb|ABD78954.1| Iga2 [Haemophilus influenzae]
          Length = 1887

 Score = 42.4 bits (98), Expect = 0.53,   Method: Composition-based stats.
 Identities = 23/72 (31%), Positives = 40/72 (55%), Gaps = 2/72 (2%)

Query: 370  ETRLAYSTIANVANFTSE--LKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKA 427
            E R   +    VA   +E   +Q+ +LAR  ++EE++ RE   +EKA+ EK  +   E+A
Sbjct: 1128 EARRQQAEAERVARLKAEEAKRQSEMLARQKSEEERKARELAEREKAEAEKVARRKAEEA 1187

Query: 428  DREKADKDLQEK 439
             R+ A+   ++K
Sbjct: 1188 KRQAAELLAKQK 1199



 Score = 42.4 bits (98), Expect = 0.53,   Method: Composition-based stats.
 Identities = 23/72 (31%), Positives = 40/72 (55%), Gaps = 2/72 (2%)

Query: 370  ETRLAYSTIANVANFTSE--LKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKA 427
            E R   +    VA   +E   +Q+ +LAR  ++EE++ RE   +EKA+ EK  +   E+A
Sbjct: 1269 EARRQQAEAERVARLKAEEAKRQSEMLARQKSEEERKARELAEREKAEAEKVARRKAEEA 1328

Query: 428  DREKADKDLQEK 439
             R+ A+   ++K
Sbjct: 1329 KRQAAELLAKQK 1340


>gi|198470278|ref|XP_002133416.1| GA22886 [Drosophila pseudoobscura pseudoobscura]
 gi|198145376|gb|EDY72044.1| GA22886 [Drosophila pseudoobscura pseudoobscura]
          Length = 1343

 Score = 42.4 bits (98), Expect = 0.54,   Method: Composition-based stats.
 Identities = 28/113 (24%), Positives = 58/113 (51%), Gaps = 7/113 (6%)

Query: 829 SKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAEVERLSGLAQQPSD 888
           S F  S  KL ++     T +++ +E+   I+A ++          E++RL   AQQ ++
Sbjct: 837 STFQQSEDKLKQMV--QQTYDSLSQEKIELIHAVQQKHAENTQYYEEIQRLQPFAQQVAE 894

Query: 889 STADLKELQTQLSRAKKYKESNDERIVSFI-----RSEFEREIKELKSVIEAD 936
              + + LQ Q+ R ++ KE ++ RI S +     +++  RE +E ++ ++ D
Sbjct: 895 LVRERETLQEQVRRVQELKEKSEMRITSLLAEQSSQAQAAREAQEQQASVQRD 947


>gi|308806069|ref|XP_003080346.1| structural maintenance of chromosomes (ISS) [Ostreococcus tauri]
 gi|116058806|emb|CAL54513.1| structural maintenance of chromosomes (ISS) [Ostreococcus tauri]
          Length = 1030

 Score = 42.4 bits (98), Expect = 0.54,   Method: Composition-based stats.
 Identities = 52/257 (20%), Positives = 114/257 (44%), Gaps = 32/257 (12%)

Query: 338 TYDQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARA 397
           T+++I++LR+ A+ + A   W+++             Y     +     ++K+   L R 
Sbjct: 209 TFERIRELREKATNITARIAWSKV-------------YDKEMEIKETEDKVKKNQALVR- 254

Query: 398 NAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQ-EKTPIKAEGDDFGLGLPSV 456
             +  ++  E E +++A   + +  A E A+ EK  +DLQ ++  ++ +  + G  L S 
Sbjct: 255 --EATEKLAEIEQQKEASSGENEALAAEYAEFEKQLQDLQKQRHQVEMDYREAGRRLQSA 312

Query: 457 PTHSVKLPPKEEEL-EEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKN 515
            T  +      ++L +++ D   K +     +  +R ET+R+ Q +L+++L+A K     
Sbjct: 313 DTDKLTEETSLKKLTKKISDVESKIQRTLDAQRGERTETDRRLQ-VLNDTLIAAKQAVTQ 371

Query: 516 ETPAIPTAKAPPAQAHKGIQDKKPQDQR-----EKPLASDIGVGESDYAGIKLTKKEKEL 570
               I        + +K   D+K + QR     +K   +DI       + +K T   + +
Sbjct: 372 CNGDI--------EGYKHALDEKERAQRNFFGMKKSTENDINEIRKQVSTLKQTSTNRLV 423

Query: 571 QEQEENLRVAEIIQQSR 587
              +   R+ + +QQ +
Sbjct: 424 LYGQHIPRLCDALQQRQ 440


>gi|73955665|ref|XP_860724.1| PREDICTED: similar to myosin, heavy polypeptide 10, non-muscle
            isoform 4 [Canis familiaris]
          Length = 1986

 Score = 42.4 bits (98), Expect = 0.55,   Method: Composition-based stats.
 Identities = 65/283 (22%), Positives = 119/283 (42%), Gaps = 53/283 (18%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   E+L  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 986  AEAKIKKMEEEILLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 1040

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTII-------SGSEK 811
            K E  +SD+   L+K  KT  ++ + K +L G   D+  +   L   I       +  E+
Sbjct: 1041 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKVQLAKKEE 1100

Query: 812  ILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERS 865
             LQG      D T    ++L V  +  +  ++L E F  +      K  R        ++
Sbjct: 1101 ELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFESE------KASR-------NKA 1147

Query: 866  LKNQAHLNAEVERLSGLAQQPSDSTADLKELQT-------QLSRAKKYKESNDERIVSFI 918
             K +  L+ E+E L    +   D+TA  +EL+T       +L +A + +  + E  +  +
Sbjct: 1148 EKQKRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEEETRSHEAQIQDM 1207

Query: 919  RSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQL 961
            R      ++EL   +E   +   N  KN++ L+   ++L  ++
Sbjct: 1208 RQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEV 1250


>gi|12644448|sp|Q47112|CEA7_ECOLX RecName: Full=Colicin-E7
 gi|144375|gb|AAA98054.1| colicin E7 [Plasmid ColE7]
          Length = 576

 Score = 42.4 bits (98), Expect = 0.55,   Method: Composition-based stats.
 Identities = 65/291 (22%), Positives = 114/291 (39%), Gaps = 35/291 (12%)

Query: 298 LANDWVNG---RVGDKSDEWARTSTNIASW-IGRITRTEGLGGVTYDQIKQLRDLASKVK 353
           L  +W +     V +++ E AR   N A+  + R    +      Y+  K   D A+K  
Sbjct: 301 LQQEWNDAHPVEVAERNYEQARAELNQANKDVARNQERQAKAVQVYNSRKSELDAANKTL 360

Query: 354 ADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAK-- 411
           AD   AEI+   RF  E   A   +  +A   ++  Q  V  +  A +   + + +A   
Sbjct: 361 ADAK-AEIKQFERFAREPMAAGHRMWQMAGLKAQRAQTDVNNKKAAFDAAAKEKSDADVA 419

Query: 412 -EKADREKADKEAKEKADREKADKDLQEKTPIKAEG----------DDFGLGLPSVPTHS 460
              A   +  KE KEK  + K DK+ +   P KA G          ++ G  L S     
Sbjct: 420 LSSALERRKQKENKEKDAKAKLDKESKRNKPGKATGKGKPVNNKWLNNAGKDLGSPVPDR 479

Query: 461 VKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAI 520
           +    +++E +   D  KK  E  + + +  ++  R N D +     A KT T++     
Sbjct: 480 IANKLRDKEFKSFDDFRKKFWEEVSKDPELSKQFSRNNNDRMKVG-KAPKTRTQD----- 533

Query: 521 PTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQ 571
            + K    + H            EKP++ + GV + D   +   K+  ++ 
Sbjct: 534 VSGKRTSFELH-----------HEKPISQNGGVYDMDNISVVTPKRHIDIH 573


>gi|89072575|ref|ZP_01159147.1| translation initiation factor IF-2 [Photobacterium sp. SKA34]
 gi|89051679|gb|EAR57132.1| translation initiation factor IF-2 [Photobacterium sp. SKA34]
          Length = 910

 Score = 42.4 bits (98), Expect = 0.55,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 395 ARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGD 447
           A   A+EE+ + E+ AK +A+ EKA ++A++KA+R K DK   E   ++A  D
Sbjct: 146 AAKRAKEEQSKAEESAKREAE-EKAKRDAEDKANRTKQDKRKAEDKALRAVAD 197


>gi|301802393|emb|CBW35147.1| sialidase A (neuraminidase A) [Streptococcus pneumoniae INV200]
          Length = 965

 Score = 42.4 bits (98), Expect = 0.55,   Method: Composition-based stats.
 Identities = 45/167 (26%), Positives = 77/167 (46%), Gaps = 25/167 (14%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 42   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 93

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N +  Q+            LSS L +L  ++NA  +  
Sbjct: 94   DYYARDLENVETVIEKEDVET-NASNGQR----------VDLSSELDKLKKLENA-TVHM 141

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGD 1025
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D
Sbjct: 142  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSD 185


>gi|298230916|ref|ZP_06964597.1| sialidase A (neuraminidase A) [Streptococcus pneumoniae str. Canada
            MDR_19F]
 gi|298254404|ref|ZP_06977990.1| sialidase A (neuraminidase A) [Streptococcus pneumoniae str. Canada
            MDR_19A]
          Length = 942

 Score = 42.4 bits (98), Expect = 0.55,   Method: Composition-based stats.
 Identities = 45/167 (26%), Positives = 77/167 (46%), Gaps = 25/167 (14%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 19   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 70

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N +  Q+            LSS L +L  ++NA  +  
Sbjct: 71   DYYARDLENVETVIEKEDVET-NASNGQR----------VDLSSELDKLKKLENA-TVHM 118

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGD 1025
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D
Sbjct: 119  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSD 162


>gi|302663572|ref|XP_003023427.1| hypothetical protein TRV_02437 [Trichophyton verrucosum HKI 0517]
 gi|291187423|gb|EFE42809.1| hypothetical protein TRV_02437 [Trichophyton verrucosum HKI 0517]
          Length = 1628

 Score = 42.4 bits (98), Expect = 0.55,   Method: Composition-based stats.
 Identities = 77/318 (24%), Positives = 121/318 (38%), Gaps = 53/318 (16%)

Query: 310  KSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKA 369
            KS  W R    +   +G  TRT G      ++I+QL   A +        +I    R + 
Sbjct: 907  KSSPWWRLFATMKPLLGE-TRTAGEVKKRDEKIQQLEAKAQQ--------DIAERQRIED 957

Query: 370  ETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADR 429
            E R   + +  +   T E +++  L +    +  Q RE E  EK     AD+E+ E    
Sbjct: 958  ERRKIETEMQRIRK-TLESERSLALDKEEIFKRLQLREVELSEKLAGAIADQESLE---- 1012

Query: 430  EKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEE-VKDEGKKGKEPGTTET 488
            ++ D+ +  K  I+ E D     L        +L  +++EL+E + D  K+ K   +T  
Sbjct: 1013 DQLDELIAAKKKIEHELDLRRGQLEQAAQIMERLEGEKKELQERISDMEKQLKSVESTHG 1072

Query: 489  DDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLA 548
            +  E+    NQ+I  N+L                       +H  ++DKK QD   K L+
Sbjct: 1073 EYDEKIGALNQEI--NTL----------------------NSHLAMKDKKLQDLEAKLLS 1108

Query: 549  SDIGVGESDYAGIKLTKKEKEL--------QEQEENLRVAEIIQQSRMQSEDLQEKAWDS 600
            SD          ++L    KEL        Q  EEN  +   I      S   +E     
Sbjct: 1109 SD------QQLDLELANTTKELEGSKKQIKQLLEENREIQRQIADLSSTSTGYEELVRRK 1162

Query: 601  YKEWKSLSPDEIKQRFQK 618
              E   L  D  K  F+K
Sbjct: 1163 EGEVAILKADLKKHEFEK 1180


>gi|221232428|ref|YP_002511581.1| sialidase A (neuraminidase A) [Streptococcus pneumoniae ATCC 700669]
 gi|220674889|emb|CAR69464.1| sialidase A (neuraminidase A) [Streptococcus pneumoniae ATCC 700669]
          Length = 965

 Score = 42.4 bits (98), Expect = 0.55,   Method: Composition-based stats.
 Identities = 45/167 (26%), Positives = 77/167 (46%), Gaps = 25/167 (14%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 42   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 93

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N +  Q+            LSS L +L  ++NA  +  
Sbjct: 94   DYYARDLENVETVIEKEDVET-NASNGQR----------VDLSSELDKLKKLENA-TVHM 141

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGD 1025
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D
Sbjct: 142  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSD 185


>gi|217039603|gb|ACJ76930.1| neuraminidase A [Streptococcus pneumoniae]
          Length = 980

 Score = 42.4 bits (98), Expect = 0.55,   Method: Composition-based stats.
 Identities = 45/167 (26%), Positives = 77/167 (46%), Gaps = 25/167 (14%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 57   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 108

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N +  Q+            LSS L +L  ++NA  +  
Sbjct: 109  DYYARDLENVETVIEKEDVET-NASNGQR----------VDLSSELDKLKKLENA-TVHM 156

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGD 1025
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D
Sbjct: 157  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSD 200


>gi|298503437|ref|YP_003725377.1| exo-alpha-sialidase [Streptococcus pneumoniae TCH8431/19A]
 gi|217039565|gb|ACJ76911.1| neuraminidase A [Streptococcus pneumoniae]
 gi|298239032|gb|ADI70163.1| exo-alpha-sialidase [Streptococcus pneumoniae TCH8431/19A]
          Length = 980

 Score = 42.4 bits (98), Expect = 0.55,   Method: Composition-based stats.
 Identities = 45/167 (26%), Positives = 77/167 (46%), Gaps = 25/167 (14%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 57   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 108

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N +  Q+            LSS L +L  ++NA  +  
Sbjct: 109  DYYARDLENVETVIEKEDVET-NASNGQR----------VDLSSELDKLKKLENA-TVHM 156

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGD 1025
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D
Sbjct: 157  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSD 200


>gi|217039561|gb|ACJ76909.1| neuraminidase A [Streptococcus pneumoniae]
 gi|217039581|gb|ACJ76919.1| neuraminidase A [Streptococcus pneumoniae]
 gi|217039583|gb|ACJ76920.1| neuraminidase A [Streptococcus pneumoniae]
 gi|217039589|gb|ACJ76923.1| neuraminidase A [Streptococcus pneumoniae INV200]
 gi|217039605|gb|ACJ76931.1| neuraminidase A [Streptococcus pneumoniae]
          Length = 980

 Score = 42.4 bits (98), Expect = 0.55,   Method: Composition-based stats.
 Identities = 45/167 (26%), Positives = 77/167 (46%), Gaps = 25/167 (14%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 57   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 108

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N +  Q+            LSS L +L  ++NA  +  
Sbjct: 109  DYYARDLENVETVIEKEDVET-NASNGQR----------VDLSSELDKLKKLENA-TVHM 156

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGD 1025
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D
Sbjct: 157  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSD 200


>gi|182684635|ref|YP_001836382.1| sialidase A precursor (neuraminidase A) [Streptococcus pneumoniae
            CGSP14]
 gi|182629969|gb|ACB90917.1| sialidase A precursor (neuraminidase A) [Streptococcus pneumoniae
            CGSP14]
          Length = 980

 Score = 42.4 bits (98), Expect = 0.55,   Method: Composition-based stats.
 Identities = 45/167 (26%), Positives = 77/167 (46%), Gaps = 25/167 (14%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 57   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 108

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N +  Q+            LSS L +L  ++NA  +  
Sbjct: 109  DYYARDLENVETVIEKEDVET-NASNGQR----------VDLSSELDKLKKLENA-TVHM 156

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGD 1025
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D
Sbjct: 157  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSD 200


>gi|149011444|ref|ZP_01832691.1| sialidase A precursor [Streptococcus pneumoniae SP19-BS75]
 gi|303258624|ref|ZP_07344604.1| sialidase A precursor (neuraminidase A) [Streptococcus pneumoniae
            SP-BS293]
 gi|303261787|ref|ZP_07347733.1| sialidase A precursor (neuraminidase A) [Streptococcus pneumoniae
            SP14-BS292]
 gi|303263651|ref|ZP_07349573.1| sialidase A precursor (neuraminidase A) [Streptococcus pneumoniae
            BS397]
 gi|303267668|ref|ZP_07353500.1| sialidase A precursor (neuraminidase A) [Streptococcus pneumoniae
            BS457]
 gi|303268285|ref|ZP_07354083.1| sialidase A precursor (neuraminidase A) [Streptococcus pneumoniae
            BS458]
 gi|147764434|gb|EDK71365.1| sialidase A precursor [Streptococcus pneumoniae SP19-BS75]
 gi|302636870|gb|EFL67359.1| sialidase A precursor (neuraminidase A) [Streptococcus pneumoniae
            SP14-BS292]
 gi|302640125|gb|EFL70580.1| sialidase A precursor (neuraminidase A) [Streptococcus pneumoniae
            SP-BS293]
 gi|302642236|gb|EFL72585.1| sialidase A precursor (neuraminidase A) [Streptococcus pneumoniae
            BS458]
 gi|302642799|gb|EFL73114.1| sialidase A precursor (neuraminidase A) [Streptococcus pneumoniae
            BS457]
 gi|302646689|gb|EFL76914.1| sialidase A precursor (neuraminidase A) [Streptococcus pneumoniae
            BS397]
          Length = 942

 Score = 42.4 bits (98), Expect = 0.55,   Method: Composition-based stats.
 Identities = 45/167 (26%), Positives = 77/167 (46%), Gaps = 25/167 (14%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 19   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 70

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N +  Q+            LSS L +L  ++NA  +  
Sbjct: 71   DYYARDLENVETVIEKEDVET-NASNGQR----------VDLSSELDKLKKLENA-TVHM 118

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGD 1025
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D
Sbjct: 119  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSD 162


>gi|149006768|ref|ZP_01830454.1| sialidase A precursor [Streptococcus pneumoniae SP18-BS74]
 gi|307127904|ref|YP_003879935.1| neuraminidase [Streptococcus pneumoniae 670-6B]
 gi|147761683|gb|EDK68647.1| sialidase A precursor [Streptococcus pneumoniae SP18-BS74]
 gi|306484966|gb|ADM91835.1| neuraminidase [Streptococcus pneumoniae 670-6B]
 gi|332072862|gb|EGI83343.1| LPXTG-motif cell wall anchor domain protein [Streptococcus pneumoniae
            GA17545]
          Length = 942

 Score = 42.4 bits (98), Expect = 0.55,   Method: Composition-based stats.
 Identities = 45/167 (26%), Positives = 77/167 (46%), Gaps = 25/167 (14%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 19   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 70

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N +  Q+            LSS L +L  ++NA  +  
Sbjct: 71   DYYARDLENVETVIEKEDVET-NASNGQR----------VDLSSELDKLKKLENA-TVHM 118

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGD 1025
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D
Sbjct: 119  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSD 162


>gi|154736696|gb|ABS84875.1| immunoglobulin G binding protein A [Staphylococcus aureus]
          Length = 465

 Score = 42.4 bits (98), Expect = 0.56,   Method: Composition-based stats.
 Identities = 51/220 (23%), Positives = 83/220 (37%), Gaps = 26/220 (11%)

Query: 365 NRFKAETRLAYSTIANVANFTSE--------LKQATVLARANAQEEKQRREQEAKEKADR 416
           N+F  E + A+  I ++ N T E        LK    +++    E K+  + +A ++ D 
Sbjct: 246 NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDN 305

Query: 417 EKADKEAKEKADREKADKDLQEKT--PIKAEGDDFGLGLPSVPTHSVKLPPKEEELEE-- 472
            K  KE   K  +E  +K  +E    P K +G+  G    + P       P +E+  +  
Sbjct: 306 NKPGKEDNNKPGQEDGNKPGKEDNNKPGKEDGNKPGKEDNNKPGQEDNNKPGQEDNNKPG 365

Query: 473 VKDEGKKGKE---------PGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTA 523
            +D  K GKE         PG T  D  +        I  ++ LA K   K     +   
Sbjct: 366 QEDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIKPGQELVVDK 425

Query: 524 KAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKL 563
           K P   A        P+   E P      +G + + G+ L
Sbjct: 426 KQPANHADANKAQALPETGEENPF-----IGTTVFGGLSL 460


>gi|83682379|emb|CAJ28179.1| immunoglobulin G binding protein A precursor [Staphylococcus
           aureus]
          Length = 451

 Score = 42.4 bits (98), Expect = 0.56,   Method: Composition-based stats.
 Identities = 51/204 (25%), Positives = 79/204 (38%), Gaps = 21/204 (10%)

Query: 365 NRFKAETRLAYSTIANVANFTSE--------LKQATVLARANAQEEKQRREQEAKEKADR 416
           N+F  E + A+  I ++ N T E        LK    +++    E K+  + +A ++ D 
Sbjct: 245 NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDN 304

Query: 417 EKADKEAKEKADREKADKDLQE--KTPIKAEGDDFGLGLPSVP-THSVKLPPKEEELEEV 473
            K  KE   K  +E  +K  +E  K P K +G+  G    + P       P KE+  +  
Sbjct: 305 NKPGKEDNNKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDGNKPGKEDGNKPGKEDGNKPG 364

Query: 474 KDEGKK-GKE---------PGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTA 523
           K++G K GKE         PG T  D  +        I  ++ LA K   K     +   
Sbjct: 365 KEDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIKPGQELVVDK 424

Query: 524 KAPPAQAHKGIQDKKPQDQREKPL 547
           K P   A        P+   E P 
Sbjct: 425 KQPANHADANKAQALPETGEENPF 448


>gi|157692367|ref|YP_001486829.1| resistance-nodulation-cell division acriflavin:proton (H+)
           antiporter [Bacillus pumilus SAFR-032]
 gi|157681125|gb|ABV62269.1| RND superfamily resistance-nodulation-cell division:proton (H+)
           antiporter [Bacillus pumilus SAFR-032]
          Length = 1038

 Score = 42.4 bits (98), Expect = 0.57,   Method: Composition-based stats.
 Identities = 42/182 (23%), Positives = 83/182 (45%), Gaps = 31/182 (17%)

Query: 31  SIQDNIKHLREFIIAWSSDLNPHKDRYDYIVGPIEQRLKKVSERYERVVSRDLTLVIEAG 90
           +I+  I  +RE +I+    +   KD     VG I  ++K+  +  E+   R      EA 
Sbjct: 525 AIKSGIGEVRESLISLEDGVRRSKDG----VGTIRSKIKEAKKELEQEYRRS-----EAM 575

Query: 91  LKDLKEVGDTLKRLAETGEVILS--------------DKSDRLLCRFMDMVETEDEHKIN 136
           +++LK++  TL+R A++ + +++              +  ++ L    DM E ++  K+ 
Sbjct: 576 IQELKQMVSTLERHAKSNQQLITTIKKVKSSYENVSFEALEKRLPEVKDMDEYKEIKKVF 635

Query: 137 KQVRDALESAGFDLESTQENIRKVESALINNNMKDAFRFLE-LAQKSKETADSHIIEAID 195
           K  +  L+ AG      Q N+ + E++L    +K A   ++  + K KE    H + A+ 
Sbjct: 636 KDTKGMLDQAG-----NQMNLYEEEASLFKEKIKKADSVIQSFSSKQKEV--KHQVRALM 688

Query: 196 VG 197
            G
Sbjct: 689 EG 690


>gi|296268126|ref|YP_003650758.1| hypothetical protein Tbis_0132 [Thermobispora bispora DSM 43833]
 gi|296090913|gb|ADG86865.1| protein of unknown function DUF195 [Thermobispora bispora DSM 43833]
          Length = 545

 Score = 42.4 bits (98), Expect = 0.58,   Method: Composition-based stats.
 Identities = 46/164 (28%), Positives = 76/164 (46%), Gaps = 24/164 (14%)

Query: 851  IKEERYWTIYAFE---RSLKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYK 907
            + +ERY    A     RS +++AH     ER+SGL ++ S +  +LK L  Q++R +   
Sbjct: 35   VAQERYRQARAEADGLRSERDKAH-----ERVSGLEREHSKAQTELKTLTGQVTRLQAAL 89

Query: 908  ESNDERIVSFIRSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKE 967
            E+  ER+        E E + LK+ +E    E    ++  + LQ+  EK +A L++R   
Sbjct: 90   EAGQERL-----QRAEAEAERLKASLET---ERQRLDERDRLLQEA-EKKIAALAARE-- 138

Query: 968  LNIDNAYGLWNEYKEDFKASFEYPLGTYEPA--ILGAMKDMDRL 1009
               D A     E +E          G  E A  +  A K++DR+
Sbjct: 139  ---DKAREEVQELREQLSELTAQKQGLQEQAARLEAARKELDRI 179


>gi|196045391|ref|ZP_03112622.1| hypothetical protein BC03BB108_5293 [Bacillus cereus 03BB108]
 gi|196023598|gb|EDX62274.1| hypothetical protein BC03BB108_5293 [Bacillus cereus 03BB108]
          Length = 643

 Score = 42.4 bits (98), Expect = 0.58,   Method: Composition-based stats.
 Identities = 52/197 (26%), Positives = 83/197 (42%), Gaps = 27/197 (13%)

Query: 822 LSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERSLK-NQAHLNAEVERLS 880
           L  +  +  F  SY    E+   D+  N    +RY   YAFE      +A  N   E+L 
Sbjct: 143 LEKISFRDIFRYSYIHQHELGTHDFLENKSTFKRYKNPYAFELMFNLVEADKNHLQEQLV 202

Query: 881 GLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIK----ELKSVIEAD 936
            +  +  D+  ++  L++ L    K K++ D   +S   + F+ EI+    E KS+IE  
Sbjct: 203 KVRNEIEDTNKEITGLKSYL----KDKDAEDFNELSSKATRFKNEIEQRKLEKKSIIENS 258

Query: 937 AKENPNPNKNQKKLQKTREKLVAQL------------SSRLKELNIDNAYGLWNEYKEDF 984
              + N NK   +L+K   ++  Q+            S R K L I+     +N  KE+ 
Sbjct: 259 KANSNNENKMYIRLKKDLTEIANQIFDLQKQKNELQNSVRAKRLLIEE----YNLEKEEI 314

Query: 985 KASFE--YPLGTYEPAI 999
            A+ E  Y L   E  I
Sbjct: 315 NATLEVNYKLAISEQNI 331


>gi|158299982|ref|XP_319987.4| AGAP009210-PA [Anopheles gambiae str. PEST]
 gi|157013781|gb|EAA43417.4| AGAP009210-PA [Anopheles gambiae str. PEST]
          Length = 1710

 Score = 42.0 bits (97), Expect = 0.60,   Method: Composition-based stats.
 Identities = 71/325 (21%), Positives = 150/325 (46%), Gaps = 19/325 (5%)

Query: 679 VEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGESSVRKHS--FEVLSSKHQKSVIA 736
           ++ +++K+    R     L A   + + + + +   E  V + S    V  ++ +K  +A
Sbjct: 510 IQNLHEKVADAERAAASKLSALTISEECLKEQINYLEHRVDEQSDQLTVKDAELEKQYLA 569

Query: 737 VNNFIKEITHHTRRLVKEDPKRGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIP 796
           + N   E     R    +D  R K +  L++   ++Q + +TV ++R  + L  +     
Sbjct: 570 LKN--AESEQEERLAALQDELRSKKD-LLAERDQQVQLLEQTVEELRADVALVEVNASKT 626

Query: 797 QEQPPLYTIISGSEKILQGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERY 856
             +  L T  + + K+L+ D +    ++ +V+SK  +S + L           ++ ++  
Sbjct: 627 HLERDL-TNATQTIKVLEEDRSVKEKAAQEVESKLTASEAALKAEIAARQEQESLAQKLQ 685

Query: 857 WTIYAFERSLKNQAHL-NAEVERLSGLAQQPSDSTADLKELQTQLSR-AKKYKES--NDE 912
             + +   S ++ A L  A+ + LS  A+Q  +  A+  ++Q +LS   +K+++S    E
Sbjct: 686 RDLQSLATSGESSAALLAAKQDELSNQAKQLQELEAEKVKVQQELSSLQQKFEQSRTEHE 745

Query: 913 RIVSFIRSEFERE---IKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKELN 969
           ++++ + +  + E   I EL+  ++   +EN   +K  ++     E LV+ L + LKELN
Sbjct: 746 QLIAEVHALADAERNTIAELRKQLQTSEQENLAKDKQLEE----NEVLVSALQNELKELN 801

Query: 970 IDNAYGLWNEYKEDFKASFEYPLGT 994
           +  A    N+     KASF    GT
Sbjct: 802 VSKAS--LNQELTAIKASFADKDGT 824


>gi|119629612|gb|EAX09207.1| hCG2012292 [Homo sapiens]
          Length = 1808

 Score = 42.0 bits (97), Expect = 0.61,   Method: Composition-based stats.
 Identities = 40/164 (24%), Positives = 70/164 (42%), Gaps = 20/164 (12%)

Query: 395  ARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLP 454
            A+  AQE  + + Q+  ++  RE+A K A+E+A RE+A K  QE+   +A+         
Sbjct: 1305 AQKGAQERAREQAQKGAQERAREQAQKGAQERA-REQAQKGAQERAREQAQKGAQERARE 1363

Query: 455  SVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQD---------ILDNS 505
                 + +   ++   E  +++ +KG +    E   RE+T  + Q            D +
Sbjct: 1364 QAQKGAQERAQEQGAQERAREQAQKGAQERAQE-QGREQTHIEAQGQAQKGAQEWARDRA 1422

Query: 506  LLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLAS 549
               G   T+ ET           Q  KG Q++  +  RE+ L S
Sbjct: 1423 RDQGWEQTQIET---------QRQTQKGAQERAWEQGREQALTS 1457


>gi|154736704|gb|ABS84879.1| immunoglobulin G binding protein A [Staphylococcus aureus]
 gi|154736708|gb|ABS84881.1| immunoglobulin G binding protein A [Staphylococcus aureus]
          Length = 473

 Score = 42.0 bits (97), Expect = 0.62,   Method: Composition-based stats.
 Identities = 55/228 (24%), Positives = 86/228 (37%), Gaps = 34/228 (14%)

Query: 365 NRFKAETRLAYSTIANVANFTSE--------LKQATVLARANAQEEKQRREQEAKEKADR 416
           N+F  E + A+  I ++ N T E        LK    +++    E K+  + +A ++ D 
Sbjct: 246 NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDN 305

Query: 417 EKADKEAKEKADREKADKDLQE--KTPIKAEGDDFGLGLPSVP---------THSVKLPP 465
            K  KE   K  +E  +K  +E  K P K +G+  G      P             K P 
Sbjct: 306 NKPGKEDNNKPGKEDNNKPGKEDNKKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDNKKPG 365

Query: 466 KEEELEEVKDEGKK-GKE---------PGTTETDDREETERKNQDILDNSLLAGKTHTKN 515
           KE+  +  K++G K GKE         PG T  D  +        I  ++ LA K   K 
Sbjct: 366 KEDGNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIKP 425

Query: 516 ETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKL 563
               +   K P   A        P+   E P      +G + + G+ L
Sbjct: 426 GQELVVDKKQPANHADANKAQALPETGEENPF-----IGTTVFGGLSL 468


>gi|332256080|ref|XP_003277145.1| PREDICTED: LOW QUALITY PROTEIN: myosin-XVIIIa-like [Nomascus
            leucogenys]
          Length = 2041

 Score = 42.0 bits (97), Expect = 0.62,   Method: Composition-based stats.
 Identities = 56/273 (20%), Positives = 116/273 (42%), Gaps = 19/273 (6%)

Query: 369  AETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKAD 428
             E RL Y       +FT +  Q          E+K   EQ+ K + +R   D +A +  +
Sbjct: 1384 GEWRLKYERAVREVDFTKKRLQQEF-------EDKLEVEQQNKRQLERRLGDLQA-DSEE 1435

Query: 429  REKADKDLQEKTP-IKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTE 487
             ++A + L++K   + AE  D  L L      + +L  K+   +    E  +  E    E
Sbjct: 1436 SQRALQQLKKKCQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDS---ELSQAHEEAQRE 1492

Query: 488  TDDREETERKNQDILDNSL-LAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKP 546
               RE+ +R+   +L  +  L  +   K+   A  T K    +A   +QD   Q+ +++ 
Sbjct: 1493 KLQREKLQREKDMLLAEAFSLKQQLEEKDMDIAGFTQKVVSLEAE--LQDISSQESKDEA 1550

Query: 547  LASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKS 606
              + +     D    K+  +E+EL EQ   +   ++++Q++++ E   E+   ++ +   
Sbjct: 1551 SLAKVKKQLRDLEA-KVKDQEEELDEQAGTI---QMLEQAKLRLEMEMERMRQTHSKEME 1606

Query: 607  LSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQE 639
               +E+++  Q   K   +    ++  Y+  Q+
Sbjct: 1607 SRDEEVEEARQSCQKKLKQMEVQLEEEYEDKQK 1639


>gi|229180826|ref|ZP_04308163.1| hypothetical protein bcere0005_41690 [Bacillus cereus 172560W]
 gi|228602663|gb|EEK60147.1| hypothetical protein bcere0005_41690 [Bacillus cereus 172560W]
          Length = 308

 Score = 42.0 bits (97), Expect = 0.63,   Method: Composition-based stats.
 Identities = 33/135 (24%), Positives = 66/135 (48%), Gaps = 23/135 (17%)

Query: 368 KAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKA 427
           KA+T++A S          + K+ T  A   ++EE +R+ Q+  E+  +E+AD++A+E+A
Sbjct: 112 KADTKVATS---------QDTKKDT--ADTKSKEEAERKAQKETERKAQEEADRKAQEEA 160

Query: 428 DR---EKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPG 484
           DR   E+  +  QE+   KA+ +           H  +   + +  EE + + ++  +  
Sbjct: 161 DRKAQEETQRKAQEEANHKAQEE---------ANHKAQEEAQRKAQEEAQRKAQEEAQRK 211

Query: 485 TTETDDREETERKNQ 499
             E  +R+  E  +Q
Sbjct: 212 AQEEANRKAHEEASQ 226


>gi|15602624|ref|NP_245696.1| translation initiation factor IF-2 [Pasteurella multocida subsp.
           multocida str. Pm70]
 gi|13431559|sp|P57873|IF2_PASMU RecName: Full=Translation initiation factor IF-2
 gi|12721057|gb|AAK02843.1| InfB [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 833

 Score = 42.0 bits (97), Expect = 0.63,   Method: Composition-based stats.
 Identities = 52/215 (24%), Positives = 99/215 (46%), Gaps = 33/215 (15%)

Query: 398 NAQEEKQRREQ-EAKEKAD---REKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGL 453
           + ++EK+R E+ E + KAD   R+KA++ A++ A+  K   +L E+       +D+    
Sbjct: 111 DVEKEKRRAEEAELRRKADELARQKAEELARKAAEEAKRYAELSEEDAENENSEDYA-DY 169

Query: 454 PSVPTHSVKLPPKEEELEEVKDEG---------KKGKEPGTTETDDREETERKNQDILDN 504
               T++ +   +E   +E ++ G         K G+E  +++T+   E+ R+NQ   D 
Sbjct: 170 HLTSTYAREAEDEEARRKENRNRGGKNKVAKAKKGGREDESSKTE--RESNRRNQK--DG 225

Query: 505 SLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGE-SDYAGIKL 563
            +  GK H K  + A+  A   PAQA            R+  +   I V E ++   +K 
Sbjct: 226 KMGKGK-HAKKGS-ALQQAFTKPAQA----------VNRDVVIGETITVAELANKMAVKA 273

Query: 564 TKKEKELQEQEENLRVAEIIQQSRMQ--SEDLQEK 596
           T+  K + +      + ++I Q   Q  +E++  K
Sbjct: 274 TEVIKTMMKMGAMATINQVIDQETAQLVAEEMGHK 308


>gi|283469349|emb|CAQ48560.1| immunoGlobulin g binding protein a [Staphylococcus aureus subsp.
           aureus ST398]
          Length = 484

 Score = 42.0 bits (97), Expect = 0.64,   Method: Composition-based stats.
 Identities = 54/219 (24%), Positives = 83/219 (37%), Gaps = 29/219 (13%)

Query: 341 QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQ 400
           + K+L D A   KAD         N+F  E + A+  I ++ N T E +   + +  +  
Sbjct: 258 EAKKLND-AQAPKAD---------NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDP 307

Query: 401 EEKQRREQEAKEKADREKADKEAKEKADREKADKDLQE--KTPIKAEGDDFGLGLPSVPT 458
              +    EAK+  D +   +E   K  +E  +K  +E  K P K +G+  G        
Sbjct: 308 SVSKEILAEAKKLNDAQAPKEEDNNKPGKEDGNKPGKEDNKKPGKEDGNKPG-------K 360

Query: 459 HSVKLPPKEEELEEVKDEGKK-GKE---------PGTTETDDREETERKNQDILDNSLLA 508
              K P KE+  +  K++G K GKE         PG T  D  +        I  ++ LA
Sbjct: 361 EDNKKPGKEDGNKPGKEDGNKPGKEDGNGIHVVKPGDTVNDIAKANGTTADKIAADNKLA 420

Query: 509 GKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPL 547
            K   K     +   K P   A        P+   E P 
Sbjct: 421 DKNMIKPGQELVVDKKQPANHADANKAQALPETGEENPF 459


>gi|169763828|ref|XP_001727814.1| RNA-binding La domain protein [Aspergillus oryzae RIB40]
 gi|238489791|ref|XP_002376133.1| lupus la ribonucleoprotein, putative [Aspergillus flavus NRRL3357]
 gi|83770842|dbj|BAE60975.1| unnamed protein product [Aspergillus oryzae]
 gi|220698521|gb|EED54861.1| lupus la ribonucleoprotein, putative [Aspergillus flavus NRRL3357]
          Length = 739

 Score = 42.0 bits (97), Expect = 0.65,   Method: Composition-based stats.
 Identities = 48/199 (24%), Positives = 75/199 (37%), Gaps = 22/199 (11%)

Query: 385 TSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKA 444
           T+E  QA+   +   Q E    E E  E    E++ +  K   +    DKD++      +
Sbjct: 23  TAEPNQAS---KPEEQAEITTPEAENTETVKTEESQEAEKAPVN---TDKDVESTAVESS 76

Query: 445 EGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDN 504
           + D  G   PSV T S    PK++E     +        GT+E+   ++++    D   N
Sbjct: 77  KADVSGTSSPSVGTSSTSTLPKDDESSNTPN--------GTSESTWDKQSQASGTDKQSN 128

Query: 505 SLLAGKTHT----KNETPAIPTAKAPPA----QAHKGIQDKKPQDQREKPLASDIGVGES 556
                K  +    K+E P    A   PA    Q  K  Q+ K +    KP  S    G S
Sbjct: 129 GTENAKEKSAEKEKSEPPKELKAAPLPAVNIWQQRKEAQEAKAKAVASKPAGSAAKTGTS 188

Query: 557 DYAGIKLTKKEKELQEQEE 575
             A    +      Q+Q +
Sbjct: 189 KTASAASSVSGDAQQDQSK 207


>gi|85085472|ref|XP_957517.1| hypothetical protein NCU04440 [Neurospora crassa OR74A]
 gi|28918609|gb|EAA28281.1| predicted protein [Neurospora crassa OR74A]
 gi|40882180|emb|CAF06006.1| hypothetical protein G21B4.210 [Neurospora crassa]
          Length = 1019

 Score = 42.0 bits (97), Expect = 0.66,   Method: Composition-based stats.
 Identities = 50/212 (23%), Positives = 87/212 (41%), Gaps = 46/212 (21%)

Query: 399 AQEEKQRREQEAKEKADREKADKEAKEKADREKADK--DLQEKTPIKAEGDDFGLGLPSV 456
           A+ E++R E++ K+K +REK DK     A+REK ++    Q++  +KA  +         
Sbjct: 198 AERERKRLEKDKKDKEEREKRDK-----AEREKKEQAAKAQQEAKVKAARE-----AQER 247

Query: 457 PTHSVKLPPKEEE-----------------LEEVKDEGKKGKEPGTTETDDREETERKNQ 499
               VK   ++EE                  E  +D  ++ ++    E   ++E +R+ +
Sbjct: 248 AEREVKKRARDEEDQKQAELERAERNARLNRERSEDARRQAEQKHAAEAARKKEEQRQAR 307

Query: 500 DILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIG---VGES 556
           +       A +    +   A   A  PP    K +    P  +  + +  D G   V ES
Sbjct: 308 E-------ASEAEMASLEEAKRQAMRPPPPPSKQLLSTPPTSRTRELVVPDTGNSYVEES 360

Query: 557 DYAGIKLTKKEKELQEQEENLRVAEIIQQSRM 588
           D      T  EK  +  EE +R+A   QQ R+
Sbjct: 361 DV----YTDSEKMREVLEEEVRMA---QQKRL 385


>gi|302809886|ref|XP_002986635.1| hypothetical protein SELMODRAFT_425551 [Selaginella moellendorffii]
 gi|300145523|gb|EFJ12198.1| hypothetical protein SELMODRAFT_425551 [Selaginella moellendorffii]
          Length = 410

 Score = 42.0 bits (97), Expect = 0.67,   Method: Composition-based stats.
 Identities = 55/226 (24%), Positives = 107/226 (47%), Gaps = 36/226 (15%)

Query: 390 QATVLARANAQEEKQRREQEAKE--KADREKADKEAKEKADREKADKDLQEKTPIKAEGD 447
           Q   L R    EE++ R Q  KE  + D+ + +++AKE  +  KA +++++K  I+A  D
Sbjct: 144 QILKLGRLEQLEERKARRQNLKEIQEQDKIQLNRQAKEDEEVAKAKEEIRKKKVIEARSD 203

Query: 448 DFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDI------ 501
                   + ++  +   KE E + +K+  KK +E       DR + +RK++ +      
Sbjct: 204 -------FIASNEDQRMRKEAEKKRLKEMDKKIEEFAAYR--DRVDQQRKDERVRKEAEK 254

Query: 502 ----------LDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDI 551
                     L+  LL  +T T+    +          AHK  +DKK Q++ ++ LA  +
Sbjct: 255 LSQRETMLMRLEKQLLEARTDTEKRLWS-------QEAAHKAAEDKKLQEKADRALADWV 307

Query: 552 GVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKA 597
               S    IKL +K++  +++ + +  A  +++ R+Q  + +EKA
Sbjct: 308 KCDRSRQQQIKL-RKDRLARDKNDEMEEAMGVRE-RLQIIEAEEKA 351


>gi|294655860|ref|XP_458060.2| DEHA2C08778p [Debaryomyces hansenii CBS767]
 gi|199430663|emb|CAG86127.2| DEHA2C08778p [Debaryomyces hansenii]
          Length = 2042

 Score = 42.0 bits (97), Expect = 0.67,   Method: Composition-based stats.
 Identities = 208/1093 (19%), Positives = 433/1093 (39%), Gaps = 161/1093 (14%)

Query: 2    NELATSIDYQTNNLDQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYIV 61
            ++L  S++ +  N +Q +  +ED    +  +   + HL +      S++  H+ + D + 
Sbjct: 855  DDLVKSLEQKLENSEQARQKAED---GINKMSRELFHLSKQKKESDSNIKSHEKKVDSLK 911

Query: 62   GPIEQRLKKVSERYERVVSRDLTLVIEAGLKDL--KEVGDTLKRLAETGEV-ILSDKSDR 118
              I    K    R E++   +          DL  ++V D  K+++E+      SDK  R
Sbjct: 912  LEIANITKTFEARIEKLQKAN----------DLFKEKVEDLNKKISESVSYNEHSDKKSR 961

Query: 119  LLCRFMDMVETEDEHKINK--QVRDALESAGFDLESTQENIRKVESALIN-----NNMKD 171
             +   +D VE  +EH ++K      A +   +   S+ + I K +  + +     N+++ 
Sbjct: 962  EMKEKLDDVEATNEHLMDKLRSAASAFQEMKYAKTSSDKEIEKYKIEIKSKNDEFNSLQS 1021

Query: 172  AFRFLELAQKSKETADS--HIIEAIDVGTKLKENTPPTTFTSISKVLLKSNNMQDVVFTK 229
             F  L+  ++          +  + +VG   K N+      S    L  +++     F +
Sbjct: 1022 EFTLLKEEKEKINEEFESFKVKSSAEVG---KLNSSINDLKSAKDSLDSNHSTISNEFEE 1078

Query: 230  IKEVV----KKHVNAELGHRK-LRGLAFDHTYFNDKLNQFLKEIKNHQKEYDESEKGSSK 284
            +KE +    K++ N ++ + K L  L  +    N+KL + L++I N ++  +  +K   +
Sbjct: 1079 LKEKLSQESKRYSNLKIEYDKSLESLKCE----NEKLKKDLEDIDNSKENAEAKQKSVEE 1134

Query: 285  --ARYHAAYAHIYWDLAN--DWVNGRVGDKSDEWARTSTNIASWIGRITRTEGLGGVTYD 340
              + +   ++ +  +L    D   G   D  ++      +IAS          L      
Sbjct: 1135 ELSNFKTKHSKVREELEKSLDAKTGEYNDAIEKLKNKDISIAS----------LKETHSK 1184

Query: 341  QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELK--QATVLARAN 398
            ++ +L    SK+  D   A  R     K + +    + +N A+  S L+  +  + A  N
Sbjct: 1185 KVSELDSGHSKLSQDLEAANSRCLETEK-QIKEHLESSSNSADQISALEKVKGELEASIN 1243

Query: 399  AQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPT 458
              E++  + +E  EK   E        +A+++KA+K L      KA  +     L  +  
Sbjct: 1244 NAEQESNKSREEFEKEKAELNQNLTNLEAEKQKAEKRLDSVQEEKAIAEKELAKLKQILD 1303

Query: 459  HSVKLPPKEEELEEVKDEGKKGKEPGT-------------TETDDREETERK-------- 497
             + KL   E E+ E+K +  K K+  T             +E  D+ E +          
Sbjct: 1304 DNSKL---ETEVSELKSDITKFKDEHTIINEKLSIKTKELSEKKDQIENQESKLKDLAKS 1360

Query: 498  --NQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQ-DQREKPLASDIGVG 554
              N+ IL   L   K   +     +    A  + + K +Q K    + + K    D+   
Sbjct: 1361 LDNEKILVKDLKEKKESLETRIKELENDIAYASNSSKEMQTKNENLETKLKSTEKDLSTS 1420

Query: 555  ESDYAG----IKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPD 610
             S +      +K    + E+      + + + +Q+   +   L E +    KE+     D
Sbjct: 1421 NSKFTNETKILKDLISDHEVSISSLKVDLDKKVQEVEKERNMLSENSETVIKEYG----D 1476

Query: 611  EIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSPLGLM 670
            +IK+  +          S ++   K  + +D+++  +++N+F    IH   S  S   L 
Sbjct: 1477 KIKELEKALGIAKTAHESKLNAMSKEKKLADESLK-YINNEF---EIHKNDSNESTTKLT 1532

Query: 671  YEKDELHGVEAVYQKLDVLFRHCIE-NLRANKNAVDAMSKAVEAGESSVRKHSFEVLSSK 729
             E + L+      +KL        E  L+     + A  K +E     ++K   +V+S  
Sbjct: 1533 KEIESLNVKLENERKLSTSKLSEREAELKKESETLKATGKQLEDEIEKLKKEK-DVVSDN 1591

Query: 730  HQKSVIAVNNF----------IKEITHHTRRLVKE-DPKRGKSESYLSDI---------- 768
             Q   +  +            IK I + T    KE D  + K++   +D+          
Sbjct: 1592 FQSKNLEFSTLEKDLASKVEEIKSINNVTESYKKESDDIKSKTKQLENDLEAAQKFGDKT 1651

Query: 769  RSELQKVNKTVMDIR-IKLRLYGIFQDIPQEQPPLYTIISGSEKILQGDYTFPPLSSLDV 827
            + EL  +N+ + +++ +       + +  +E    Y  +   +K +  +     LS+L  
Sbjct: 1652 KEELDTLNQKIEELKSVNSNTEETWTNKLKESESSYAALDEQKKSISQE-----LSALKS 1706

Query: 828  QSKFDSSYSKLFEIFYGDWTNNAIK--------EERYWTIYAFERSLKN-----QAHLNA 874
              K  S  +K  E       ++  +        EE+  T+ +    L+N     +  L++
Sbjct: 1707 SDKAASEMTKQLENELQTLKDDIEEKSRSKKELEEKSTTLSSTINELENKLDAMKKELDS 1766

Query: 875  E---VERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFERE------ 925
            E   +E+LS   ++ S S+ADLKE + +  + +K  E         ++ +F+ E      
Sbjct: 1767 EKSVIEKLSAELKEHSKSSADLKEYKEKFEQLEKEHEQ--------LKKKFDAEGNIHGE 1818

Query: 926  -IKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-----NIDNAYGLWN- 978
             +KELKS +++   ++      + K++   ++L++  +++  E+     ++++   L N 
Sbjct: 1819 KMKELKSKLDSLQDDSTAAMDLKSKIESLNQELLSTKTTKDDEIKKLTKDLESTQALKNN 1878

Query: 979  --EYKEDFKASFE 989
              E K+D  +S E
Sbjct: 1879 EKELKKDLNSSKE 1891


>gi|169596200|ref|XP_001791524.1| hypothetical protein SNOG_00853 [Phaeosphaeria nodorum SN15]
 gi|111071228|gb|EAT92348.1| hypothetical protein SNOG_00853 [Phaeosphaeria nodorum SN15]
          Length = 730

 Score = 42.0 bits (97), Expect = 0.67,   Method: Composition-based stats.
 Identities = 37/163 (22%), Positives = 68/163 (41%), Gaps = 6/163 (3%)

Query: 395 ARANAQEEKQRREQEAKEKADREKADKEAKE-KADREKADKDLQEKTPIKAEGDDFGLGL 453
           AR +A+E   R E+E+K+    E  D++ +      E  D +L EKT     G       
Sbjct: 497 AREDAEERASRLERESKQ----EPVDEDLEHANGTIEDDDAELNEKTTGLENGSASPDAA 552

Query: 454 PSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDIL-DNSLLAGKTH 512
            +      +L     E+ E+K + ++ +E   T   DR+      + I  DN+  + +  
Sbjct: 553 DATSQMQQRLDLMMSEMSEMKQQMERYRERAETAEADRKTLAEMIESIRRDNARASSREA 612

Query: 513 TKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGE 555
            +      P+ +A P+  H G +D    ++ E  +  D  + E
Sbjct: 613 RRRSRTNSPSPRAAPSSGHDGSEDDHEAEEGEITIIKDKDLDE 655


>gi|67972134|dbj|BAE02409.1| unnamed protein product [Macaca fascicularis]
          Length = 234

 Score = 42.0 bits (97), Expect = 0.67,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 46/97 (47%), Gaps = 14/97 (14%)

Query: 374 AYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKAD 433
           AY     V   TS+    T   RAN +   + +EQE + KA+ E+A + AKE+ ++E+A 
Sbjct: 17  AYQKTVPVEAVTSK----TSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEAR 72

Query: 434 KDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEEL 470
           + L+E+   K +           P  S    P EE L
Sbjct: 73  RKLEEQARAKTQ----------TPPASPAPQPTEERL 99


>gi|168061756|ref|XP_001782852.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162665630|gb|EDQ52307.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 1193

 Score = 42.0 bits (97), Expect = 0.67,   Method: Composition-based stats.
 Identities = 51/222 (22%), Positives = 93/222 (41%), Gaps = 29/222 (13%)

Query: 563 LTKKEKELQEQEENLRV-AEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAK 621
           LT  +KE+ ++EE + V  +     R + E+L  +   S+ + K  S D  K R+++ A+
Sbjct: 332 LTCLQKEVNDKEEVIAVLMKRTNTDRREKEELLREL--SHAKAKRKSADTEKDRWKRLAE 389

Query: 622 VFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSPLGLMYEKDELHGVEA 681
              R       ++KG ++S       LD      RIHN              +E HG+ +
Sbjct: 390 ERARIVPAGRDAHKGKRKSGSKPE--LDKLAEMQRIHN--------------EEFHGLRS 433

Query: 682 VYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGESSVRKHSFEVLSSKHQKSVIAVNNFI 741
           +Y          +  L + +  +      V A E  VR    +   SKH++   A NN +
Sbjct: 434 MY----------MTKLESLQGQLQNYEMKVAALEERVRSAQDQKRKSKHEERSSAGNNAV 483

Query: 742 KEITHHTRRLVKEDPKRGKSESYLSDIRSELQKVNKTVMDIR 783
           + +  H    + E     +   +   + SE+Q+V  TV+ ++
Sbjct: 484 ENVKFHELVTLLESVAPDEDVMHRDGVDSEIQEVPMTVLALK 525


>gi|315126158|ref|YP_004068161.1| translation initiation factor IF-2 [Pseudoalteromonas sp. SM9913]
 gi|315014672|gb|ADT68010.1| translation initiation factor IF-2 [Pseudoalteromonas sp. SM9913]
          Length = 885

 Score = 42.0 bits (97), Expect = 0.68,   Method: Composition-based stats.
 Identities = 31/113 (27%), Positives = 52/113 (46%), Gaps = 2/113 (1%)

Query: 386 SELKQATVLARANAQEEKQRREQEAKEKADRE-KADKEAKEKADREKADKDLQEKTPIKA 444
           S ++Q     R  A+E+ +  EQ+  E+A  E KA +EA+ KA +E AD+  +E+   KA
Sbjct: 100 SAVEQEQEQQRLAAEEKARLEEQQKAEQAAAELKAKQEAERKA-KEDADRKAKEEAKRKA 158

Query: 445 EGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERK 497
           + +         P  S K      E E ++ E ++       E   R+  E +
Sbjct: 159 DAERKAKQQQMTPEQSAKSEKDRIEAERLQKEAEEAALKKAEEEAKRQAEEAR 211


>gi|327272712|ref|XP_003221128.1| PREDICTED: early endosome antigen 1-like [Anolis carolinensis]
          Length = 1448

 Score = 42.0 bits (97), Expect = 0.69,   Method: Composition-based stats.
 Identities = 58/216 (26%), Positives = 93/216 (43%), Gaps = 36/216 (16%)

Query: 389  KQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKT----PIKA 444
            K+   L  +N Q  KQ  E+ A+ K D EK  +EA +K ++E  D+ LQ  T     ++ 
Sbjct: 827  KKCDALGESNQQILKQE-EENARLKLDIEKLHQEA-DKHNKE-LDRKLQATTEDLKKLEL 883

Query: 445  EGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREET---ERKNQDI 501
            E +     L ++     KL    E L+E KDE +K K+ G T   + E++    R+   +
Sbjct: 884  EKETLLKELEAIKN---KLSKNTEYLKEAKDELEKEKQKGKTAVAEIEKSCQEARRQLQL 940

Query: 502  LDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGI 561
               S+   +   KN                      + Q+   K LA+++    S    I
Sbjct: 941  QSESIAKEQNELKNSL--------------------EKQEGISKQLATELEAARSQVLQI 980

Query: 562  KLTKKEKELQEQEENLRVAEI---IQQSRMQSEDLQ 594
            +   KEKE  EQ+  L+V E+     Q + Q+E  Q
Sbjct: 981  QGVLKEKEKNEQQLQLKVKELKESFDQKKKQNETQQ 1016


>gi|221142252|ref|ZP_03566745.1| immunoglobulin G binding protein A precursor [Staphylococcus aureus
           subsp. aureus str. JKD6009]
          Length = 426

 Score = 42.0 bits (97), Expect = 0.70,   Method: Composition-based stats.
 Identities = 56/227 (24%), Positives = 85/227 (37%), Gaps = 45/227 (19%)

Query: 341 QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSE--------LKQAT 392
           + K+L D A   KAD         N+F  E + A+  I ++ N T E        LK   
Sbjct: 200 EAKKLND-AQAPKAD---------NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDP 249

Query: 393 VLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQE--KTPIKAEGDDFG 450
            +++    E K+  + +A ++ D  K  KE   K  +E  +K  +E  K P K +G+   
Sbjct: 250 SVSKEILAEAKKLNDAQAPKEEDNNKPGKEDNNKPGKEDGNKPGKEDNKKPGKEDGNK-- 307

Query: 451 LGLPSVPTHSVKLPPKEEELEEVKDEGKK-GKE---------PGTTETDDREETERKNQD 500
                        P KE+  +  K++G K GKE         PG T  D  +        
Sbjct: 308 -------------PGKEDGNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADK 354

Query: 501 ILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPL 547
           I  ++ LA K   K     +   K P   A        P+   E P 
Sbjct: 355 IAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEENPF 401


>gi|167764965|ref|ZP_02437086.1| hypothetical protein BACSTE_03357 [Bacteroides stercoris ATCC
           43183]
 gi|167697634|gb|EDS14213.1| hypothetical protein BACSTE_03357 [Bacteroides stercoris ATCC
           43183]
          Length = 617

 Score = 42.0 bits (97), Expect = 0.70,   Method: Composition-based stats.
 Identities = 47/243 (19%), Positives = 106/243 (43%), Gaps = 34/243 (13%)

Query: 565 KKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSP------DEIKQRFQK 618
           +K++ L E+ E L+ +   + +  +   LQ       KEWK++ P      D I +RF  
Sbjct: 381 EKKRALCEKAEALKDSTDWKATADELTKLQ-------KEWKTVGPVAKKYSDAIWKRFIS 433

Query: 619 YAKVFYRSYSPVDGSYKGTQESD-----------KAINHFLDNDFGYYRIHNFLSQWSPL 667
               F+   +    S +  ++ +            AI+  +D +     +   + +W+ +
Sbjct: 434 ACDYFFEQKNKATSSQRSVEQENLEKKKAIIEKLTAIDETMDVEEATQLVRELMKEWNGI 493

Query: 668 GLM--YEKDELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGESSVRKHSFEV 725
           G +   EKD+++  +  + ++D LF H   N+ A+   +     ++    SS+++ S + 
Sbjct: 494 GHVPFKEKDKIY--KQYHSRIDKLFEHF--NISASNKKLSNFKSSI----SSIQEGSPQA 545

Query: 726 LSSKHQKSVIAVNNFIKEITHHTRRLVKEDPKRGKSESYLSDIRSELQKVNKTVMDIRIK 785
           L  +  K V A  N   E+  +   L        K  S L+++  +++K+   +  ++ K
Sbjct: 546 LYRERDKLVRACENMKNELQTYENNLGFLTASSKKGNSLLTELNRKVEKLKGDIELVKQK 605

Query: 786 LRL 788
           +++
Sbjct: 606 IKV 608


>gi|326916241|ref|XP_003204418.1| PREDICTED: uncharacterized protein C6orf163 homolog [Meleagris
           gallopavo]
          Length = 350

 Score = 42.0 bits (97), Expect = 0.71,   Method: Composition-based stats.
 Identities = 62/259 (23%), Positives = 109/259 (42%), Gaps = 42/259 (16%)

Query: 400 QEEKQRREQEAKEKADREKADKEAKEKADREKA-DKDLQEKTPIKAEGDDFGLGLPSVPT 458
           QEE++R+E E +E  ++ KA+  ++ +  +E A DK L E T   A  + F         
Sbjct: 57  QEERERKEAEIQESIEKMKAELWSQAEQYKEDAVDKALTEAT---ANYNAF--------V 105

Query: 459 HSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETP 518
             +KL  ++E  E V+    + KE    E + R ETE   Q +      A     K +  
Sbjct: 106 QDLKLKLEKEVKEVVRKAKAEMKE--YMEEEQRRETEATEQRMAHKLRCALLECAKEKMQ 163

Query: 519 AIPTAKAPP---AQAHKGIQDKK--PQDQREKPLASD--------IGVGESDYAGIKLTK 565
           A+  A+      A +   +Q +K   Q + E  LA +        +  G+ +   + L+ 
Sbjct: 164 AVAEARKQEREMALSEAAMQHRKHIEQLKEESMLAEELYRKTIEQLSKGKCNEMNVALSV 223

Query: 566 KEKELQ-EQEENLRVAEIIQQSRMQSEDLQ-----------EKAWDSYKEWKSLSPDEI- 612
           K+KE Q E E+ ++  + +    ++   +            E+  +  + WK     EI 
Sbjct: 224 KQKENQIEMEKQMKELQTVHLEELEKVMITLRTAEGQVKALEQKLERMRAWKDSLETEIQ 283

Query: 613 --KQRFQKYAKVFYRSYSP 629
             +Q FQKY    + + SP
Sbjct: 284 ATRQAFQKYIDATFPNLSP 302


>gi|115375944|ref|ZP_01463192.1| hypothetical protein STIAU_4841 [Stigmatella aurantiaca DW4/3-1]
 gi|115367027|gb|EAU66014.1| hypothetical protein STIAU_4841 [Stigmatella aurantiaca DW4/3-1]
          Length = 431

 Score = 42.0 bits (97), Expect = 0.71,   Method: Composition-based stats.
 Identities = 47/223 (21%), Positives = 96/223 (43%), Gaps = 14/223 (6%)

Query: 372 RLAYSTIANVANFTSELKQATVLARANAQEEKQ-RREQEAKEKADREKADKEAKEKADRE 430
           R A +  A     T   +Q T  A    Q E + +R+ EAK++ +  +A  EA++ A+ E
Sbjct: 150 REAQAKAAAQVEETRRREQETAAAEKQRQTEAEAKRQAEAKQREETARAQAEARKAAEDE 209

Query: 431 KADKDLQE-KTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETD 489
           +  +  +E +   +AE +            +      E E ++ + E  + +     E  
Sbjct: 210 EKRRQAEEAQAKRQAETEAKQRKQEEARAQAEARRTAEAEEKQRQKEEAEARRQAEVEAK 269

Query: 490 DREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQ-DQREKPL- 547
            R++ E + Q     S  A +T  + ET  + +A+ PPA+  +G     P    R K L 
Sbjct: 270 QRKQEEARAQAEARRSAQAEETRRQQETARVASAE-PPAREEQGDSAAAPGISARRKTLE 328

Query: 548 ---------ASDIGVGESDYAGIKLTKKEKELQEQEENLRVAE 581
                    +S + +  ++    K+++ ++E+  + EN ++ +
Sbjct: 329 IVGFQQRASSSRVYIRTNERVQYKVSQSDREIILELENTQIGK 371


>gi|317508732|ref|ZP_07966385.1| hypothetical protein HMPREF9336_02757 [Segniliparus rugosus ATCC
           BAA-974]
 gi|316252980|gb|EFV12397.1| hypothetical protein HMPREF9336_02757 [Segniliparus rugosus ATCC
           BAA-974]
          Length = 447

 Score = 42.0 bits (97), Expect = 0.72,   Method: Composition-based stats.
 Identities = 31/137 (22%), Positives = 51/137 (37%), Gaps = 14/137 (10%)

Query: 409 EAKEKADREKADKEAKEKADREKADKDLQEKTPIKA--EGDDFGLGLPSVPTHSVKLPPK 466
           ++ +   +E  +  +    D E+ + D QE+ P +     DD    LP+    +  LP  
Sbjct: 3   QSNDSDPKEPTEHSSSASEDVERPESDAQEEPPTEKLPAADDETTVLPAADDETTVLPAV 62

Query: 467 EEELEEVKDEGKKGKEPGTTETDDREET------ERKNQDILDNSLLAGKTHTKNETPAI 520
           E       D    G EP   E D  +ET      E +  D+ +       T    E P  
Sbjct: 63  EH------DPAGLGSEPPPAERDVADETTVLPAVEPEGADLTEELPAPAPTEATTELPVA 116

Query: 521 PTAKAPPAQAHKGIQDK 537
              +  P QA + + D+
Sbjct: 117 EQGRREPDQAEQSVSDE 133


>gi|301779135|ref|XP_002925003.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent
           regulator of chromatin subfamily E member 1-like
           [Ailuropoda melanoleuca]
          Length = 467

 Score = 42.0 bits (97), Expect = 0.73,   Method: Composition-based stats.
 Identities = 42/208 (20%), Positives = 85/208 (40%), Gaps = 29/208 (13%)

Query: 341 QIKQLRDLASKVKADYHWAEIRH---GNRFKAETRLAYSTIANVANFTSELKQATVLARA 397
           Q++ L     K++A+    E RH     +F   T    + +  +     E+    + A  
Sbjct: 286 QVQSLMVHQRKLEAELLQIEERHQEKKRKFLESTDSFNNELKRLCGLKVEVDMEKIAAEI 345

Query: 398 NAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVP 457
              EE+ R+ QE +EK   E+A++        E+     Q  +  + + DD         
Sbjct: 346 AQAEEQARKRQEEREKEAAEQAERSQSSMVPEEE-----QTASKTEEKKDD--------- 391

Query: 458 THSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNET 517
             S+ +  +E  LEE  +  + G+E GT+  +D+E  +     + +       T +++ +
Sbjct: 392 -ESIPMETEETHLEEATESQQNGEE-GTSTPEDKESGQEGVDSLAEEGTSDSNTGSESNS 449

Query: 518 PAIPTAKAPPAQAHKGIQDKKPQDQREK 545
               T + PP        D  P+D++++
Sbjct: 450 ---ATVEEPPT-------DPTPEDEKKE 467


>gi|317137572|ref|XP_003190071.1| RNA-binding La domain protein [Aspergillus oryzae RIB40]
          Length = 731

 Score = 42.0 bits (97), Expect = 0.73,   Method: Composition-based stats.
 Identities = 48/199 (24%), Positives = 75/199 (37%), Gaps = 22/199 (11%)

Query: 385 TSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKA 444
           T+E  QA+   +   Q E    E E  E    E++ +  K   +    DKD++      +
Sbjct: 23  TAEPNQAS---KPEEQAEITTPEAENTETVKTEESQEAEKAPVN---TDKDVESTAVESS 76

Query: 445 EGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDN 504
           + D  G   PSV T S    PK++E     +        GT+E+   ++++    D   N
Sbjct: 77  KADVSGTSSPSVGTSSTSTLPKDDESSNTPN--------GTSESTWDKQSQASGTDKQSN 128

Query: 505 SLLAGKTHT----KNETPAIPTAKAPPA----QAHKGIQDKKPQDQREKPLASDIGVGES 556
                K  +    K+E P    A   PA    Q  K  Q+ K +    KP  S    G S
Sbjct: 129 GTENAKEKSAEKEKSEPPKELKAAPLPAVNIWQQRKEAQEAKAKAVASKPAGSAAKTGTS 188

Query: 557 DYAGIKLTKKEKELQEQEE 575
             A    +      Q+Q +
Sbjct: 189 KTASAASSVSGDAQQDQSK 207


>gi|255590037|ref|XP_002535157.1| heat shock protein, putative [Ricinus communis]
 gi|223523886|gb|EEF27226.1| heat shock protein, putative [Ricinus communis]
          Length = 623

 Score = 42.0 bits (97), Expect = 0.73,   Method: Composition-based stats.
 Identities = 52/219 (23%), Positives = 90/219 (41%), Gaps = 32/219 (14%)

Query: 329 TRTEGLGGVTYDQIKQLRDLASKVKA--DYHWAEIRHGNRFKAETRLAYSTIANVANFTS 386
           T  +    VT   ++  R++AS  K+   ++ ++I    R   +  + +   AN     S
Sbjct: 411 TAEDNQNAVTIHVLQGEREMASGNKSLGQFNLSDIPPSPRGMPQIEVTFDIDANGILHVS 470

Query: 387 ELKQAT-----VLARANA---QEEKQRREQEAKEKADREKADKEAKEKAD-REKADKDLQ 437
              +AT     +  +AN+   +EE QR E++A + AD    DK+ +E  D R +AD  L 
Sbjct: 471 AKDKATGKENKITIKANSGLSEEEIQRMEEDAAKYADE---DKKLRELVDARNQADSVLH 527

Query: 438 E-KTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETER 496
             K  +   GD              K+    ++LE V  +G           DD+E  E 
Sbjct: 528 SVKKSLAEHGDKIE------ADEKAKIEDAIKDLEAVAKDG-----------DDKEVIEA 570

Query: 497 KNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQ 535
           K   +++ S   G+     +     T  AP A+  K ++
Sbjct: 571 KTNALMEASQKLGEKVYAEQQAQANTESAPQAEGEKTVE 609


>gi|121698168|ref|XP_001267736.1| involucrin repeat protein, putative [Aspergillus clavatus NRRL 1]
 gi|119395878|gb|EAW06310.1| involucrin repeat protein, putative [Aspergillus clavatus NRRL 1]
          Length = 5853

 Score = 42.0 bits (97), Expect = 0.73,   Method: Composition-based stats.
 Identities = 50/202 (24%), Positives = 87/202 (43%), Gaps = 11/202 (5%)

Query: 397  ANAQEEKQRREQEAKEKADREKA--DKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLP 454
            ++A EE+Q+ +  A E+  +E A  + +A +  D  +  K  ++    K +   F +  P
Sbjct: 3666 SSAPEEEQKVKDTALEEITQESAADETQASQSTDEPQTAKSKKKAKKKKRKSVSFNVEEP 3725

Query: 455  SVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTK 514
            SV T     P  E   +    +GK+ +E   T+  D EE++   Q +   SL        
Sbjct: 3726 SVETSESDKPVDEVLEQMTPGDGKQSEEAPATQKTDIEESQPTEQTL--ESLSQETPVLA 3783

Query: 515  NETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQE 574
            N    +P  K   A+  + I +  P+   E+     I V E       L   ++  QE+E
Sbjct: 3784 NTGIELPEPKPEVAEQQEHIAETSPEAVTEE---QPIDVLEETAV---LPLADEPSQEKE 3837

Query: 575  ENLRVAEIIQQSRMQSEDLQEK 596
            +N  VAE  +     ++DLQ +
Sbjct: 3838 QN-DVAEDAKGVEPNTDDLQNR 3858


>gi|332829569|gb|EGK02215.1| hypothetical protein HMPREF9455_01485 [Dysgonomonas gadei ATCC
            BAA-286]
          Length = 1347

 Score = 42.0 bits (97), Expect = 0.74,   Method: Composition-based stats.
 Identities = 43/160 (26%), Positives = 70/160 (43%), Gaps = 6/160 (3%)

Query: 60   IVGPIEQRLKKVSERYERVVSRDLTLVIEAGLKDLKEVGDTL---KRLAETGEVILSDKS 116
            I+GP+EQ + + S+     +  DL ++     + L  V   L   K   ET ++ LSD++
Sbjct: 852  IIGPLEQ-IIETSDTLPEHIKGDLNIIDRNSQRLLNLVNQLLDFRKIERETIQITLSDQN 910

Query: 117  -DRLLCRFMDMVETEDEHKINKQVRDALESAGFDLESTQENIRKVESALINNNMKDAFRF 175
                L    D  ++  EHK  + V    +   F      EN+ KV S L+NN  K    +
Sbjct: 911  VYEFLLNMYDRFKSYVEHKHIRFVY-TYDDKDFRTAIDVENLTKVVSNLLNNASKYTKDY 969

Query: 176  LELAQKSKETADSHIIEAIDVGTKLKENTPPTTFTSISKV 215
            +EL  +S    + +II   D G  + EN     F    ++
Sbjct: 970  IELIFRSDVEGNKYIICVKDNGDGISENEREKIFKPFYQI 1009


>gi|209153978|gb|ACI33221.1| Drebrin-like protein [Salmo salar]
          Length = 461

 Score = 42.0 bits (97), Expect = 0.74,   Method: Composition-based stats.
 Identities = 29/100 (29%), Positives = 54/100 (54%), Gaps = 11/100 (11%)

Query: 345 LRDLASKVKADYHWAEIRHGNRFK-AETRLAYSTIANVANFTSELKQAT---VLARANAQ 400
           ++ +A    A+Y +   +  N+F+ A  +    ++    N  SE+K+       A+A   
Sbjct: 129 MQKVAKASGANYSFH--KESNKFRDAGPQGPVGSVYQKTNAMSEIKRTNKDNFWAQAEKD 186

Query: 401 EEKQRREQ-----EAKEKADREKADKEAKEKADREKADKD 435
           EEK++RE+     E ++K ++++ D+EAKE   REK DK+
Sbjct: 187 EEKRQREERSKADEERQKLEKDRKDREAKEATLREKRDKE 226


>gi|320142152|gb|EFW33971.1| signal peptide, YSIRK family [Staphylococcus aureus subsp. aureus
           MRSA177]
          Length = 512

 Score = 42.0 bits (97), Expect = 0.74,   Method: Composition-based stats.
 Identities = 59/235 (25%), Positives = 87/235 (37%), Gaps = 45/235 (19%)

Query: 341 QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQA--------- 391
           + K+L D A   KAD         N+F  E + A+  I ++ N T E +           
Sbjct: 270 EAKKLND-AQAPKAD---------NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDP 319

Query: 392 ----TVLARANAQEEKQRREQEAKEKADREKADKEAKE---KADREKADKDLQE--KTPI 442
                +LA A    + Q  ++E   K  +E  +K  KE   K  +E  +K  +E  K P 
Sbjct: 320 SVSKEILAEAKKLNDAQAPKEEDNNKPGKEDNNKPGKEDNNKPGKEDGNKPGKEDNKKPG 379

Query: 443 KAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKK-GKE---------PGTTETDDRE 492
           K +G+  G           K P KE+  +  K++G K GKE         PG T  D  +
Sbjct: 380 KEDGNKPG-------KEDNKKPGKEDGNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDIAK 432

Query: 493 ETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPL 547
                   I  ++ LA K   K     +   K P   A        P+   E P 
Sbjct: 433 ANGTTADKIAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEENPF 487


>gi|86565266|ref|NP_508847.2| Lin-5 (Five) Interacting protein family member (lfi-1)
           [Caenorhabditis elegans]
 gi|71533335|gb|AAZ32792.1| Lin-5 (five) interacting protein protein 1, isoform b
           [Caenorhabditis elegans]
          Length = 2117

 Score = 42.0 bits (97), Expect = 0.74,   Method: Composition-based stats.
 Identities = 108/469 (23%), Positives = 195/469 (41%), Gaps = 69/469 (14%)

Query: 99  DTLKRLAETGEVILSDKSDRL--LCRFMDMVETEDEHKINKQVRDALESA---GFDLES- 152
           +T+KR+  TG    +  +D L  L +      +E + +++K++    E +     +LES 
Sbjct: 475 ETIKRMNGTGGAGSASSADLLEELRKIRGGGSSEGDAELHKELMTKYEESIERNIELESR 534

Query: 153 ---TQENIRKVESALINNNMK-----DAFRFL-ELAQKSKETADSHI-IEAIDVGTKLKE 202
              +Q  I ++E+ L  N  K      A + L E+AQ S++  D  + I+     +  K 
Sbjct: 535 GDDSQRKIAELEAELRRNREKLNEAQGALKKLHEMAQDSEKNVDGTVSIKRTRSLSPGKT 594

Query: 203 NTPPT--------TFTSISKVLLKSNNMQDVVFTKIKEVVKKHVNAELGHRKLRGLAFDH 254
             PP+        TF +    + +      +  +++KE + K  NA+   R+L     D 
Sbjct: 595 PLPPSEALRAVRNTFRNKDNDIQQLERKLKIAESQVKEFLNKFENADEARRRL-----DK 649

Query: 255 TYFNDKLNQFLKEIKNHQKEYDESEKGSSKA--RYHAAYAH-IYWDLANDWVNGRVGDKS 311
            + + K     +EI N QK  DE+E+ S +   +  A+ A  +  + A  ++   +    
Sbjct: 650 QFADAK-----REISNLQKSVDEAERNSRRTDDKLRASEAERVAAEKARKFLEDELAKLQ 704

Query: 312 DEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKAET 371
             + ++ST+ A  + R    E    +  +   ++ +L  +V+       +R  NR K+E 
Sbjct: 705 ASFQKSSTDDARKL-RDEMDEHTNSIQEEFKTRIDELNRRVE-----NLLRENNRLKSEV 758

Query: 372 ---RLAYSTIANVANFTS---ELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKE 425
              +  Y  + N  N T    E K+  +    + +   Q+   + +EK DR   D E K 
Sbjct: 759 NPLKDKYRDLENEYNSTQRRIEEKETQIRYSDDIRRNIQKDLDDLREKYDRVHTDNE-KI 817

Query: 426 KADREKADKDL----QEKTPIKAEGDDFGLGLPSVPTHSVKLPPK-EEELEEVKDEGKKG 480
             + E A K      Q+   IK + DD+         H   +  K E E++  +D  K G
Sbjct: 818 LGELEHAQKAAHLAEQQLKEIKIQRDDYQKQKDEHARHLFDIRHKLETEIKGRQDLEKNG 877

Query: 481 KEPGTTETDDREET----------ERKNQDILDNSLLA--GK-THTKNE 516
                 E D   +T           R++ D LD ++    GK TH +NE
Sbjct: 878 AR-NNDELDKLRQTISDYESQINLLRRHNDELDTTIKGHQGKITHLENE 925


>gi|320139531|gb|EFW31402.1| signal peptide, YSIRK family [Staphylococcus aureus subsp. aureus
           MRSA131]
          Length = 438

 Score = 42.0 bits (97), Expect = 0.75,   Method: Composition-based stats.
 Identities = 53/228 (23%), Positives = 83/228 (36%), Gaps = 35/228 (15%)

Query: 340 DQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSE--------LKQA 391
           D   Q  +L S+ K        +  N+F  E + A+  I ++ N T E        LK  
Sbjct: 201 DDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDD 260

Query: 392 TVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKT--PIKAEGDDF 449
             +++    E K+  + +A ++ D  K  KE   K  +E  +K  +E    P K +G+  
Sbjct: 261 PSVSKEILAEAKKLNDAQAPKEEDNNKPGKEDNNKPGKEDNNKPGKEDNNKPGKEDGNK- 319

Query: 450 GLGLPSVPTHSVKLPPKEEELEEVKDEGKK-GKE---------PGTTETDDREETERKNQ 499
                         P KE+  +  K++G K GKE         PG T  D  +       
Sbjct: 320 --------------PGKEDNKKPGKEDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTAD 365

Query: 500 DILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPL 547
            I  ++ LA K   K     +   K P   A        P+   E P 
Sbjct: 366 KIAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEENPF 413


>gi|300122966|emb|CBK23973.2| unnamed protein product [Blastocystis hominis]
          Length = 791

 Score = 42.0 bits (97), Expect = 0.75,   Method: Composition-based stats.
 Identities = 40/127 (31%), Positives = 60/127 (47%), Gaps = 9/127 (7%)

Query: 346 RDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQR 405
           R  A K +A+   AE     R +AE R+A +  A      +E  +A  +A   A+ E+  
Sbjct: 334 RIAAEKAEAERIAAEKAEAERLEAE-RIA-AEKAEAERLEAEKAEAERIAAEKAEAERIA 391

Query: 406 REQEAKEKADREKADKE--AKEKADREK--ADKDLQEKTPIKAEG---DDFGLGLPSVPT 458
            E+   E+   EKA+ E  A EKA+ E+  A+K   EK P   EG   D      P++P 
Sbjct: 392 AEKAEAERIAAEKAEAERIAAEKAEAERIAAEKAEAEKVPAIVEGSALDRLLKSTPAIPI 451

Query: 459 HSVKLPP 465
           ++   PP
Sbjct: 452 NTEAEPP 458


>gi|301773660|ref|XP_002922247.1| PREDICTED: src substrate cortactin-like [Ailuropoda melanoleuca]
          Length = 539

 Score = 42.0 bits (97), Expect = 0.76,   Method: Composition-based stats.
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 9/72 (12%)

Query: 396 RANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPS 455
           RAN +   + +EQE + KA+ EKA + AKE+ ++E+A + L E+   +          P+
Sbjct: 351 RANFENLAKEKEQEDRRKAEAEKAQRMAKERQEQEEARRQLHEQAQAQK---------PT 401

Query: 456 VPTHSVKLPPKE 467
            P      P +E
Sbjct: 402 PPASPTPQPAQE 413


>gi|301764417|ref|XP_002917632.1| PREDICTED: ankyrin repeat domain-containing protein 12-like
            [Ailuropoda melanoleuca]
 gi|281338964|gb|EFB14548.1| hypothetical protein PANDA_005959 [Ailuropoda melanoleuca]
          Length = 2060

 Score = 42.0 bits (97), Expect = 0.76,   Method: Composition-based stats.
 Identities = 58/224 (25%), Positives = 99/224 (44%), Gaps = 32/224 (14%)

Query: 396  RANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKD----------LQEKTPIKAE 445
            R + + EK +     K+  DREK+ ++   K D+EK +K+          L EK   +A+
Sbjct: 878  RCHKEGEKIKNTTTVKKTEDREKSREKMDRKHDKEKPEKERHLAENKEKHLIEKKNKQAD 937

Query: 446  GDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNS 505
              D+          S K   K+ E++  K E  + KE G   T  +   E K   I D+S
Sbjct: 938  NSDYA--------KSEKSKNKDREVD--KKEKSRDKE-GVNITISKHFQEEKKSSIADSS 986

Query: 506  ------LLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREK-PLASDIGV-GESD 557
                   L+ K  TK+E    P  K    +     + K+    ++K  L S + +  E+D
Sbjct: 987  KAQHEKTLSLKEKTKDEPLKTPDGKEKDKKDKDIDRYKERDKHKDKIQLNSLLKLKSEAD 1046

Query: 558  YAGIKLTKKEKELQEQEENLRVAEIIQQS--RMQS-EDLQEKAW 598
               +K +   K+ + +E+ L   +++Q S  RM S +DL+ + W
Sbjct: 1047 KPKLKSSPASKDTRPKEKRLVNDDLMQTSFERMLSLKDLEIEQW 1090


>gi|224050488|ref|XP_002187632.1| PREDICTED: cortactin [Taeniopygia guttata]
          Length = 511

 Score = 42.0 bits (97), Expect = 0.76,   Method: Composition-based stats.
 Identities = 22/68 (32%), Positives = 40/68 (58%), Gaps = 7/68 (10%)

Query: 378 IANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQ 437
           +  VAN TS +       RAN +   + +EQE + KA+ E+A + A+EK ++E+A + L+
Sbjct: 302 VEAVANKTSTI-------RANFENLAKEKEQEDRRKAEAERAQRMAREKQEQEEARRKLE 354

Query: 438 EKTPIKAE 445
           E+   + +
Sbjct: 355 EQAKARKQ 362


>gi|158297307|ref|XP_317566.4| AGAP007919-PA [Anopheles gambiae str. PEST]
 gi|157015132|gb|EAA12907.4| AGAP007919-PA [Anopheles gambiae str. PEST]
          Length = 1306

 Score = 41.6 bits (96), Expect = 0.77,   Method: Composition-based stats.
 Identities = 60/243 (24%), Positives = 100/243 (41%), Gaps = 21/243 (8%)

Query: 365  NRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAK 424
            +R  +E ++A   IAN     S+  +    AR+   E +Q+ E+E       +KA  E  
Sbjct: 772  SRENSELQIA---IANQTGKFSQRLEELEQARSELTEHRQKLEEEVASLQSEQKAKVEVL 828

Query: 425  EKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPG 484
             K    + D+  +E    +++ D+    L ++     K    EE L+EVK +G      G
Sbjct: 829  RKETGAEIDRLTKELKIAQSKADESRKALAAM---EAKCEALEECLKEVKTDGGGNGSKG 885

Query: 485  TTETDDRE------ETERKN-QDILDNSLLAGK---THTKNETPAIPTAKAPPAQAHKGI 534
              ++ + +        E+ N QD L   ++A +    H K     I T K    +A K  
Sbjct: 886  MIDSIELKAQIALLTKEKANVQDKLQGEVIARQLVEDHMKMVNEEISTLKREFGKAEK-- 943

Query: 535  QDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQ 594
             DK   + R + L+S     E+        K+   +Q+Q E     E I+   MQ E  Q
Sbjct: 944  -DKLEAETRLEVLSSYFKEKETQLQKELSVKEAMWMQQQGETTTTVEKIRH--MQDEIQQ 1000

Query: 595  EKA 597
             K+
Sbjct: 1001 LKS 1003


>gi|27227578|emb|CAD59406.1| SMC4 protein [Anopheles gambiae]
          Length = 1376

 Score = 41.6 bits (96), Expect = 0.79,   Method: Composition-based stats.
 Identities = 49/242 (20%), Positives = 105/242 (43%), Gaps = 33/242 (13%)

Query: 566  KEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLS-PDEIKQRFQKYA---K 621
            K++E++ +  ++ VA + QQ     E +    W + +  ++ S P++++    K A   +
Sbjct: 808  KQQEMELKRMHMDVASLTQQMPRLKEQVD---WQAERVARTHSDPEKVRALEAKVAECKQ 864

Query: 622  VFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSPLGLMYEKDELHGVEA 681
             F  S +  D   K      + IN   ++     ++    ++ + LG   +K     + A
Sbjct: 865  AFDSSSTKADAMQKNVDRYTEQINEITNS-----KVKVLQTKINGLGKQIDK-----LSA 914

Query: 682  VYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGESSVRK----------------HSFEV 725
               KL V  +    N++ +K+ +++M   VEA +S++RK                   E 
Sbjct: 915  NISKLTVEIKTSERNVQKSKDKINSMEDEVEAAQSAIRKGNDERTQLEEEANKLREELEE 974

Query: 726  LSSKHQKSVIAVNNFIKEITHHTRRLVKEDPKRGKSESYLSDIRSELQKVNKTVMDIRIK 785
            +    +K+    ++  KEI    +R  +   KR + E  L  I ++LQ+   T+   +++
Sbjct: 975  MKLAIEKAHEGSSSIKKEIVALQKREAEGKMKRLEFEQILQTIETKLQETKDTLPHWQLQ 1034

Query: 786  LR 787
            L+
Sbjct: 1035 LK 1036


>gi|160700626|ref|YP_001552301.1| hypothetical protein BA3_0032 [Thalassomonas phage BA3]
 gi|157787745|gb|ABV74317.1| hypothetical protein BA3_0032 [Thalassomonas phage BA3]
          Length = 564

 Score = 41.6 bits (96), Expect = 0.81,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 36/58 (62%)

Query: 388 LKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAE 445
           L +A +     A+ E++R+EQE  E+  +EKA++EAK K + E+     +E+  ++AE
Sbjct: 420 LIKARIAEHEQAEAERKRQEQECIEREAKEKAEREAKAKLEAEEKRIRDEERAKVEAE 477


>gi|76563930|ref|NP_068640.2| cortactin isoform B [Rattus norvegicus]
 gi|51859454|gb|AAH81802.1| Cortactin [Rattus norvegicus]
 gi|149061815|gb|EDM12238.1| cortactin, isoform CRA_e [Rattus norvegicus]
          Length = 509

 Score = 41.6 bits (96), Expect = 0.81,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 33/50 (66%)

Query: 396 RANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAE 445
           RAN +   + REQE + KA+ E+A + A+E+ ++E+A + L+E+   K +
Sbjct: 314 RANFENLAKEREQEDRRKAEAERAQRMAQERQEQEEARRKLEEQARAKKQ 363


>gi|83682389|emb|CAJ28184.1| immunoglobulin G binding protein A precursor [Staphylococcus
           aureus]
          Length = 393

 Score = 41.6 bits (96), Expect = 0.81,   Method: Composition-based stats.
 Identities = 51/204 (25%), Positives = 78/204 (38%), Gaps = 21/204 (10%)

Query: 365 NRFKAETRLAYSTIANVANFTSE--------LKQATVLARANAQEEKQRREQEAKEKADR 416
           N+F  E + A+  I ++ N T E        LK    +++    E K+  + +A ++ D 
Sbjct: 187 NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDN 246

Query: 417 EKADKEAKEKADREKADKDLQE--KTPIKAEGDDFGLGLPSVP-THSVKLPPKEEELEEV 473
            K  KE   K  +E  +K  +E  K P K +G+  G      P       P KE+  +  
Sbjct: 247 NKPGKEDNNKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDGNKPG 306

Query: 474 KDEGKK-GKE---------PGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTA 523
           K++G K GKE         PG T  D  +        I  ++ LA K   K     +   
Sbjct: 307 KEDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIKPGQELVVDK 366

Query: 524 KAPPAQAHKGIQDKKPQDQREKPL 547
           K P   A        P+   E P 
Sbjct: 367 KQPANHADANKAQALPETGEENPF 390


>gi|294782453|ref|ZP_06747779.1| membrane protein [Fusobacterium sp. 1_1_41FAA]
 gi|294481094|gb|EFG28869.1| membrane protein [Fusobacterium sp. 1_1_41FAA]
          Length = 495

 Score = 41.6 bits (96), Expect = 0.82,   Method: Composition-based stats.
 Identities = 34/100 (34%), Positives = 52/100 (52%), Gaps = 22/100 (22%)

Query: 395 ARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLP 454
           AR  A+ EK  RE+ A+EKA REKA   AKEKA+RE+  ++   K     +        P
Sbjct: 257 ARERAEREKAIREKAAREKAAREKA---AKEKAERERIAREKAAKEAEAKKNST----KP 309

Query: 455 S-----VPTHSVKLP----------PKEEELEEVKDEGKK 479
           S      PT SV++P           ++ E+E++++E K+
Sbjct: 310 SDNKIKTPTKSVEVPIVVDTSDIELEEKREIEKLREEEKQ 349



 Score = 39.7 bits (91), Expect = 3.8,   Method: Composition-based stats.
 Identities = 21/39 (53%), Positives = 29/39 (74%), Gaps = 2/39 (5%)

Query: 406 REQEAKEKADREKA--DKEAKEKADREKADKDLQEKTPI 442
           RE+ A+E+A+REKA  +K A+EKA REKA K+  E+  I
Sbjct: 253 REKAARERAEREKAIREKAAREKAAREKAAKEKAERERI 291


>gi|167522313|ref|XP_001745494.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163775843|gb|EDQ89465.1| predicted protein [Monosiga brevicollis MX1]
          Length = 1103

 Score = 41.6 bits (96), Expect = 0.82,   Method: Composition-based stats.
 Identities = 34/105 (32%), Positives = 56/105 (53%), Gaps = 25/105 (23%)

Query: 385 TSELKQATVLARANAQEEKQRRE-QEAKEKADRE------KADKEAKEKADREKADKDLQ 437
           T+EL++A     A  Q  KQ RE ++A+EKA RE      KA++EA+    +E+  K+L+
Sbjct: 358 TAELQRAKEEKAAELQRAKQEREAKKAEEKAQREAERARLKAEREAERLKKQEEKRKELE 417

Query: 438 EKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKE 482
           +KT  + E                KL  ++ ELE+VK + ++ +E
Sbjct: 418 QKTAERNE----------------KL--RQAELEKVKRKEEQEQE 444


>gi|269939639|emb|CBI48007.1| immunoglobulin G binding protein A precursor [Staphylococcus aureus
           subsp. aureus TW20]
          Length = 426

 Score = 41.6 bits (96), Expect = 0.83,   Method: Composition-based stats.
 Identities = 56/227 (24%), Positives = 85/227 (37%), Gaps = 45/227 (19%)

Query: 341 QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSE--------LKQAT 392
           + K+L D A   KAD         N+F  E + A+  I ++ N T E        LK   
Sbjct: 200 EAKKLND-AQAPKAD---------NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDP 249

Query: 393 VLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQE--KTPIKAEGDDFG 450
            +++    E K+  + +A ++ D  K  KE   K  +E  +K  +E  K P K +G+   
Sbjct: 250 SVSKEILAEAKKLNDAQAPKEEDNNKPGKEDNNKPGKEDGNKPGKEDNKKPGKEDGNK-- 307

Query: 451 LGLPSVPTHSVKLPPKEEELEEVKDEGKK-GKE---------PGTTETDDREETERKNQD 500
                        P KE+  +  K++G K GKE         PG T  D  +        
Sbjct: 308 -------------PGKEDGNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADK 354

Query: 501 ILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPL 547
           I  ++ LA K   K     +   K P   A        P+   E P 
Sbjct: 355 IAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEENPF 401


>gi|256084886|ref|XP_002578656.1| tektin [Schistosoma mansoni]
 gi|238664037|emb|CAZ34894.1| tektin, putative [Schistosoma mansoni]
          Length = 510

 Score = 41.6 bits (96), Expect = 0.83,   Method: Composition-based stats.
 Identities = 41/155 (26%), Positives = 67/155 (43%), Gaps = 8/155 (5%)

Query: 823 SSLDVQSKFDSSYSKLFEIFYGDWT--NNAIKEERYWTIYAFER---SLKNQAHLNAEVE 877
           +S +++ K DS+   L    +G +   NNA++        A +    SL+       EVE
Sbjct: 332 ASENLREKIDSALRSLIGSVHGQFVTVNNALQTRINEVANARDNLRLSLRKVTQELYEVE 391

Query: 878 RLSG-LAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIKELKSVIEAD 936
            L G L +   D    LK  QT+L   ++ +  N E          + E+ EL+  IE  
Sbjct: 392 NLIGALKKTTDDKIQPLKVAQTRLK--ERTRRINVESCYDQPMKTLQTEVLELRKTIEEL 449

Query: 937 AKENPNPNKNQKKLQKTREKLVAQLSSRLKELNID 971
                N N    +LQK+R  L  ++ ++   L+ID
Sbjct: 450 KNNRRNANITLARLQKSRTSLEQEIETKENSLSID 484


>gi|193787210|dbj|BAG52416.1| unnamed protein product [Homo sapiens]
          Length = 234

 Score = 41.6 bits (96), Expect = 0.83,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 46/97 (47%), Gaps = 14/97 (14%)

Query: 374 AYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKAD 433
           AY     V   TS+    T   RAN +   + +EQE + KA+ E+A + AKE+ ++E+A 
Sbjct: 17  AYQKTVPVEAVTSK----TSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEAR 72

Query: 434 KDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEEL 470
           + L+E+   K +           P  S    P EE L
Sbjct: 73  RKLEEQARAKTQ----------TPPVSPAPQPTEERL 99


>gi|261867880|ref|YP_003255802.1| translation initiation factor IF-2 [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261413212|gb|ACX82583.1| translation initiation factor IF-2 [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 829

 Score = 41.6 bits (96), Expect = 0.84,   Method: Composition-based stats.
 Identities = 49/210 (23%), Positives = 95/210 (45%), Gaps = 29/210 (13%)

Query: 400 QEEKQRREQEAKEKAD---REKADKEAKEKADREKADKDLQEKTPIKAEGDDFG-LGLPS 455
           +E+++  E E + KAD   R+KA+++A++ A+  K   +L +     +  +D+    L S
Sbjct: 110 KEKRKAEEAELRRKADELARQKAEEQARKAAEEAKRYAELSDDNQHNSNTEDYSDYNLTS 169

Query: 456 VPTHSVKLPPKEEELEEVKDEGK----KGKEPGTTETDDREETE--RKNQDILDNSLLAG 509
             +++++   +EE   E +  GK    K K+ G  +  ++ E E  R+NQ      +  G
Sbjct: 170 --SYALEAEDEEERRNEGRGRGKNKVTKAKKGGRDDDSNKNERESNRRNQ----KDVKGG 223

Query: 510 KTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGE-SDYAGIKLTKKEK 568
           K     +  A+  A   PAQA            R+  +   I V E ++   +K T+  K
Sbjct: 224 KGKQAKKGSALQQAFTKPAQAV----------NRDVVIGETITVAELANKMAVKATEVIK 273

Query: 569 ELQEQEENLRVAEIIQQSRMQ--SEDLQEK 596
            + +      + ++I Q   Q  +E++  K
Sbjct: 274 TMMKMGAMATINQVIDQETAQLVAEEMGHK 303


>gi|85107158|ref|XP_962321.1| hypothetical protein NCU07679 [Neurospora crassa OR74A]
 gi|28923924|gb|EAA33085.1| hypothetical protein NCU07679 [Neurospora crassa OR74A]
          Length = 1179

 Score = 41.6 bits (96), Expect = 0.84,   Method: Composition-based stats.
 Identities = 62/242 (25%), Positives = 98/242 (40%), Gaps = 22/242 (9%)

Query: 340 DQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANA 399
           ++I  L +   +VKA     E+R G + +A        +   AN    L     L +++ 
Sbjct: 272 NEISHLEEDLQRVKAQRD-KELRKGGKAQA----LEEAVKKHANELVRLATVVDLKKSSM 326

Query: 400 QEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIK--AEGDDFGLGLPSVP 457
           +EE++RR+   K  AD E A KE  +  ++ KA  D  ++T  K   E D     L ++ 
Sbjct: 327 KEEQERRKAGEKNVADLEAALKEKTKTYEKIKAKYDAAKETLEKQRQEADTKEELLQTLQ 386

Query: 458 THSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNET 517
           T            +E ++ G +G+            TE++   I    L   +   K E 
Sbjct: 387 TGVAS--------KEGQENGYQGQLQDARNRATAAATEQEQAKIKIAHL---EKRIKGEE 435

Query: 518 PAIPTAKAPPAQAHKGIQDKKPQDQR-EKPLASDIGVGESDYAGIKLTKKEKELQEQEEN 576
           P    AK   A   K +   K Q QR EK L     +G       ++ K+E  LQ+   N
Sbjct: 436 PRARKAKEQNAGLLKDLDGLKAQAQRLEKELGR---LGFQPGTEEEMYKQESSLQQTIRN 492

Query: 577 LR 578
           LR
Sbjct: 493 LR 494


>gi|149061813|gb|EDM12236.1| cortactin, isoform CRA_c [Rattus norvegicus]
          Length = 546

 Score = 41.6 bits (96), Expect = 0.89,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 33/50 (66%)

Query: 396 RANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAE 445
           RAN +   + REQE + KA+ E+A + A+E+ ++E+A + L+E+   K +
Sbjct: 351 RANFENLAKEREQEDRRKAEAERAQRMAQERQEQEEARRKLEEQARAKKQ 400


>gi|302835453|ref|XP_002949288.1| hypothetical protein VOLCADRAFT_117098 [Volvox carteri f.
           nagariensis]
 gi|300265590|gb|EFJ49781.1| hypothetical protein VOLCADRAFT_117098 [Volvox carteri f.
           nagariensis]
          Length = 1081

 Score = 41.6 bits (96), Expect = 0.90,   Method: Composition-based stats.
 Identities = 19/36 (52%), Positives = 25/36 (69%), Gaps = 2/36 (5%)

Query: 406 REQEAKEKADREKADKE--AKEKADREKADKDLQEK 439
           +E+  KEK D+EK DKE   KEK D+EK DK+  +K
Sbjct: 869 KEKGDKEKGDKEKGDKEKGGKEKGDKEKGDKEKSDK 904


>gi|183603211|ref|ZP_02710805.2| surface protein PspC [Streptococcus pneumoniae CDC1087-00]
 gi|183570660|gb|EDT91188.1| surface protein PspC [Streptococcus pneumoniae CDC1087-00]
          Length = 581

 Score = 41.6 bits (96), Expect = 0.90,   Method: Composition-based stats.
 Identities = 59/243 (24%), Positives = 90/243 (37%), Gaps = 69/243 (28%)

Query: 395 ARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEK------------TPI 442
           A+A  + E+    +  K K DREKA++EAK +AD ++ D+  + K            TP 
Sbjct: 111 AKAKVESEQAEATRLKKIKTDREKAEEEAKRRADAKEQDESKRRKSRGKRGALGEQATPD 170

Query: 443 KAEGD----DFGLGLPSVPTHSVK------------------------------------ 462
           K E D    D  +G  ++P+ S+K                                    
Sbjct: 171 KKENDAKSSDSSVGEETLPSPSLKPGKKVAEAEKKVEEAEKKAKAQKEEDRRNYPTNTYK 230

Query: 463 ----------LPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTH 512
                     +  KE ELE VK+E K+ +     E   +E+ + +++      L   KT 
Sbjct: 231 TLELEIAESDVKVKEAELELVKEEAKESR---NEEKIKQEKAKVESKKAEATRLEKIKTD 287

Query: 513 TKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLA--SDIGVGESDYAGIKLTKKEKEL 570
            K    A    KA      K     KP+   E+P A  +D    E DYA     K  +  
Sbjct: 288 RKKAEEA--KRKAAEEDKVKEKPAPKPEKPAEQPKAEKTDDQQAEEDYARRSEEKYNRLT 345

Query: 571 QEQ 573
           Q+Q
Sbjct: 346 QQQ 348


>gi|15425681|dbj|BAB64297.1| I-connectin [Procambarus clarkii]
          Length = 17352

 Score = 41.6 bits (96), Expect = 0.91,   Method: Composition-based stats.
 Identities = 52/215 (24%), Positives = 97/215 (45%), Gaps = 20/215 (9%)

Query: 407  EQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAE--GDDFGLGLPSVPTHSVKLP 464
            + E K + +R K D++ +EK       K +  K  +K E     F    P  P  + +  
Sbjct: 5743 DDEIKPRKERTKPDRKEEEKESPSWKIKRIPPKEEVKEEIILKPFTKDKPEEPKPARRPK 5802

Query: 465  PKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHT---KNETPAIP 521
            P +    EV +  K   EP   +TD  + +E + Q  L++ L   +T T   ++E P  P
Sbjct: 5803 PGKPYEPEVPEPEKTPLEP-YRKTDKEKVSELERQRDLED-LKVDETVTDIREDELPVHP 5860

Query: 522  TAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRV-A 580
                   QA  G   K+PQ  +EKP   +  + +     +K T  +K + E+E+   V  
Sbjct: 5861 DK----VQAKPG---KRPQ--KEKPQKEEFSIPK---VALKKTVPKKFVPEEEKLESVDL 5908

Query: 581  EIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQR 615
            E +++ +      +++ W    ++++ +PDE+ +R
Sbjct: 5909 EHVEKPKKPEPTKEKREWSPMPDYETYAPDELPER 5943


>gi|238587040|ref|XP_002391355.1| hypothetical protein MPER_09231 [Moniliophthora perniciosa FA553]
 gi|215455900|gb|EEB92285.1| hypothetical protein MPER_09231 [Moniliophthora perniciosa FA553]
          Length = 356

 Score = 41.6 bits (96), Expect = 0.92,   Method: Composition-based stats.
 Identities = 22/75 (29%), Positives = 41/75 (54%)

Query: 368 KAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKA 427
           +  T+ A ST    A     +++  V  R N +EE+  R++E KE +DR+K ++E +E A
Sbjct: 60  RPSTKTAKSTKDTQAKAKRLMREMQVFWRKNEREERDLRKRELKEASDRQKLEEERREAA 119

Query: 428 DREKADKDLQEKTPI 442
            + +  + L  +T +
Sbjct: 120 RQARKLEFLISQTEL 134


>gi|156543856|ref|XP_001606820.1| PREDICTED: similar to CG33715-PD [Nasonia vitripennis]
          Length = 7697

 Score = 41.6 bits (96), Expect = 0.92,   Method: Composition-based stats.
 Identities = 44/220 (20%), Positives = 94/220 (42%), Gaps = 29/220 (13%)

Query: 396  RANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDL--QEKTPIKAEGDDFGLGL 453
            + N  ++  + ++  K+   +EK D+++ +K D +K D  +   +K   + E  D     
Sbjct: 2766 KENFAQQGIKTDKSDKQVCKKEKIDEKSNKKMDPQKLDSKIGKSQKQQSQEEKSD----- 2820

Query: 454  PSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHT 513
                   VK+  KEE   E+KD  +  ++    + ++ +  E KNQ+ L+ +L       
Sbjct: 2821 -------VKVTVKEEY--ELKDTKRDQRKEQVAKKEESQRRESKNQEALEQAL------- 2864

Query: 514  KNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGE--SDYAGIKLTKKEKELQ 571
                  +   + P  +  K  + +K  ++ EKP    +   E       I+  ++EK ++
Sbjct: 2865 ----EQVVNKEVPHKEDSKKDKFRKQHNKEEKPAKQAVKREELGKQECNIQKPEEEKMIK 2920

Query: 572  EQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDE 611
            E E+        Q+    +E+ Q+K     K  + ++ +E
Sbjct: 2921 EHEQKQSGNNKFQEQEDITEECQKKVSRKEKATEQVAKEE 2960


>gi|313768111|ref|YP_004061542.1| hypothetical protein BpV1_112c [Bathycoccus sp. RCC1105 virus BpV1]
 gi|312599718|gb|ADQ91739.1| hypothetical protein BpV1_112c [Bathycoccus sp. RCC1105 virus BpV1]
          Length = 1145

 Score = 41.6 bits (96), Expect = 0.93,   Method: Composition-based stats.
 Identities = 61/262 (23%), Positives = 120/262 (45%), Gaps = 12/262 (4%)

Query: 365 NRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAK 424
           NRF+     A  T  N  N  ++ KQ   +     +EE +R  +E + +  RE+++++AK
Sbjct: 553 NRFEKGGMFAPKTEQNTINRITKEKQK--IKNKQEKEEDRRLLREEENRKAREESNRKAK 610

Query: 425 EKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPG 484
           EKA+R KA +++  K   +A   +  L   +   +S +L  + +E +E     K+     
Sbjct: 611 EKANR-KAAEEVNRKAREEANRKE-ALNSMTGTGNSKRLWKEAQEKKEANRLAKEKANQN 668

Query: 485 TTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQR- 543
                +R+  E  N+    NS+       +    A    +A      K  Q+ K +  R 
Sbjct: 669 AKNEVNRKAREEANRKEALNSMTGTGNSKRLWKEAQEKKEANRLAKEKANQNAKNEANRL 728

Query: 544 EKPLASDIGVGESDYAGIKLTKKEKE----LQEQEENLRVAEIIQQSRMQSEDLQEKAWD 599
            +  A+     E++    +L  KEK+       +E     A++I+Q R ++E+ +++A +
Sbjct: 729 AREKANQNAKNEANRKAKELNIKEKQNKFNKAAKEAEEAKAKVIEQKR-KAEEARKRAEE 787

Query: 600 SYKEWKSLSPDEIKQRFQKYAK 621
           + ++ K L  + IK++  K+ K
Sbjct: 788 ANRKAKEL--NNIKEKQNKFNK 807


>gi|156848149|ref|XP_001646957.1| hypothetical protein Kpol_2000p67 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156117639|gb|EDO19099.1| hypothetical protein Kpol_2000p67 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 824

 Score = 41.6 bits (96), Expect = 0.93,   Method: Composition-based stats.
 Identities = 65/286 (22%), Positives = 107/286 (37%), Gaps = 46/286 (16%)

Query: 350 SKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQE 409
           SK+++  HWA I   N   A T      ++      +EL+   +LA  N   E    E  
Sbjct: 494 SKLRSMLHWAHIGIWNTDNAVTTKLRPELSESNQNGTELEDQQILANINNTSE----ESF 549

Query: 410 AKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFG------------------- 450
              +   E +D E  E  D E  +  +Q+  P  AE +D G                   
Sbjct: 550 TSVRESVEPSDNEDDEPFDFETNESTIQDAVPANAEVNDGGETETETENHLGNILDDYDT 609

Query: 451 --LGLPSVPTHSV-----KLPPKEEELEEVKDEGKKG---------KEPGTTETDDREET 494
             +G  +  T  V      L P+EE +E  KDE   G         +E   T  DD  + 
Sbjct: 610 ESIGFENSETEPVLGKENDLTPEEETIE--KDESTVGESAEIIDIVQESEVTANDDELKN 667

Query: 495 ERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVG 554
           E +  +I +   +A   + K E   +  A+       +      P+D+   P+     V 
Sbjct: 668 EAEVTEIQETHEIA--ENLKEEESNLEIAEDIVKTVDEEQSPLTPEDEHAVPIHIVEEVQ 725

Query: 555 ESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDS 600
             ++ G    + +  L+EQ  +    +++  S +Q E  Q KA +S
Sbjct: 726 NEEFIGTSKVEDKVLLKEQNFDEDTEKVV-PSNLQVE--QPKAEES 768


>gi|110741657|dbj|BAE98775.1| trichohyalin like protein [Arabidopsis thaliana]
          Length = 699

 Score = 41.6 bits (96), Expect = 0.95,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 2/77 (2%)

Query: 363 HGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKE 422
           +GN  K E R    T  N       +++ T +  A  +EE  RRE+ A EKA+ EK  K 
Sbjct: 609 NGNGKKMEMRSQSETKLNEP--LKRMEEETRIKEARLREENDRRERVAVEKAENEKRLKA 666

Query: 423 AKEKADREKADKDLQEK 439
           A E+ ++E+  K+ +EK
Sbjct: 667 ALEQEEKERKIKEAREK 683



 Score = 40.5 bits (93), Expect = 2.1,   Method: Composition-based stats.
 Identities = 19/36 (52%), Positives = 27/36 (75%)

Query: 394 LARANAQEEKQRREQEAKEKADREKADKEAKEKADR 429
           L  A  QEEK+R+ +EA+EKA+ E+   EA+EKA+R
Sbjct: 664 LKAALEQEEKERKIKEAREKAENERRAVEAREKAER 699


>gi|293364796|ref|ZP_06611513.1| hyalurononglucosaminidase [Streptococcus oralis ATCC 35037]
 gi|291316246|gb|EFE56682.1| hyalurononglucosaminidase [Streptococcus oralis ATCC 35037]
          Length = 2759

 Score = 41.6 bits (96), Expect = 0.96,   Method: Composition-based stats.
 Identities = 44/165 (26%), Positives = 65/165 (39%), Gaps = 4/165 (2%)

Query: 347 DLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRR 406
           D  ++ K D H+ E R     +     A S +   + F + + QA   A  +  E     
Sbjct: 4   DERNRRKMDRHFFEKRCHYSIRKFAIGAASVMIGASIFGANMVQAAETATPSEAEGSVTH 63

Query: 407 EQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPK 466
            Q   +  D   A   A EKAD E A +   E+TP   EG +      + P  S    PK
Sbjct: 64  VQALDKLPDELAA---ALEKADAEAATEASHEETPATDEGTNPAASEEAKPEAS-PASPK 119

Query: 467 EEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKT 511
             E  +  +  K  K+P  T T   +  E+  +D  D + L G T
Sbjct: 120 PAETPKPVETPKADKQPAETTTPAVKPAEKTIEDREDVNHLEGAT 164


>gi|281344677|gb|EFB20261.1| hypothetical protein PANDA_011210 [Ailuropoda melanoleuca]
          Length = 490

 Score = 41.6 bits (96), Expect = 0.97,   Method: Composition-based stats.
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 9/72 (12%)

Query: 396 RANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPS 455
           RAN +   + +EQE + KA+ EKA + AKE+ ++E+A + L E+   +          P+
Sbjct: 314 RANFENLAKEKEQEDRRKAEAEKAQRMAKERQEQEEARRQLHEQAQAQK---------PT 364

Query: 456 VPTHSVKLPPKE 467
            P      P +E
Sbjct: 365 PPASPTPQPAQE 376


>gi|309362452|emb|CAP28112.2| CBR-NMY-2 protein [Caenorhabditis briggsae AF16]
          Length = 2051

 Score = 41.6 bits (96), Expect = 0.98,   Method: Composition-based stats.
 Identities = 42/146 (28%), Positives = 65/146 (44%), Gaps = 16/146 (10%)

Query: 837  KLFEIFYGDWTNNAIKEERYWTIYAFERSLKNQAH---------LNAEVERLSGLAQQPS 887
            KL E    D ++  I E   +     E+ L+ QA          L  E E      ++  
Sbjct: 1039 KLLEERCEDLSSRLIDETELFISIFREKHLRQQAENARRAADVLLREEQEACLEKTRKAE 1098

Query: 888  DSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIKELKSVIEADAKENPNPNK-N 946
            + TA L   +T+LS+       NDE +   IR + EREI+E+++  + DA E  N  K  
Sbjct: 1099 ELTAQLMRKETELSQISM---KNDEELA--IRQQLEREIREIRAQCD-DAVEELNKEKAA 1152

Query: 947  QKKLQKTREKLVAQLSSRLKELNIDN 972
            ++K +K R  +  +L S   EL   N
Sbjct: 1153 RQKAEKARRDMAEELESYKAELEESN 1178


>gi|194763543|ref|XP_001963892.1| GF21016 [Drosophila ananassae]
 gi|190618817|gb|EDV34341.1| GF21016 [Drosophila ananassae]
          Length = 5476

 Score = 41.6 bits (96), Expect = 0.98,   Method: Composition-based stats.
 Identities = 51/211 (24%), Positives = 80/211 (37%), Gaps = 50/211 (23%)

Query: 391  ATVLARANAQEEKQ-------RREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIK 443
            A ++  A   EEK         R     E    E    E++ ++ + ++DKD +  T  K
Sbjct: 3588 AEIIKDAAKDEEKSPLASKEVSRPGSVVESVKDEAEKPESRRESTKPESDKDEKSVTASK 3647

Query: 444  AEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILD 503
                      PS P         E  +E  KDE +K KEP   E+             +D
Sbjct: 3648 E---------PSRP---------ESVVESTKDEAEKSKEPSRPES-------------VD 3676

Query: 504  NSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQD--KKPQDQREKPLASDIGVGESDYAGI 561
             S+ A  T  + ++P      + PA A   ++D  +KP D R + +A             
Sbjct: 3677 ESVKAESTKAEEKSPLASKEASRPASAVGSVKDDAEKPADSRRESVAES----------A 3726

Query: 562  KLTKKEKELQEQEENLRVAEIIQQSRMQSED 592
            KL K  +  +E      VAE IQ    +S++
Sbjct: 3727 KLEKSAEASKEPSRPASVAESIQDEAEKSKE 3757



 Score = 38.5 bits (88), Expect = 7.3,   Method: Composition-based stats.
 Identities = 50/211 (23%), Positives = 79/211 (37%), Gaps = 50/211 (23%)

Query: 391  ATVLARANAQEEKQ-------RREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIK 443
            A ++  A   EEK         R     E    E    E++ ++ + ++DKD +  T  K
Sbjct: 1940 AEIIKDAAKDEEKSPLASKEVSRPGSVVESVKDEAEKPESRRESTKPESDKDEKSVTASK 1999

Query: 444  AEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILD 503
                      PS P         E  +E  KDE +K KEP   E+             + 
Sbjct: 2000 E---------PSRP---------ESVVESTKDEAEKSKEPSRPES-------------VA 2028

Query: 504  NSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQD--KKPQDQREKPLASDIGVGESDYAGI 561
             S+ A  T  + ++P      + PA A   ++D  +KP D R + +A             
Sbjct: 2029 ESVKAESTKAEEKSPLASKEASRPASAVGSVKDDAEKPADSRRESVAES----------A 2078

Query: 562  KLTKKEKELQEQEENLRVAEIIQQSRMQSED 592
            KL K  +  +E      VAE IQ    +S++
Sbjct: 2079 KLEKSAEASKEPSRPASVAESIQDEAEKSKE 2109


>gi|7209643|dbj|BAA92289.1| myosin heavy chain [Seriola dumerili]
          Length = 1938

 Score = 41.6 bits (96), Expect = 0.98,   Method: Composition-based stats.
 Identities = 30/95 (31%), Positives = 48/95 (50%), Gaps = 8/95 (8%)

Query: 880  SGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIKELKSVIEADAKE 939
            S L ++ +DS A+L E    L R K+  E          +SE++ EI +L S +EA AK 
Sbjct: 1194 SALRKKQADSVAELGEQIDNLQRVKQKLEKE--------KSEYKMEIDDLSSNMEAVAKS 1245

Query: 940  NPNPNKNQKKLQKTREKLVAQLSSRLKELNIDNAY 974
              N  K  + L+    +L A+    +++LN  NA+
Sbjct: 1246 KGNLEKMCRTLEDQLSELKAKNDENVRQLNDINAH 1280


>gi|93211089|gb|ABF00987.1| mushroom body defect protein [Drosophila melanogaster]
          Length = 2501

 Score = 41.6 bits (96), Expect = 0.99,   Method: Composition-based stats.
 Identities = 37/142 (26%), Positives = 70/142 (49%), Gaps = 18/142 (12%)

Query: 866  LKNQAHLNAEVERLSGLAQQPSDS-----TADLKEL---------QTQLSRAKKYKESND 911
            ++ Q  L+ +++R    AQQ  D+       + KEL         QT+LS   + ++ + 
Sbjct: 1330 IEAQTKLSDDLQRQKESAQQLVDNLKVELDKERKELAQVNSAFEAQTKLSDDLQRQKESA 1389

Query: 912  ERIVSFIRSEFEREIKEL---KSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL 968
            +++V  ++ E ++E KEL   KSVIEA  K + +  + ++  Q+  + L  +L    KEL
Sbjct: 1390 QQLVDNLKVELDKERKELAQVKSVIEAQTKLSDDLQRQKESAQQLVDNLKMELDKERKEL 1449

Query: 969  -NIDNAYGLWNEYKEDFKASFE 989
              + +A G   +  +D +   E
Sbjct: 1450 AQVKSAIGAQTKLSDDLECQKE 1471



 Score = 40.5 bits (93), Expect = 2.2,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 54/99 (54%), Gaps = 4/99 (4%)

Query: 895  ELQTQLSRAKKYKESNDERIVSFIRSEFEREIKEL---KSVIEADAKENPNPNKNQKKLQ 951
            E QT+LS   + ++ + +++V  ++ E ++E KEL   KSVIEA  K + +  + ++  Q
Sbjct: 1289 EAQTKLSDDLQREKESAQQLVDNLKVELDKERKELAQVKSVIEAQTKLSDDLQRQKESAQ 1348

Query: 952  KTREKLVAQLSSRLKEL-NIDNAYGLWNEYKEDFKASFE 989
            +  + L  +L    KEL  +++A+    +  +D +   E
Sbjct: 1349 QLVDNLKVELDKERKELAQVNSAFEAQTKLSDDLQRQKE 1387


>gi|1850913|gb|AAB48065.1| myosin heavy chain [Entamoeba histolytica]
          Length = 2139

 Score = 41.6 bits (96), Expect = 1.00,   Method: Composition-based stats.
 Identities = 138/687 (20%), Positives = 276/687 (40%), Gaps = 90/687 (13%)

Query: 1    MNELATSIDYQTNNLDQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYI 60
            + +    +D  T + ++ K  ++D+   L  +QDN     E  +A +  LN  K + D  
Sbjct: 1269 LKDTQKKLDDMTADNEKLKAKAKDLEAQLNEVQDN----HEKAVADAELLNKKKAQSDKE 1324

Query: 61   VGPIEQRLKKVSERYERVVSRD---------LTLVIEAGLKDLKEVGDTLKR----LAET 107
            +  ++  L+ +++    V S++         L+  I+   + LK +   L++    L E 
Sbjct: 1325 LNSLKAELEALTKAKSVVESKNKDSENEKAALSEEIDQANEKLKNIQADLRKATADLQEA 1384

Query: 108  GE--VILSDKSDRLLCRFMDMVETEDEHKINKQ--------VRDALESAGFDLESTQENI 157
             E    +  + D+L+     M +T +E K   +            L+    DLE   EN+
Sbjct: 1385 NEKKAEVEAQRDKLVADNKKMTKTLEEIKARDEENTYKVENYEKVLKRKEADLEEANENL 1444

Query: 158  RKVESALINNNMKDAFRFLELAQKSKETADSHIIEAIDVGTKLKENTPPTTFTSISKVLL 217
              +E     N  K   +     +++K+  ++ I E   + T  K++        ++K + 
Sbjct: 1445 -DIEKKDRMNKEKQVKKLEGELKETKDKLNAAIAEKDSIFTAKKQSD--ADLEELNKTVE 1501

Query: 218  KSNNMQDVVFTKIKEVVKKHVNAELGHRKLRGLAFDHTYFNDKLNQFLKEIKNHQKEYDE 277
            + + +   + T+I ++ + + +AE    +LR  A       DK  + + E++    E + 
Sbjct: 1502 EHDEVVAKLNTQITKLTRDNQSAEEELNELRSKA-------DKDKKKISELEEQVNELES 1554

Query: 278  SEKGSSKARYH------AAYAHIYWDLANDWV-NGRVGDKSDEWARTSTNIASWIGRITR 330
               G+  A  +      A  A +   L    V N ++   + E      ++ S I     
Sbjct: 1555 RPVGTGNADENEIKIRDAQIADLNKALEMKGVQNNQLQATNKELKAKDNDLTSKIE---- 1610

Query: 331  TEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELK- 389
                  +T +++K+L +   +++ D   A+         +T         V   T+E++ 
Sbjct: 1611 ------ITENEMKKLENAKKRLEQDKDEAD----KAVSEQTIKRKGLEEEVKKLTTEIQA 1660

Query: 390  ---QATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEG 446
               Q    +    +EEKQR E +  E   +E+ ++E    A+ E       E+  I+AE 
Sbjct: 1661 LKFQINAPSSVAQEEEKQRLESDIAEL--KEQLEQERTTAANAEA------ERKKIQAEL 1712

Query: 447  DDFGLGLPSVPTHSVKLPPK----EEELEEVKDEGKKGKEPGTTETDDR-------EETE 495
            D+    L  V     KL  K    + E++ +K+E K  ++     TDD        +  +
Sbjct: 1713 DEVKFNLEDVTNQREKLVAKNSENDAEIDSLKEEKKALEDEIEKITDDNNKLSEEIDSLD 1772

Query: 496  RKNQDILD--NSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGV 553
            RK   +LD  +S ++ K   ++E      A     + H      K + ++E   A+++ V
Sbjct: 1773 RKYNALLDSKDSDVSMKEKFQDELKVTKDALETEKKNHAETMRLKGRLEKE---AAEVQV 1829

Query: 554  G-ESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEI 612
              E+    + L ++EK   +  ++ R A+   +S M   D  +   D  ++  +   DE+
Sbjct: 1830 RLEALQKNLDLAQQEK--AKATKDYRAADGELKSLMNELDDVKDQLDKAQDDLADKEDEL 1887

Query: 613  KQRFQKYAKVFYRSYSPVDGSYKGTQE 639
                QKY K   +  S  D   +  QE
Sbjct: 1888 ATLDQKY-KTLVKQKSVFDSRIQEMQE 1913


>gi|47221029|emb|CAG12723.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 930

 Score = 41.6 bits (96), Expect = 1.00,   Method: Composition-based stats.
 Identities = 59/266 (22%), Positives = 110/266 (41%), Gaps = 28/266 (10%)

Query: 351 KVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEA 410
           K  A+ H    R G    AE  +   TI       S+L + +VL    A+ + +    E 
Sbjct: 499 KNNANLHANVEREGGLSSAEVSINPGTI-------SDLDKPSVLLETKAKSKVKIPSLEL 551

Query: 411 KEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPS--VPTHSVKLPPKEE 468
             K       ++     + +  D +++  T    EG    L +P   +P   + LP  + 
Sbjct: 552 SLKGSNTPDTEDLLCTGEVDDPDVEIKGYT----EGK---LKMPQLKIPDVQISLPRGKT 604

Query: 469 ELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPA 528
           E  EV+ +GK GK       D       +   ++D SL   KT   NET      K P  
Sbjct: 605 ENPEVEFKGKGGKYKMMKTPDLDNSLPEQKIPLVDISLPKEKTKRVNETKDAEQFKMPNV 664

Query: 529 QAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEEN---LRVAEI-IQ 584
           + +       P+ ++++ + SD+ VG      IK+ + +  L + + N   +   E+   
Sbjct: 665 ELY------IPKGKKDRGVRSDVDVGNIKLPQIKMPEVDVSLSKAKGNQGDVPANEMEAT 718

Query: 585 QSRMQSEDLQEKAWDSYKEWKSLSPD 610
           + +++  D++ +  D+ K+++  SPD
Sbjct: 719 EEKVKCPDVERE--DNDKDFQFSSPD 742


>gi|296414840|ref|XP_002837105.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295632955|emb|CAZ81296.1| unnamed protein product [Tuber melanosporum]
          Length = 615

 Score = 41.2 bits (95), Expect = 1.0,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 48/96 (50%), Gaps = 3/96 (3%)

Query: 388 LKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGD 447
           L++          EEK+R+ Q  +EK  +   D+E KE+ D+ KA++D ++K   K E D
Sbjct: 107 LRELNTKVEVRKAEEKERQAQIEEEKRKKAVEDEERKER-DKAKAERDRKKKD--KGERD 163

Query: 448 DFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEP 483
                 P+V  H V +   E  ++  K + +K + P
Sbjct: 164 SDSKRPPAVGAHQVIIQGPEAVVKGDKIKKRKAESP 199


>gi|118086145|ref|XP_418807.2| PREDICTED: similar to kinesin-like protein 2 [Gallus gallus]
          Length = 1398

 Score = 41.2 bits (95), Expect = 1.0,   Method: Composition-based stats.
 Identities = 57/241 (23%), Positives = 102/241 (42%), Gaps = 42/241 (17%)

Query: 16   DQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYIV-------GPIEQRL 68
            D DK    D+ + +  ++ +I H  E I   + +L     +Y++++       G IE + 
Sbjct: 979  DADKEVVTDLMRQIQELRSSINHKTESIDGLTRELEDINCKYNFVLAAKEESKGIIEDQE 1038

Query: 69   KKVSERYERVVSRDLTLVIEAGL--KDLKEVGDTLKRLAETGEVILSDKSDRLL-CRFMD 125
            KK+ E  E +  R +   +E  L  ++L    D L RL E      S K D LL C   D
Sbjct: 1039 KKIEELREALERRQMADNVERDLLCEELHHTSDQLIRLTEA-----SKKHDALLQCAQQD 1093

Query: 126  MVETEDEHKINKQVRDALESAGFDLESTQENIRKVESALINNNMKDAFRFLELAQKSKET 185
            + E E    + +++R+ L+    +LE      RK E           + F     K K+ 
Sbjct: 1094 ITEKE---ALIQELREQLDKMTEELEK-----RKSE-----------YEF-----KMKQI 1129

Query: 186  ADSHIIEAIDVGTKLKENTPPTTFTSISKVLLKSNNMQDVVFTKIKEVVKKHVNAELGHR 245
             DS  +++  V       TPP    +++K+L    + Q++   +   +  +H+  EL   
Sbjct: 1130 -DSFFVDSSTVTFPQCPKTPPNFDVNLAKIL--ETHEQEIADRRASAITLEHLVHELNEE 1186

Query: 246  K 246
            +
Sbjct: 1187 R 1187


>gi|259123361|gb|ACV92816.1| cytotoxin associated protein A [Helicobacter pylori]
          Length = 1218

 Score = 41.2 bits (95), Expect = 1.0,   Method: Composition-based stats.
 Identities = 42/187 (22%), Positives = 82/187 (43%), Gaps = 22/187 (11%)

Query: 101 LKRLAETGEVILSDKSDRLLCRFMDMVETEDEHKINKQVRDALESAGFDLESTQENIRKV 160
           L  LA T   I  D  D+L+ + + + ET      NK ++D L +    +E  Q +++ +
Sbjct: 546 LNNLAIT-NFIRQDLEDKLVAKGLSLPET------NKLIKDFLSTTKNWVEKFQTSLKLL 598

Query: 161 ESALINNN---MKDAFRFLELAQKSKETADSHIIEAIDVGTKLKENTPPTTFTSISKVLL 217
             A    N   +K A + LE + + +E  +  + + ++  +  K      +         
Sbjct: 599 AEAKNTGNYDEVKKAQKDLEKSLRKREHLEKEVAKNLESKSNNKNKMEAKS--------- 649

Query: 218 KSNNMQDVVFTKIKEVVKKHVNAELGHRKLRGLAFDHTYFNDKLNQFLKEIKNHQKEYDE 277
           ++N+ +D +F  I +   K   A      L+G+  +    +DKL    K +K+  K +DE
Sbjct: 650 QANSQKDEIFALINKEANKDARAIAYASNLKGIKRE---LSDKLENVNKNLKDFSKSFDE 706

Query: 278 SEKGSSK 284
            + G +K
Sbjct: 707 FKNGKNK 713


>gi|73965995|ref|XP_862960.1| PREDICTED: similar to SWI/SNF-related matrix-associated
           actin-dependent regulator of chromatin e1 isoform 6
           [Canis familiaris]
          Length = 413

 Score = 41.2 bits (95), Expect = 1.1,   Method: Composition-based stats.
 Identities = 45/209 (21%), Positives = 87/209 (41%), Gaps = 31/209 (14%)

Query: 341 QIKQLRDLASKVKADYHWAEIRH---GNRFKAETRLAYSTIANVANFTSELKQATVLARA 397
           Q++ L     K++A+    E RH     +F   T    + +  +     E+    + A  
Sbjct: 232 QVQSLMVHQRKLEAELLQIEERHQEKKRKFLESTDSFNNELKRLCGLKVEVDMEKIAAEI 291

Query: 398 NAQEEKQRREQEAKEKADREKADK-EAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSV 456
              EE+ R+ QE +EK   E+A++ ++    + E A    QEK       DD        
Sbjct: 292 AQAEEQARKRQEEREKEAAEQAERSQSSMVPEEEPAASKTQEKK------DD-------- 337

Query: 457 PTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNE 516
              S+ +  +E  LEE  +  + G+E GT+  +D+E  +     + +       T +++ 
Sbjct: 338 --ESIPMETEETHLEEATESQQNGEE-GTSTPEDKESGQEGVDSMAEEGTSDSNTGSESN 394

Query: 517 TPAIPTAKAPPAQAHKGIQDKKPQDQREK 545
           +    T + PP        D  P+D++++
Sbjct: 395 S---ATVEEPPT-------DPTPEDEKKE 413


>gi|332074028|gb|EGI84506.1| sialidase, N-terminal domain protein [Streptococcus pneumoniae
            GA41301]
          Length = 284

 Score = 41.2 bits (95), Expect = 1.1,   Method: Composition-based stats.
 Identities = 55/224 (24%), Positives = 89/224 (39%), Gaps = 38/224 (16%)

Query: 861  AFERSLKNQAHLNAEVERLSGLAQ-QPSDSTADLKELQTQLSRAKKYKESNDERIVSFIR 919
            A E+ L N+  L+ E   L+   + QPS         +T+LS  K+ +E  D++     R
Sbjct: 19   ASEQPLANETQLSGESSTLTDTEKSQPSS--------ETELSGNKQEQERKDKQEEKIPR 70

Query: 920  SEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NIDNAYGLWN 978
              + R+++ +++VIE +  E  N +  Q+            LSS L +L  ++NA  +  
Sbjct: 71   DYYARDLENVETVIEKEDVET-NASNGQR----------VDLSSELDKLKKLENA-TVHM 118

Query: 979  EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGDPSLMMDYEKVEPS 1038
            E+K D KA   Y L +   A     KD      +Y+ + T++  G D     +     P 
Sbjct: 119  EFKPDAKAPAFYNLFSVSSA---TKKDEYFTMAVYNNTATLEGRGSDGKQFYNNYNDAPL 175

Query: 1039 DVMAGLPDDLAKRFKALLSWKGWHQLTPAPKISTPSFEVSSYVN 1082
             V  G              W         P    P+  V  YVN
Sbjct: 176  KVKPG-------------QWNSVTFTVEKPTAELPNGRVRLYVN 206


>gi|301770085|ref|XP_002920464.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 8-like [Ailuropoda
           melanoleuca]
 gi|281341524|gb|EFB17108.1| hypothetical protein PANDA_009195 [Ailuropoda melanoleuca]
          Length = 1116

 Score = 41.2 bits (95), Expect = 1.1,   Method: Composition-based stats.
 Identities = 29/108 (26%), Positives = 48/108 (44%), Gaps = 10/108 (9%)

Query: 399 AQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPS--- 455
           A+EE ++RE E  +K D+E + K  +E    ++  K   E T  K   +D G   P+   
Sbjct: 520 AKEEMEKRESEQAKKEDKETSAKRGREITGVKRQSKSEHETTDAKKSAEDRGKRCPTPEL 579

Query: 456 -------VPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETER 496
                  VP  SV       +  ++K + + G     T  ++ E+TER
Sbjct: 580 QKKAVGDVPQASVAGDSNSGKPVKIKGQPESGILKTGTFRENTEDTER 627


>gi|326922133|ref|XP_003207306.1| PREDICTED: kinesin-like protein KIF15-like [Meleagris gallopavo]
          Length = 1398

 Score = 41.2 bits (95), Expect = 1.1,   Method: Composition-based stats.
 Identities = 57/241 (23%), Positives = 102/241 (42%), Gaps = 42/241 (17%)

Query: 16   DQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYIV-------GPIEQRL 68
            D DK    D+ + +  ++ +I H  E I   + +L     +Y++++       G IE + 
Sbjct: 979  DADKEVVTDLMRQIQELRSSINHKTESIDGLTRELEDINCKYNFVLAAKEESKGIIEDQE 1038

Query: 69   KKVSERYERVVSRDLTLVIEAGL--KDLKEVGDTLKRLAETGEVILSDKSDRLL-CRFMD 125
            KK+ E  E +  R +   +E  L  ++L    D L RL E      S K D LL C   D
Sbjct: 1039 KKIEELREALERRQMADNVERDLLCEELHHTSDQLIRLTEA-----SKKHDALLQCAQQD 1093

Query: 126  MVETEDEHKINKQVRDALESAGFDLESTQENIRKVESALINNNMKDAFRFLELAQKSKET 185
            + E E    + +++R+ L+    +LE      RK E           + F     K K+ 
Sbjct: 1094 ITEKE---ALIQELREQLDKMTEELEK-----RKSE-----------YEF-----KMKQI 1129

Query: 186  ADSHIIEAIDVGTKLKENTPPTTFTSISKVLLKSNNMQDVVFTKIKEVVKKHVNAELGHR 245
             DS  +++  V       TPP    +++K+L    + Q++   +   +  +H+  EL   
Sbjct: 1130 -DSFFVDSSTVTFPQCPKTPPNFDVNLAKIL--ETHEQEIADRRASTITLEHLVHELNEE 1186

Query: 246  K 246
            +
Sbjct: 1187 R 1187


>gi|322706004|gb|EFY97586.1| hypothetical protein MAA_06811 [Metarhizium anisopliae ARSEF 23]
          Length = 794

 Score = 41.2 bits (95), Expect = 1.1,   Method: Composition-based stats.
 Identities = 37/121 (30%), Positives = 55/121 (45%), Gaps = 19/121 (15%)

Query: 401 EEKQRREQEAKEKA-DREKAD--KEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVP 457
           EE+ RREQ  KEKA DRE  +  K+ KE+  +E+  K LQEK   KA  D+         
Sbjct: 500 EEQARREQAEKEKARDRETKEIAKKDKEQEKQEEKAKKLQEKMDEKARKDE--------- 550

Query: 458 THSVKLPPKEEELEEVKDEGKKGKE-PGTTETDDREETERKNQDILDNSLLAGKTHTKNE 516
               +   K E+  + K+E ++ K  P    T    + E   +   D +    +  T+ E
Sbjct: 551 ----ERATKAEQKRQAKEEKRRSKHGPAVATTSSPHQGEHTQE--ADENPAGREEETRGE 604

Query: 517 T 517
           T
Sbjct: 605 T 605


>gi|148678506|gb|EDL10453.1| myosin, heavy polypeptide 10, non-muscle [Mus musculus]
          Length = 1963

 Score = 41.2 bits (95), Expect = 1.1,   Method: Composition-based stats.
 Identities = 72/301 (23%), Positives = 124/301 (41%), Gaps = 73/301 (24%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   EVL  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 963  AEAKIKKMEEEVLLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 1017

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQ--------PPLYTIISGSE 810
            K E  +SD+   L+K  KT  ++ + K +L G   D+ Q+Q          L   ++  E
Sbjct: 1018 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDL-QDQIAELQAQVDELKVQLTKKE 1076

Query: 811  KILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFER 864
            + LQG      D T    ++L V  +  +  ++L E F                    E+
Sbjct: 1077 EELQGALARGDDETLHKNNALKVARELQAQIAELQEDFES------------------EK 1118

Query: 865  SLKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFER 924
            + +N+A             +Q  D + +L+ L+T+L        +  E     +R++ E+
Sbjct: 1119 ASRNKAE------------KQKRDLSEELEALKTELEDTLDTTAAQQE-----LRTKREQ 1161

Query: 925  EIKELKSVIEADAKENPNPNKNQKKLQKTR-EKLVAQL--SSRLKELNIDNAYGLWNEYK 981
            E+ ELK  +E + K +    ++ ++   T  E+L  QL  + R K     N  GL  + K
Sbjct: 1162 EVAELKKALEDETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNK 1221

Query: 982  E 982
            E
Sbjct: 1222 E 1222


>gi|45551456|ref|NP_727769.2| mushroom body defect, isoform B [Drosophila melanogaster]
 gi|45446951|gb|AAN09583.2| mushroom body defect, isoform B [Drosophila melanogaster]
          Length = 2520

 Score = 41.2 bits (95), Expect = 1.1,   Method: Composition-based stats.
 Identities = 37/143 (25%), Positives = 70/143 (48%), Gaps = 18/143 (12%)

Query: 865  SLKNQAHLNAEVERLSGLAQQPSDST-----------ADLK---ELQTQLSRAKKYKESN 910
            + + Q  L+ +++R    AQQ  D+            A +K   E QT+LS   + ++ +
Sbjct: 1329 AFEAQTKLSDDLQREKESAQQLVDNLKVELDKERKELAQVKSVIEAQTKLSDDLQRQKES 1388

Query: 911  DERIVSFIRSEFEREIKEL---KSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKE 967
             +++V  ++ E ++E KEL   KSVIEA  K + +  + ++  Q+  + L  +L    KE
Sbjct: 1389 AQQLVDNLKVELDKERKELAKVKSVIEAQTKLSDDLQRQKESAQQLVDNLKMELDKERKE 1448

Query: 968  L-NIDNAYGLWNEYKEDFKASFE 989
            L  + +A G   +  +D +   E
Sbjct: 1449 LAQVKSAIGAQTKLSDDLECQKE 1471



 Score = 40.1 bits (92), Expect = 2.5,   Method: Composition-based stats.
 Identities = 36/139 (25%), Positives = 68/139 (48%), Gaps = 18/139 (12%)

Query: 869  QAHLNAEVERLSGLAQQPSDS-----TADLKEL---------QTQLSRAKKYKESNDERI 914
            Q  L+ +++R     QQ  D+       + KEL         QT+LS   + ++ + +++
Sbjct: 1165 QTKLSDDLQRQKESGQQLVDNLKVELEKERKELAHVNSAIGAQTKLSDDLECQKESGQQL 1224

Query: 915  VSFIRSEFEREIKEL---KSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NI 970
            V  ++ E E+E KEL   KSVIEA  K + +  + ++  Q+  + L  +L    KEL  +
Sbjct: 1225 VDNLKVELEKERKELAQVKSVIEAQTKLSDDLQREKESAQQLVDNLKVELDKERKELAQV 1284

Query: 971  DNAYGLWNEYKEDFKASFE 989
            ++A+    +  +D +   E
Sbjct: 1285 NSAFEAQTKLSDDLQRQKE 1303


>gi|24641959|ref|NP_727770.1| mushroom body defect, isoform A [Drosophila melanogaster]
 gi|22832726|gb|AAF48362.2| mushroom body defect, isoform A [Drosophila melanogaster]
          Length = 2328

 Score = 41.2 bits (95), Expect = 1.1,   Method: Composition-based stats.
 Identities = 37/143 (25%), Positives = 70/143 (48%), Gaps = 18/143 (12%)

Query: 865  SLKNQAHLNAEVERLSGLAQQPSDST-----------ADLK---ELQTQLSRAKKYKESN 910
            + + Q  L+ +++R    AQQ  D+            A +K   E QT+LS   + ++ +
Sbjct: 1329 AFEAQTKLSDDLQREKESAQQLVDNLKVELDKERKELAQVKSVIEAQTKLSDDLQRQKES 1388

Query: 911  DERIVSFIRSEFEREIKEL---KSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKE 967
             +++V  ++ E ++E KEL   KSVIEA  K + +  + ++  Q+  + L  +L    KE
Sbjct: 1389 AQQLVDNLKVELDKERKELAKVKSVIEAQTKLSDDLQRQKESAQQLVDNLKMELDKERKE 1448

Query: 968  L-NIDNAYGLWNEYKEDFKASFE 989
            L  + +A G   +  +D +   E
Sbjct: 1449 LAQVKSAIGAQTKLSDDLECQKE 1471



 Score = 40.1 bits (92), Expect = 2.5,   Method: Composition-based stats.
 Identities = 36/139 (25%), Positives = 68/139 (48%), Gaps = 18/139 (12%)

Query: 869  QAHLNAEVERLSGLAQQPSDS-----TADLKEL---------QTQLSRAKKYKESNDERI 914
            Q  L+ +++R     QQ  D+       + KEL         QT+LS   + ++ + +++
Sbjct: 1165 QTKLSDDLQRQKESGQQLVDNLKVELEKERKELAHVNSAIGAQTKLSDDLECQKESGQQL 1224

Query: 915  VSFIRSEFEREIKEL---KSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NI 970
            V  ++ E E+E KEL   KSVIEA  K + +  + ++  Q+  + L  +L    KEL  +
Sbjct: 1225 VDNLKVELEKERKELAQVKSVIEAQTKLSDDLQREKESAQQLVDNLKVELDKERKELAQV 1284

Query: 971  DNAYGLWNEYKEDFKASFE 989
            ++A+    +  +D +   E
Sbjct: 1285 NSAFEAQTKLSDDLQRQKE 1303


>gi|302386300|ref|YP_003822122.1| chromosome segregation protein SMC [Clostridium saccharolyticum WM1]
 gi|302196928|gb|ADL04499.1| chromosome segregation protein SMC [Clostridium saccharolyticum WM1]
          Length = 1186

 Score = 41.2 bits (95), Expect = 1.1,   Method: Composition-based stats.
 Identities = 52/210 (24%), Positives = 93/210 (44%), Gaps = 38/210 (18%)

Query: 866  LKNQAHLNAEVERL----SGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSE 921
            L+N   +  E+ RL    +GL+   + S + ++E Q ++           E + S I+ E
Sbjct: 830  LENIRRIKEEIHRLEEELTGLSNGTNGSNSIIEEKQKEI-----------EALKSRIQEE 878

Query: 922  FEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLS-------------SRLKEL 968
             +R  +EL+ +I   + +    ++ QK L + RE+L  ++S              +L+E 
Sbjct: 879  MKRS-EELEGIISEKSSQKEASSREQKALFQKREELTGRISLLDKELFRLQSQKEKLEEW 937

Query: 969  NIDNAYGLWNEYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGG-DPS 1027
               +   +WNEY+  +  + E  L   E   L  +K M     I S+ + I+K G  + +
Sbjct: 938  MESHVNYMWNEYELTYSTAEE--LRNEEWTSLPEIKRM-----IQSLKEEIRKLGNVNVN 990

Query: 1028 LMMDYEKV-EPSDVMAGLPDDLAKRFKALL 1056
             + DY++V E    M    DDL      LL
Sbjct: 991  AIEDYKEVSERYGFMKTQHDDLVSAEATLL 1020


>gi|302654175|ref|XP_003018898.1| conserved hypothetical protein [Trichophyton verrucosum HKI 0517]
 gi|291182582|gb|EFE38253.1| conserved hypothetical protein [Trichophyton verrucosum HKI 0517]
          Length = 1053

 Score = 41.2 bits (95), Expect = 1.1,   Method: Composition-based stats.
 Identities = 41/149 (27%), Positives = 68/149 (45%), Gaps = 10/149 (6%)

Query: 461 VKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAI 520
           V+ PPK +E  + +D+ K  +EP   E  D EET  K  D L  +        +    A+
Sbjct: 215 VEEPPKLDEEPKAEDDLKVDEEPKAKELPDEEET--KADDQLGTTEEPTPDEPQPAEEAV 272

Query: 521 PTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLR-- 578
           PT +A P +A   +++ KPQD   +               I+  K E+ + EQE  L   
Sbjct: 273 PTEEASPEEA--ALEETKPQDAAPEVEEKFEEAAPESETQIEEDKFEEAIPEQEAKLEDN 330

Query: 579 -VAEII---QQSRMQSEDLQEKAWDSYKE 603
            V++ I   ++ + + +   E+A +S KE
Sbjct: 331 VVSDAIPLPEEVQQEGDKQPEQATESVKE 359


>gi|237835003|ref|XP_002366799.1| trichohyalin, putative [Toxoplasma gondii ME49]
 gi|211964463|gb|EEA99658.1| trichohyalin, putative [Toxoplasma gondii ME49]
          Length = 2238

 Score = 41.2 bits (95), Expect = 1.1,   Method: Composition-based stats.
 Identities = 49/224 (21%), Positives = 98/224 (43%), Gaps = 26/224 (11%)

Query: 400 QEEKQRREQEAKE----KADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPS 455
           +EE+++ EQE +E    +A+ EK  +EA EKA +E+  K  +E+   K    +   G   
Sbjct: 495 KEERKKMEQEREEWQKHRAEEEKGKQEAIEKAVKEERKKLEEERNEWKMHRAEMEKG--- 551

Query: 456 VPTHSVKLPPKEEELEEVKDEGKKGKEPGTTE-TDDREETERKNQDILDNSLLAGKTHTK 514
                     K+E +E+  +E +K  E    E    R E E+  Q+ ++ ++   +   +
Sbjct: 552 ----------KQEAIEKAVEEERKKMEQEREEWQKHRAEEEKGKQEAIEKAVKEERKKME 601

Query: 515 NETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQE 574
            E            Q H+  ++K  Q+  EK +  +    E +    +  + E+E  +QE
Sbjct: 602 QEREE--------WQKHRAEEEKGKQEAIEKAVEEERKKMEQEREEWQKHRAEEEKGKQE 653

Query: 575 ENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQK 618
              +  E  ++   Q  +  +K  +  ++      +E+KQ+ Q+
Sbjct: 654 AIEKAVEEERKKMEQEREQWQKRQEEREKENEQDGEEMKQKLQR 697


>gi|149061814|gb|EDM12237.1| cortactin, isoform CRA_d [Rattus norvegicus]
          Length = 381

 Score = 41.2 bits (95), Expect = 1.1,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 33/50 (66%)

Query: 396 RANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAE 445
           RAN +   + REQE + KA+ E+A + A+E+ ++E+A + L+E+   K +
Sbjct: 186 RANFENLAKEREQEDRRKAEAERAQRMAQERQEQEEARRKLEEQARAKKQ 235


>gi|50557430|ref|XP_506123.1| YALI0F32175p [Yarrowia lipolytica]
 gi|49651993|emb|CAG78937.1| YALI0F32175p [Yarrowia lipolytica]
          Length = 831

 Score = 41.2 bits (95), Expect = 1.1,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 59/123 (47%), Gaps = 10/123 (8%)

Query: 383 NFTSELKQATV-LARANAQEEKQRREQEAKEKADREKADKEAK--EKADREK-------A 432
           NF  EL+   +  AR +A+E ++R  +EA +K  +++A+K+    + A+ EK       A
Sbjct: 462 NFVEELELRKIKRARKDAEESEKRPVEEAADKKKQQEAEKQTSGLQNAEEEKMPLAEEPA 521

Query: 433 DKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDRE 492
           ++   EK  + AE +  GL        +V    +  + EE + +   G+E G     + E
Sbjct: 522 ERPAGEKRRLTAEAEKQGLAEAEAEKLTVTGVGRVRQTEETEKQILVGEEAGRLRQAEEE 581

Query: 493 ETE 495
           E +
Sbjct: 582 EIQ 584


>gi|224023664|ref|ZP_03642030.1| hypothetical protein BACCOPRO_00378 [Bacteroides coprophilus DSM
           18228]
 gi|224016886|gb|EEF74898.1| hypothetical protein BACCOPRO_00378 [Bacteroides coprophilus DSM
           18228]
          Length = 617

 Score = 41.2 bits (95), Expect = 1.1,   Method: Composition-based stats.
 Identities = 83/406 (20%), Positives = 166/406 (40%), Gaps = 49/406 (12%)

Query: 562 KLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAK 621
           ++++ E E    + ++R  E   Q  M    LQ K  +S+ + K    DE+ ++ QK   
Sbjct: 51  QISRLEAEATAYQTSVRENEEKHQKTMGEICLQNKELNSHIDEK----DELIKQLQK--- 103

Query: 622 VFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYY--RIHNFLSQWSPLGLMYEKDELHGV 679
                 S    + +  QE    +N+ L      Y  +I N L Q +   L  ++  L   
Sbjct: 104 ----DISDKGKALEDLQEKYNQLNNSLKVQQDSYEEKIKN-LHQDTDTSLQQKEQNLLNA 158

Query: 680 EAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGESSVRKHSFEVLSSKHQKSVIAVNN 739
               Q+L        E +R  +   DA+S+ V   E  ++             +  A+N 
Sbjct: 159 RQDIQELQ-------EKIRRTEAERDALSQTVSEKEERLKT------------TETALNE 199

Query: 740 FIKEITHHTRRLVKEDPKRGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQ 799
            + +I     R    + +  ++E+ L+ +RS +QK+ + +      L+  G+   + + +
Sbjct: 200 ALIQIQKMDIRYKDSENQNKEAETELTTLRSNIQKLEQQLQQSEASLK--GLNTRLDENE 257

Query: 800 PPLYTIISGSEKILQGDYTFPPLSSLD----VQSKFDSSYSKLFEIFYGDWTNNAIKEER 855
                +    E+    +     LSSL        K +    +L E+     T   + E +
Sbjct: 258 SRNSQLAFQVEEYTSKNQEL--LSSLKEAQTYSQKLEKEIDQLKELQDQTETKGQVAENK 315

Query: 856 YWTIYAFERSLKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIV 915
                +  + L  +A +N   E+L+G   +      +LK  Q++   A+K ++  ++++ 
Sbjct: 316 LAQTLSANKEL--EAQINEAKEKLTGSENKLKSIAEELKHEQSKRLTAEKQQKETEDKLS 373

Query: 916 SFIRSEFEREIKELKSVIEADAKENPNPNK-NQKKLQKTREKLVAQ 960
           S +     REI  L+  I+A  +E  +P+  +QK  + T ++L  Q
Sbjct: 374 SAL-----REITILQETIKALEQEQTSPSAPSQKDTKNTLQELSEQ 414


>gi|154249780|ref|YP_001410605.1| methyl-accepting chemotaxis sensory transducer [Fervidobacterium
           nodosum Rt17-B1]
 gi|154153716|gb|ABS60948.1| methyl-accepting chemotaxis sensory transducer [Fervidobacterium
           nodosum Rt17-B1]
          Length = 465

 Score = 41.2 bits (95), Expect = 1.1,   Method: Composition-based stats.
 Identities = 56/253 (22%), Positives = 111/253 (43%), Gaps = 36/253 (14%)

Query: 1   MNELATSIDYQTNNLDQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYI 60
           +NE   SIDY  +NL Q +  +  VA  +  +      + +++I   + +N    R + I
Sbjct: 145 LNEFKASIDYLRDNLRQVRDEAISVADNINELSLENDSIAKYMINIVNQMNEITSRVESI 204

Query: 61  VGPIEQR---LKKVSERYERVV--SRDLTLVIEAGLKDLKEVGDTLKRLAETGEVILSDK 115
              IE+    ++++S   + +   ++   +  E  +K  K+ G  LK++  T + I S  
Sbjct: 205 SAAIEETTAGVEEISSATKNIAHNTQQAVMFAEDSVKLAKDAGSVLKQVILTTKGISSSA 264

Query: 116 SDRLLCRFMDMVETEDEHKINKQVRDALESAGF----DLESTQENIRKVESALINNNMKD 171
            D       ++VE+ +        R A E +GF    +  + Q N+  + +A+      +
Sbjct: 265 KD-----VENVVESFN--------RGAEEISGFVETINAIAEQTNLLALNAAIEAARAGE 311

Query: 172 AFR--------FLELAQKSKETADS--HIIEAIDVGTKLKENTPPTTFTSISKVLLKSNN 221
           A R          +LA++SK  +D+   ++E I     + EN    +   +S+V  + N 
Sbjct: 312 AGRGFAVVADEIRKLAEESKRASDNVRRVVEEI---KGIAENANKVSGEIVSRV-EEGNK 367

Query: 222 MQDVVFTKIKEVV 234
           + D   T I E++
Sbjct: 368 LVDKADTMIDEII 380


>gi|241247398|ref|XP_002402802.1| serine/threonine kinase pskh, putative [Ixodes scapularis]
 gi|215496404|gb|EEC06044.1| serine/threonine kinase pskh, putative [Ixodes scapularis]
          Length = 539

 Score = 41.2 bits (95), Expect = 1.1,   Method: Composition-based stats.
 Identities = 28/112 (25%), Positives = 60/112 (53%), Gaps = 4/112 (3%)

Query: 396 RANAQEEKQRREQEAKEKADREKADKEA--KEKADREKADKDLQEKTPIKAEGDDFGLGL 453
           R  +  +K  R++   +K+DR+K+D++   ++K+DR+K+D+D  +K   K++ D      
Sbjct: 185 RDKSDRDKSDRDKSDHDKSDRDKSDRDKSDRDKSDRDKSDRDRVDKNE-KSDRDRSDKYE 243

Query: 454 PSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNS 505
            S    S K    E +  + KD+  +  +    ++D  E++++ ++D  D S
Sbjct: 244 KSDRDRSDKYEKSERDRSD-KDKSDRHDKSDRDKSDRHEKSDKSDRDKYDKS 294


>gi|149007766|ref|ZP_01831375.1| choline binding protein A [Streptococcus pneumoniae SP18-BS74]
 gi|147760761|gb|EDK67733.1| choline binding protein A [Streptococcus pneumoniae SP18-BS74]
          Length = 560

 Score = 41.2 bits (95), Expect = 1.1,   Method: Composition-based stats.
 Identities = 53/226 (23%), Positives = 107/226 (47%), Gaps = 27/226 (11%)

Query: 381 VANFTSELKQATV-LARANAQE---EKQRREQEAKEKADREKADKEAKEKADREKADKDL 436
           +A    E+K+A + L +  A+E   +++ ++ EAK ++ + +A +    K DREKA+++ 
Sbjct: 177 IAESDVEVKKAELELVKEEAKESRDDEKIKQAEAKVESKKAEATRLENIKTDREKAEEEA 236

Query: 437 QEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETER 496
           + +   K +              +V+      E ++ K   K+G  PG   T D++E + 
Sbjct: 237 KRRAEAKLK-------------EAVEKNVATSEQDKPKGRRKRGV-PGEQATPDKKENDA 282

Query: 497 KNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLAS----DIG 552
           K+ D             K E   +  A+   A+A K  + +K +D+R  P  +    ++ 
Sbjct: 283 KSSDSSVGEEALPSPSLKPEK-KVAEAEKKVAEAEKKAKAQKEEDRRNYPTNTYKTLELE 341

Query: 553 VGESDYAGIKLTKKEKEL-QEQEENLRVAEIIQQSRMQSEDLQEKA 597
           + ESD   +K+ + E EL +E+ +  R  E + Q++ + E  + +A
Sbjct: 342 IAESD---VKVKEAELELVKEEAKESRNEEKVNQAKAKVESKKAEA 384


>gi|301757633|ref|XP_002914672.1| PREDICTED: LOW QUALITY PROTEIN: voltage-dependent L-type calcium
           channel subunit alpha-1S-like [Ailuropoda melanoleuca]
          Length = 1867

 Score = 41.2 bits (95), Expect = 1.2,   Method: Composition-based stats.
 Identities = 28/88 (31%), Positives = 43/88 (48%), Gaps = 4/88 (4%)

Query: 407 EQEAKEKADREKADKEAKEKADREKADKDLQEKTPI--KAEGDDFGLGLPSVPTHSVKLP 464
           E E+   A + KA+++ + K  +   DK  +EK+ I  K E    G G+P+  T  +K+ 
Sbjct: 666 EAESLTSAQKAKAEEKKRRKMSKGLPDKSEEEKSVIAKKLEQKPKGEGIPT--TAKLKID 723

Query: 465 PKEEELEEVKDEGKKGKEPGTTETDDRE 492
             E  + EVKD       PG  E D+ E
Sbjct: 724 EFESNVNEVKDPYPSADFPGDDEEDEPE 751


>gi|281351206|gb|EFB26790.1| hypothetical protein PANDA_002570 [Ailuropoda melanoleuca]
          Length = 1875

 Score = 41.2 bits (95), Expect = 1.2,   Method: Composition-based stats.
 Identities = 28/88 (31%), Positives = 43/88 (48%), Gaps = 4/88 (4%)

Query: 407 EQEAKEKADREKADKEAKEKADREKADKDLQEKTPI--KAEGDDFGLGLPSVPTHSVKLP 464
           E E+   A + KA+++ + K  +   DK  +EK+ I  K E    G G+P+  T  +K+ 
Sbjct: 666 EAESLTSAQKAKAEEKKRRKMSKGLPDKSEEEKSVIAKKLEQKPKGEGIPT--TAKLKID 723

Query: 465 PKEEELEEVKDEGKKGKEPGTTETDDRE 492
             E  + EVKD       PG  E D+ E
Sbjct: 724 EFESNVNEVKDPYPSADFPGDDEEDEPE 751


>gi|73965989|ref|XP_851010.1| PREDICTED: similar to SWI/SNF-related matrix-associated
           actin-dependent regulator of chromatin e1 isoform 2
           [Canis familiaris]
          Length = 411

 Score = 41.2 bits (95), Expect = 1.2,   Method: Composition-based stats.
 Identities = 45/209 (21%), Positives = 87/209 (41%), Gaps = 31/209 (14%)

Query: 341 QIKQLRDLASKVKADYHWAEIRH---GNRFKAETRLAYSTIANVANFTSELKQATVLARA 397
           Q++ L     K++A+    E RH     +F   T    + +  +     E+    + A  
Sbjct: 230 QVQSLMVHQRKLEAELLQIEERHQEKKRKFLESTDSFNNELKRLCGLKVEVDMEKIAAEI 289

Query: 398 NAQEEKQRREQEAKEKADREKADK-EAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSV 456
              EE+ R+ QE +EK   E+A++ ++    + E A    QEK       DD        
Sbjct: 290 AQAEEQARKRQEEREKEAAEQAERSQSSMVPEEEPAASKTQEKK------DD-------- 335

Query: 457 PTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNE 516
              S+ +  +E  LEE  +  + G+E GT+  +D+E  +     + +       T +++ 
Sbjct: 336 --ESIPMETEETHLEEATESQQNGEE-GTSTPEDKESGQEGVDSMAEEGTSDSNTGSESN 392

Query: 517 TPAIPTAKAPPAQAHKGIQDKKPQDQREK 545
           +    T + PP        D  P+D++++
Sbjct: 393 S---ATVEEPPT-------DPTPEDEKKE 411


>gi|145539868|ref|XP_001455624.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124423432|emb|CAK88227.1| unnamed protein product [Paramecium tetraurelia]
          Length = 1003

 Score = 41.2 bits (95), Expect = 1.2,   Method: Composition-based stats.
 Identities = 83/428 (19%), Positives = 177/428 (41%), Gaps = 39/428 (9%)

Query: 231 KEVVKKHVNAELGHRKL-------RGLAFDHTYFNDKLNQFLKEIKNHQKEYDESEKGSS 283
           KE+  KH +AE  ++ L       + L  +    ND +NQ  KEI   QK+ D+  K   
Sbjct: 473 KELGDKHNDAEQLNKDLDEYEQENKELQKEINQLNDSINQLNKEINQKQKQIDQQAKDIQ 532

Query: 284 KARYHAAYAHIYWDLANDWVNGRVGDKSDEWARTSTNIASWIGRITRTEGLGGVTYDQIK 343
           + +      ++     ++  N  + ++ +E  + +  +     +I  TE     T DQ+K
Sbjct: 533 ELQ-----ENLEKQKQDNQNNNDLDEQLNESKKQNQKLQD---QINNTEQKQNKTQDQLK 584

Query: 344 -QLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEE 402
            QL+D  +++K        +  ++ K + +   +    V N   E          +A+ +
Sbjct: 585 NQLQDAQNEIK--------QLKDQIKEQEKEKKNLQNEVNNLNKECDD------LDAKLQ 630

Query: 403 KQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVK 462
           ++ +EQ+   +  R   +    ++  ++K D+  + +  +    +              +
Sbjct: 631 QKIKEQQENSEIKRLNDELNKAQQQLKQKEDQLTKAQNELNKLKEQKQKEQKDQKDKDQQ 690

Query: 463 LPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPT 522
               E++++++  E  +  +      ++ E+ +++ Q++ D       T +K        
Sbjct: 691 RKDLEKQVKDLDAECDQLDQQRQAAVNEAEKLKQELQNLNDLKKQLKDTQSKLAQAEKQI 750

Query: 523 AKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEE-----NL 577
           A+  P      IQ K  QD +    A      + D A  +L +KEKE ++ ++     + 
Sbjct: 751 AQLDPEAVKNKIQ-KAEQDAKNAIQAQSQAKKDLDKANSQLKQKEKENKDLDDECNSLDA 809

Query: 578 RVAEIIQQSRMQSEDLQEKAWDS---YKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSY 634
           +V ++ +Q++ Q +D++EK        KE + L  D+IK    K  K        +D   
Sbjct: 810 QVQKLKEQAKQQEDDIKEKQKQIDQLQKENQQLKKDDIKGEIDKLRKFIQEQKPILDNLE 869

Query: 635 KGTQESDK 642
           K + +SDK
Sbjct: 870 KESTQSDK 877


>gi|308511103|ref|XP_003117734.1| hypothetical protein CRE_00333 [Caenorhabditis remanei]
 gi|308238380|gb|EFO82332.1| hypothetical protein CRE_00333 [Caenorhabditis remanei]
          Length = 3156

 Score = 41.2 bits (95), Expect = 1.2,   Method: Composition-based stats.
 Identities = 30/136 (22%), Positives = 60/136 (44%), Gaps = 11/136 (8%)

Query: 398  NAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVP 457
            + ++E    ++E  +   R + + E  +K D+E+ ++D + K   +  GDD       +P
Sbjct: 2061 SGEDEDVPNDEEINDILSRSEDEFELFQKMDQERLERDRKNKAKPRLCGDD------EIP 2114

Query: 458  THSVKLPPKEEELEEVKDEGKKGK---EPGTTETDDREETERKNQDILDNSLLAGKTHTK 514
               ++   + + +E+ K+EG+       PG+  T  R+E +     + D+  L       
Sbjct: 2115 RDILRAADETDYIEKAKEEGRVPYLEVMPGSRRT--RKEVDYSTDTMSDDRFLEKLFDGD 2172

Query: 515  NETPAIPTAKAPPAQA 530
            +  PA P A  P   A
Sbjct: 2173 DAAPAKPDAHKPDVAA 2188


>gi|258447713|ref|ZP_05695852.1| cell wall anchor domain-containing protein [Staphylococcus aureus
           A6224]
 gi|257858995|gb|EEV81859.1| cell wall anchor domain-containing protein [Staphylococcus aureus
           A6224]
          Length = 520

 Score = 41.2 bits (95), Expect = 1.2,   Method: Composition-based stats.
 Identities = 58/236 (24%), Positives = 89/236 (37%), Gaps = 39/236 (16%)

Query: 341 QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSE--------LKQAT 392
           + K+L D A   KAD         N+F  E + A+  I ++ N T E        LK   
Sbjct: 270 EAKKLND-AQAPKAD---------NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDP 319

Query: 393 VLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQE--KTPIKAEGDDFG 450
            +++    E K+  + +A ++ D +K  KE   K  +E  +K  +E  K P K +G+  G
Sbjct: 320 SVSKEILAEAKKLNDAQAPKEEDNKKPGKEDGNKPGKEDGNKPGKEDNKKPGKEDGNKPG 379

Query: 451 LGLPSVP-THSVKLPPKEEELEEVKDEGKK-GKE-----------------PGTTETDDR 491
               + P       P KE+  +  K++G K GKE                 PG T  D  
Sbjct: 380 KEDNNKPGKEDGNKPGKEDNNKPGKEDGNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDIA 439

Query: 492 EETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPL 547
           +        I  ++ LA K   K     +   K P   A        P+   E P 
Sbjct: 440 KANGTTADKIAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEENPF 495


>gi|113678140|ref|NP_001038323.1| chromodomain helicase DNA binding protein 4 [Danio rerio]
 gi|94732824|emb|CAK04973.1| novel protein similar to vertebrate chromodomain helicase DNA binding
            protein 4 (CHD4) [Danio rerio]
          Length = 1929

 Score = 41.2 bits (95), Expect = 1.2,   Method: Composition-based stats.
 Identities = 53/210 (25%), Positives = 84/210 (40%), Gaps = 44/210 (20%)

Query: 411  KEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEEL 470
            +  ++ EKAD + +EK +      D +EKT      DD         T   K    ++E 
Sbjct: 1599 ESSSEAEKADGKQEEKEEENAKSGDSEEKT------DD---------TDKPKGSEADKET 1643

Query: 471  EEVKDEGKKGKEP---GTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPP 527
             + K E KK  EP    TT   D ++ ++  +D       +GKT    + P   +AK   
Sbjct: 1644 SDAKGE-KKDDEPEKMDTTPVTDEKKGQKDEKD-------SGKTEEAGKLPNGESAKDSA 1695

Query: 528  AQAHKGIQDKKPQDQREKPLASDIGVGE------SDYAGIKLTKKEKEL-QEQEENLRVA 580
            A A  GI+++K    R     +D G  E      ++     +TKK  E+   + +   +A
Sbjct: 1696 AGA--GIEERKKAKTRFMFNIADGGFTELHSLWQNEERAATVTKKTNEIWHRRHDYWLLA 1753

Query: 581  EIIQQSRMQSEDLQEKAWDSYKEWKSLSPD 610
             IIQ   MQ           Y  W+ +  D
Sbjct: 1754 GIIQYLLMQH---------GYARWQDIQND 1774


>gi|9545989|gb|AAF88146.1|AF174134_1 Mud protein [Drosophila melanogaster]
          Length = 2501

 Score = 41.2 bits (95), Expect = 1.2,   Method: Composition-based stats.
 Identities = 37/143 (25%), Positives = 70/143 (48%), Gaps = 18/143 (12%)

Query: 865  SLKNQAHLNAEVERLSGLAQQPSDS-----TADLKEL---------QTQLSRAKKYKESN 910
            + + Q  L+ +++    LAQQ  D+       + KEL         QT+LS   + ++ +
Sbjct: 1329 AFEAQTKLSDDLQLEKDLAQQLVDTLKVELDKERKELAQVNSPFEAQTKLSDDLQRQKES 1388

Query: 911  DERIVSFIRSEFEREIKEL---KSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKE 967
             +++V  ++ E ++E KEL   KSVIEA  K + +  + ++  Q+  + L  +L    KE
Sbjct: 1389 AQQLVDNLKVELDKERKELAQVKSVIEAQTKLSDDLQRQKESAQQLVDNLEMELDKERKE 1448

Query: 968  L-NIDNAYGLWNEYKEDFKASFE 989
            L  + +A G   +  +D +   E
Sbjct: 1449 LAQVKSAIGAQTKLSDDLECQKE 1471



 Score = 40.1 bits (92), Expect = 2.5,   Method: Composition-based stats.
 Identities = 36/139 (25%), Positives = 68/139 (48%), Gaps = 18/139 (12%)

Query: 869  QAHLNAEVERLSGLAQQPSDS-----TADLKEL---------QTQLSRAKKYKESNDERI 914
            Q  L+ +++R     QQ  D+       + KEL         QT+LS   + ++ + +++
Sbjct: 1165 QTKLSDDLQRQKESGQQLVDNLKVELEKERKELAHVNSAIGAQTKLSDDLECQKESGQQL 1224

Query: 915  VSFIRSEFEREIKEL---KSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-NI 970
            V  ++ E E+E KEL   KSVIEA  K + +  + ++  Q+  + L  +L    KEL  +
Sbjct: 1225 VDNLKVELEKERKELAQVKSVIEAQTKLSDDLQREKESAQQLVDNLKVELDKERKELAQV 1284

Query: 971  DNAYGLWNEYKEDFKASFE 989
            ++A+    +  +D +   E
Sbjct: 1285 NSAFEAQTKLSDDLQRQKE 1303


>gi|311255169|ref|XP_003126114.1| PREDICTED: LOW QUALITY PROTEIN: myosin-9 [Sus scrofa]
          Length = 1967

 Score = 41.2 bits (95), Expect = 1.2,   Method: Composition-based stats.
 Identities = 58/249 (23%), Positives = 106/249 (42%), Gaps = 46/249 (18%)

Query: 398  NAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGD--DFGLGLPS 455
            N  EE+++ +  AK K   E    + +E+  RE+  +   EKTP K EGD  D    +P 
Sbjct: 1007 NLMEEEEKSKSLAKLKNKHEAMITDLEERLRREEKQRQELEKTPRKLEGDSTDLSDQIPE 1066

Query: 456  VPTH----SVKLPPKEEEL---------------------EEVKDEGKKGKEPGTTETDD 490
            +        ++LP KEEEL                      E++ +  + +E   +E   
Sbjct: 1067 LQAQXAELKMQLPKKEEELLAALARVEEEAAQKNMALKKIRELESQISELQEDLESERAA 1126

Query: 491  REETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQR--EKPLA 548
            R + E++ +D L   L A KT  ++   +          A + ++ K+ Q+    +K L 
Sbjct: 1127 RNKAEKQKRD-LGEELEALKTELEDTLDS--------TAAQQELRSKREQEVNILKKTLE 1177

Query: 549  SDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLS 608
             +    E+    +    ++K  Q  EE   +AE ++Q++    +L EKA  + +  +   
Sbjct: 1178 EEAKTHEAQIQEM----RQKHSQAVEE---LAEQLEQTKRVKANL-EKAKQTLENERGEL 1229

Query: 609  PDEIKQRFQ 617
             +E+K   Q
Sbjct: 1230 ANEVKVLLQ 1238


>gi|241952833|ref|XP_002419138.1| DNA repair protein Rad50 homologue, putative [Candida dubliniensis
           CD36]
 gi|223642478|emb|CAX42727.1| DNA repair protein Rad50 homologue, putative [Candida dubliniensis
           CD36]
          Length = 1307

 Score = 41.2 bits (95), Expect = 1.2,   Method: Composition-based stats.
 Identities = 94/450 (20%), Positives = 178/450 (39%), Gaps = 66/450 (14%)

Query: 101 LKRLAETG---EVILSDKSDRLLCRFMDMVETEDEHKINK---QVRDA-LESAGFDLEST 153
           L+R  E G   EV L +K + L      + E +D +++ K   ++ +   E + F+ E  
Sbjct: 460 LRRKVEVGSNNEVELEEKRNDLDLTMKLLQEKKDLNEVRKLDAKISECNTEISKFEFE-L 518

Query: 154 QENIRKVESALINNNMKDAFRFLELAQKSKETADSHIIEAID------VGTKLKENTPPT 207
            E  +K+ ++   ++++    FLE + KSK+   S I   ID      +G+KL  +   +
Sbjct: 519 DELAKKLSTSNKQSDLRSKVLFLEESAKSKKAELSKIFANIDNNYFEVLGSKLDVDVGES 578

Query: 208 TFTS-ISKVLLKSNNMQDVVFTKIKEVVKKHVNAELGHRKLRGLAFDHTYFNDKLNQFLK 266
             +  IS + +KS   Q  V T         + +EL   K            + ++  LK
Sbjct: 579 LLSQKISNLEIKSEEQQKKVVT---------LESELQINK------------NSIDSILK 617

Query: 267 EIKNHQKEYDESEKGSSKARYHAA---YAHIYWDLANDWVNGRVGDKSDEWARTSTNIAS 323
            I+ +  + D  +   +K         Y ++  DL + + N      S E  R   N A 
Sbjct: 618 TIEENNSKIDSLKVSITKVISEDEINDYENVVNDLEDSYRNVSEDVNSAEVTRDFKNSAI 677

Query: 324 WIG----------RITRTEGLGGVTYD--------QIKQLRDLASKVKADYHWAEIRHGN 365
                        R+    GLG    D        +I+++R+ + ++K      E+    
Sbjct: 678 SFAEENKCCLLCKRLFEQGGLGAFIQDLKQSVDEHKIQEIREQSLEIKK-----ELEDVK 732

Query: 366 RFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKE 425
               E       +ANV N+   LK+   L   + Q EK+  +Q   ++A +   D  +  
Sbjct: 733 SINLEVVNYRECLANVQNYECTLKE---LVDKSNQIEKELEQQRKDQQAIKHSIDNASSL 789

Query: 426 KADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGT 485
           K     A +   E + I+ + D+    L       V +   + + +E+  + KK ++   
Sbjct: 790 KKPLSDATRINLEVSDIEFQLDELNEDLRGFGGSVVSVDELQRQQQEINMKIKKTRQNLN 849

Query: 486 TETDDREETERKNQDILDNSLLAGKTHTKN 515
             T+ + + +R+ Q  L+N +   K    N
Sbjct: 850 DYTESKYKAQRELQK-LENRVKDTKLQISN 878


>gi|148266538|ref|YP_001245481.1| cell wall anchor domain-containing protein [Staphylococcus aureus
           subsp. aureus JH9]
 gi|150392576|ref|YP_001315251.1| cell wall anchor domain-containing protein [Staphylococcus aureus
           subsp. aureus JH1]
 gi|257794461|ref|ZP_05643440.1| cell wall anchor protein [Staphylococcus aureus A9781]
 gi|258407579|ref|ZP_05680715.1| cell wall anchor protein [Staphylococcus aureus A9763]
 gi|258419852|ref|ZP_05682814.1| cell wall anchor domain-containing protein [Staphylococcus aureus
           A9719]
 gi|258445109|ref|ZP_05693346.1| immunoglobulin G binding protein A precursor [Staphylococcus aureus
           A6300]
 gi|258455663|ref|ZP_05703618.1| cell wall anchor domain-containing protein [Staphylococcus aureus
           A5937]
 gi|282928363|ref|ZP_06335966.1| immunoglobulin G-binding protein A [Staphylococcus aureus A10102]
 gi|147739607|gb|ABQ47905.1| LPXTG-motif cell wall anchor domain [Staphylococcus aureus subsp.
           aureus JH9]
 gi|149945028|gb|ABR50964.1| LPXTG-motif cell wall anchor domain [Staphylococcus aureus subsp.
           aureus JH1]
 gi|257788433|gb|EEV26773.1| cell wall anchor protein [Staphylococcus aureus A9781]
 gi|257840804|gb|EEV65261.1| cell wall anchor protein [Staphylococcus aureus A9763]
 gi|257844134|gb|EEV68521.1| cell wall anchor domain-containing protein [Staphylococcus aureus
           A9719]
 gi|257856017|gb|EEV78936.1| immunoglobulin G binding protein A precursor [Staphylococcus aureus
           A6300]
 gi|257861875|gb|EEV84648.1| cell wall anchor domain-containing protein [Staphylococcus aureus
           A5937]
 gi|282589947|gb|EFB95030.1| immunoglobulin G-binding protein A [Staphylococcus aureus A10102]
          Length = 520

 Score = 41.2 bits (95), Expect = 1.2,   Method: Composition-based stats.
 Identities = 58/236 (24%), Positives = 89/236 (37%), Gaps = 39/236 (16%)

Query: 341 QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSE--------LKQAT 392
           + K+L D A   KAD         N+F  E + A+  I ++ N T E        LK   
Sbjct: 270 EAKKLND-AQAPKAD---------NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDP 319

Query: 393 VLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQE--KTPIKAEGDDFG 450
            +++    E K+  + +A ++ D +K  KE   K  +E  +K  +E  K P K +G+  G
Sbjct: 320 SVSKEILAEAKKLNDAQAPKEEDNKKPGKEDGNKPGKEDGNKPGKEDNKKPGKEDGNKPG 379

Query: 451 LGLPSVP-THSVKLPPKEEELEEVKDEGKK-GKE-----------------PGTTETDDR 491
               + P       P KE+  +  K++G K GKE                 PG T  D  
Sbjct: 380 KEDNNKPGKEDGNKPGKEDNNKPGKEDGNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDIA 439

Query: 492 EETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPL 547
           +        I  ++ LA K   K     +   K P   A        P+   E P 
Sbjct: 440 KANGTTADKIAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEENPF 495


>gi|83682339|emb|CAJ28159.1| immunoglobulin G binding protein A precursor [Staphylococcus
           aureus]
 gi|83682341|emb|CAJ28160.1| immunoglobulin G binding protein A precursor [Staphylococcus
           aureus]
 gi|83682343|emb|CAJ28161.1| immunoglobulin G binding protein A precursor [Staphylococcus
           aureus]
          Length = 451

 Score = 41.2 bits (95), Expect = 1.2,   Method: Composition-based stats.
 Identities = 51/204 (25%), Positives = 80/204 (39%), Gaps = 21/204 (10%)

Query: 365 NRFKAETRLAYSTIANVANFTSE--------LKQATVLARANAQEEKQRREQEAKEKADR 416
           N+F  E + A+  I ++ N T E        LK    +++    E K+  + +A ++ D 
Sbjct: 245 NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDG 304

Query: 417 EKADKEAKEKADREKADKDLQE--KTPIKAEGDDFGLGLPSVP-THSVKLPPKEEELEEV 473
            K  KE  +K  +E  +K  +E  K P K + +  G    + P     K P KE+  +  
Sbjct: 305 NKPGKEDNKKPGKEDGNKPGKEDNKKPGKEDNNKPGKEDGNKPGKEDNKKPGKEDGNKPG 364

Query: 474 KDEGKK-GKE---------PGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTA 523
           K++ KK GKE         PG T  D  +        I  ++ LA K   K     +   
Sbjct: 365 KEDNKKPGKEDGNGVHVVKPGDTVNDIAKANGTTADKIASDNKLADKNMIKPGQELVVDK 424

Query: 524 KAPPAQAHKGIQDKKPQDQREKPL 547
           K P   A        P+   E P 
Sbjct: 425 KQPANHADANKAQALPETGEENPF 448


>gi|83682385|emb|CAJ28182.1| immunoglobulin G binding protein A precursor [Staphylococcus
           aureus]
 gi|83682408|emb|CAJ28194.1| immunoglobulin G binding protein A precursor [Staphylococcus
           aureus]
          Length = 435

 Score = 41.2 bits (95), Expect = 1.2,   Method: Composition-based stats.
 Identities = 47/195 (24%), Positives = 74/195 (37%), Gaps = 19/195 (9%)

Query: 365 NRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAK 424
           N+F  E + A+  I ++ N T E +   + +  +     +    EAK+  D +   +E  
Sbjct: 245 NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDN 304

Query: 425 EKADREKADKDLQE--KTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKK-GK 481
            K  +E  +K  +E  K P K +G+  G           K P KE+  +  K++ KK GK
Sbjct: 305 NKPGKEDGNKPGKEDNKKPGKEDGNKPG-------KEDNKKPGKEDGNKPGKEDNKKPGK 357

Query: 482 E---------PGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHK 532
           E         PG T  D  +        I  ++ LA K   K     +   K P   A  
Sbjct: 358 EDGNGVHVVKPGDTVNDIAKANGTTADKIASDNKLADKNMIKPGQELVVDKKQPANHADA 417

Query: 533 GIQDKKPQDQREKPL 547
                 P+   E P 
Sbjct: 418 NKAQALPETGEENPF 432


>gi|300911388|ref|ZP_07128837.1| immunoglobulin G binding protein A [Staphylococcus aureus subsp.
           aureus TCH70]
 gi|300887567|gb|EFK82763.1| immunoglobulin G binding protein A [Staphylococcus aureus subsp.
           aureus TCH70]
          Length = 504

 Score = 41.2 bits (95), Expect = 1.2,   Method: Composition-based stats.
 Identities = 57/227 (25%), Positives = 84/227 (37%), Gaps = 37/227 (16%)

Query: 341 QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSE--------LKQAT 392
           + K+L D A   KAD         N+F  E + A+  I ++ N T E        LK   
Sbjct: 270 EAKKLND-AQAPKAD---------NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDP 319

Query: 393 VLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKT--PIKAEGDDFG 450
            +++    E K+  + +A ++ D  K  KE   K  +E  +K  +E    P K +G+  G
Sbjct: 320 SVSKEILAEAKKLNDAQAPKEEDNNKPGKEDGNKPGKEDGNKPGKEDNNKPGKEDGNKPG 379

Query: 451 LGLPSVPTHSVKLPPKEEELEEVK-DEGKKGKE---------PGTTETDDREETERKNQD 500
                      K P KE+  +  K D  K GKE         PG T  D  +        
Sbjct: 380 -------KEDNKKPGKEDGNKPGKEDNNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADK 432

Query: 501 ILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPL 547
           I  ++ LA K   K     +   K P   A        P+   E P 
Sbjct: 433 IAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEENPF 479


>gi|118088833|ref|XP_419850.2| PREDICTED: hypothetical protein [Gallus gallus]
          Length = 348

 Score = 41.2 bits (95), Expect = 1.2,   Method: Composition-based stats.
 Identities = 63/259 (24%), Positives = 108/259 (41%), Gaps = 42/259 (16%)

Query: 400 QEEKQRREQEAKEKADREKADKEAKEKADREKA-DKDLQEKTPIKAEGDDFGLGLPSVPT 458
           QEE++R+E E +E+ ++ KA+  ++ +  +E A DK L E                S   
Sbjct: 57  QEERERKEAEIQERIEKMKAELWSQAEQYKEDAVDKALTEAAANY-----------SAFV 105

Query: 459 HSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETP 518
             +KL  ++E  E V+    + KE    E + R E E   Q +      A     K +  
Sbjct: 106 QDLKLKLEKEIREAVRKAKAEMKE--YMEEEQRREIEATEQRMAHKLRCALLECAKEKMQ 163

Query: 519 AIPTAKAPP---AQAHKGIQDKKPQDQ--REKPLASD--------IGVGESDYAGIKLTK 565
           A+  A+      A +   +Q +K  +Q   E  LA +        +  G+ +   I L+ 
Sbjct: 164 AVAKARKQEREVALSEAAVQHRKHIEQLKEESMLAEELYRKTIEQLNRGKCNEMNIALSI 223

Query: 566 KEKELQ-EQEENLRVAEIIQQSRMQ--------SED---LQEKAWDSYKEWKSLSPDEI- 612
           K+KE + E E+ ++  E I    ++        +ED     E+  +  + WK     EI 
Sbjct: 224 KQKENEIEMEKQMKELETIHLDELEKVMITLKTAEDQVKALEQKLEKMRAWKDSLETEIQ 283

Query: 613 --KQRFQKYAKVFYRSYSP 629
             +Q FQKY    + + SP
Sbjct: 284 ATRQAFQKYIDATFPNLSP 302


>gi|189501444|ref|YP_001960914.1| SMC domain-containing protein [Chlorobium phaeobacteroides BS1]
 gi|189496885|gb|ACE05433.1| SMC domain protein [Chlorobium phaeobacteroides BS1]
          Length = 1085

 Score = 41.2 bits (95), Expect = 1.2,   Method: Composition-based stats.
 Identities = 54/230 (23%), Positives = 95/230 (41%), Gaps = 54/230 (23%)

Query: 2   NELATSIDYQTNNLDQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYIV 61
           +EL  ++  +   L   +IP  +V   L S++  +K        W   +    +      
Sbjct: 630 DELKLAVSGKLEPLGIKEIPESEVEALLESLKSRLKE-------WQEQVQQKTE------ 676

Query: 62  GPIEQRLKKVSERYERVVSRDLTLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLLC 121
             IE+++  +    +R     L  VI+  +K L E  + L+RL +     L+D +D    
Sbjct: 677 --IEKQIAAIDSEVQR-----LDAVIDTQVKALTEKQENLERLKKE----LADGTDERKQ 725

Query: 122 RFMDMVETEDEHKINKQVRDA-----------------LESAGFDLESTQENIR------ 158
            + D    ++E ++NK + DA                 L +A   ++S ++ I       
Sbjct: 726 LYGDKKPDDEEGRLNKAIADAEEVEKKARILNTESQQKLTTAKTHVDSLKKRIEQRATEL 785

Query: 159 -KVES----ALINNNMKDAFRFLE--LAQKSKETADSHIIEAIDVGTKLK 201
            K E+    ALI     D   FLE  L+Q+++E+  S   E  D GT+LK
Sbjct: 786 NKAETDFSVALIPAGFADEKSFLEARLSQEARESLSSRAKELDDAGTELK 835


>gi|315122422|ref|YP_004062911.1| hypothetical protein CKC_03370 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495824|gb|ADR52423.1| hypothetical protein CKC_03370 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 120

 Score = 41.2 bits (95), Expect = 1.2,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 40/81 (49%)

Query: 707 MSKAVEAGESSVRKHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKEDPKRGKSESYLS 766
           M K VE  +   + H+ ++     ++  I +NNF+ E      +L K+D  R + E+  +
Sbjct: 1   MIKKVEKSDGIKKDHAVDLAVRAQREKAIGLNNFLAEARVLVNKLPKDDSVRSQCETRNN 60

Query: 767 DIRSELQKVNKTVMDIRIKLR 787
            +RSEL  +N  V     +LR
Sbjct: 61  LVRSELGVINNKVRQYDNELR 81


>gi|195035357|ref|XP_001989144.1| GH10207 [Drosophila grimshawi]
 gi|193905144|gb|EDW04011.1| GH10207 [Drosophila grimshawi]
          Length = 1348

 Score = 41.2 bits (95), Expect = 1.2,   Method: Composition-based stats.
 Identities = 62/287 (21%), Positives = 115/287 (40%), Gaps = 47/287 (16%)

Query: 24   DVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYIVGPIEQRLKKVSERYERVVS--R 81
            D   T  S+ D +K +++      SD           V P+E RLKKV+ + E++ S  R
Sbjct: 878  DRQATEQSVDDKLKEIQDQFEVLRSD----------TVKPVEARLKKVTTQIEKLSSHVR 927

Query: 82   DLTLVI---EAGLKDLKEVGDTLKRLAETGEVIL-SDKSDRLLCRFMDMVETEDEHKINK 137
             L + +   E  ++ LK     L+   +T E  L +   +R  C+       E ++++ K
Sbjct: 928  SLNVALSTAERNIERLKNNNANLQENIKTAEDKLRALNEERQQCQ-------ERKNELEK 980

Query: 138  QVRDALESAG------------FDLESTQENIRKVESALINNNMKDAFRFLELAQKSKET 185
            Q  +A E+ G             D  + QEN R ++   +  N       L+    S + 
Sbjct: 981  QASEAEEAIGTAKSQSSDVKKEIDALNKQENDRNIKRLELETN-------LQAVASSVDK 1033

Query: 186  ADSHIIEAIDVGTKLKENTPPTTFTSISKVLLKSNNMQDVVFTKIKEVVKKHVNAELGHR 245
             ++ I    +    LK N  P      S   LK++  +++    + E+  K  + E   +
Sbjct: 1034 VNAEIPYWKEQLKPLKLNVIPGDTEQESAAPLKTHTPEELEALNLAEIQYKQTSLEEQLK 1093

Query: 246  KLRGLAFDHTYFNDKL-----NQFLKEIKNHQKEYDESEKGSSKARY 287
                L +   +   +L      +FL++I + + E  +  +   K RY
Sbjct: 1094 TKPNLGYIQEFMEKQLVYMDRVRFLEDISSKRNEMRDKYEEVRKRRY 1140


>gi|189237841|ref|XP_974666.2| PREDICTED: similar to rho-associated protein kinase 1 [Tribolium
            castaneum]
          Length = 2513

 Score = 41.2 bits (95), Expect = 1.2,   Method: Composition-based stats.
 Identities = 30/100 (30%), Positives = 50/100 (50%), Gaps = 5/100 (5%)

Query: 868  NQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIK 927
            N    NA+V +L  L  Q  ++  +LKE Q +L         N+    S IR E  +  K
Sbjct: 1572 NDKDANAQVTKLQQLLDQERNTVEELKEKQRKLIAQISSLAQNE----SAIREESSKYEK 1627

Query: 928  ELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKE 967
            EL ++++ + KE     +N+ +L+K  EK +A +   L+E
Sbjct: 1628 EL-TILKHNYKELQRKAENENELRKKTEKYLADIKRTLEE 1666


>gi|325115434|emb|CBZ50989.1| conserved hypothetical protein [Neospora caninum Liverpool]
          Length = 2242

 Score = 41.2 bits (95), Expect = 1.3,   Method: Composition-based stats.
 Identities = 63/274 (22%), Positives = 116/274 (42%), Gaps = 52/274 (18%)

Query: 338  TYDQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANV-ANFTSELKQATVLAR 396
            T +    L  LA K + D    E     R +AE   A + IA++ A+     ++   L +
Sbjct: 1394 TVEPAGTLEALAEKAREDQTALE-----RLEAECLSARTAIASLKADLARTTEEKDALRK 1448

Query: 397  ANAQEEKQR-REQEAKEKADREKADKEAKEK------------ADREKADKDLQEKTPIK 443
             + ++E++R R+++A E+  RE  D   KE+            A+R K  ++ + K   K
Sbjct: 1449 ESEKKEEERVRKEQALEQRKRELEDAFEKERAALEERLRRGVEAERAKRRQETEGKAQEK 1508

Query: 444  AEGDDFGLGLPSVPTHSVKLP------PKEEELEE-VKDEGKKGKEPGTTETDDREETER 496
             E  D       +  H+  L        ++ ELEE ++ +  K KE         EE   
Sbjct: 1509 REAHDDSAEKEKLRQHAQTLAAAYGALARKVELEEALRGQAMKKKE---------EEM-- 1557

Query: 497  KNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQ-----DKKPQDQREKPLASDI 551
              +++LD        H K +   +   +   AQ H  +Q      +K +D+R++ L +  
Sbjct: 1558 --RNLLD--------HLKQQEARLRQREEENAQLHAQLQALRTHAQKSEDERQRNLDTPP 1607

Query: 552  GVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQ 585
               E++    +L    +EL  Q++ +R+ E  Q+
Sbjct: 1608 QARETEALRRQLQDATQELTRQQQKIRLLEDQQR 1641


>gi|73965993|ref|XP_862933.1| PREDICTED: similar to SWI/SNF-related matrix-associated
           actin-dependent regulator of chromatin e1 isoform 5
           [Canis familiaris]
          Length = 337

 Score = 41.2 bits (95), Expect = 1.3,   Method: Composition-based stats.
 Identities = 45/209 (21%), Positives = 87/209 (41%), Gaps = 31/209 (14%)

Query: 341 QIKQLRDLASKVKADYHWAEIRH---GNRFKAETRLAYSTIANVANFTSELKQATVLARA 397
           Q++ L     K++A+    E RH     +F   T    + +  +     E+    + A  
Sbjct: 156 QVQSLMVHQRKLEAELLQIEERHQEKKRKFLESTDSFNNELKRLCGLKVEVDMEKIAAEI 215

Query: 398 NAQEEKQRREQEAKEKADREKADK-EAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSV 456
              EE+ R+ QE +EK   E+A++ ++    + E A    QEK       DD        
Sbjct: 216 AQAEEQARKRQEEREKEAAEQAERSQSSMVPEEEPAASKTQEKK------DD-------- 261

Query: 457 PTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNE 516
              S+ +  +E  LEE  +  + G+E GT+  +D+E  +     + +       T +++ 
Sbjct: 262 --ESIPMETEETHLEEATESQQNGEE-GTSTPEDKESGQEGVDSMAEEGTSDSNTGSESN 318

Query: 517 TPAIPTAKAPPAQAHKGIQDKKPQDQREK 545
           +    T + PP        D  P+D++++
Sbjct: 319 S---ATVEEPPT-------DPTPEDEKKE 337


>gi|269961980|ref|ZP_06176335.1| translation initiation factor IF-2 [Vibrio harveyi 1DA3]
 gi|269833303|gb|EEZ87407.1| translation initiation factor IF-2 [Vibrio harveyi 1DA3]
          Length = 894

 Score = 41.2 bits (95), Expect = 1.3,   Method: Composition-based stats.
 Identities = 30/70 (42%), Positives = 38/70 (54%), Gaps = 12/70 (17%)

Query: 389 KQATVLARANAQEEKQRREQEAKEKADRE-KADKEAKEKADR---EKADKDLQEK----- 439
           ++A   A+  A E+ QR   EA EKA RE  A +EA+EKA R   EKA KD+  K     
Sbjct: 125 REAEEQAKREAAEKAQR---EADEKAKREADAKREAEEKAKRAQAEKAKKDMNAKNADAN 181

Query: 440 TPIKAEGDDF 449
           T  K E D+ 
Sbjct: 182 TQAKKEADEL 191


>gi|258424225|ref|ZP_05687106.1| immunoglobulin G binding protein A [Staphylococcus aureus A9635]
 gi|257845491|gb|EEV69524.1| immunoglobulin G binding protein A [Staphylococcus aureus A9635]
          Length = 520

 Score = 41.2 bits (95), Expect = 1.3,   Method: Composition-based stats.
 Identities = 57/228 (25%), Positives = 88/228 (38%), Gaps = 31/228 (13%)

Query: 341 QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSE--------LKQAT 392
           + K+L D A   KAD         N+F  E + A+  I ++ N T E        LK   
Sbjct: 278 EAKKLND-AQAPKAD---------NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDP 327

Query: 393 VLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKT--PIKAEGDDFG 450
            +++    E K+  + +A ++ D  K  KE  +K  +E  +K  +E    P K + +  G
Sbjct: 328 SVSKEILAEAKKLNDAQAPKEEDGNKPGKEDNKKPGKEDGNKPGKEDNNKPGKEDNNKPG 387

Query: 451 LGLPSVP-THSVKLPPKEEELEEVKDEGKK-GKE---------PGTTETDDREETERKNQ 499
               + P     K P KE+  +  K++ KK GKE         PG T  D  +       
Sbjct: 388 KEDGNKPGKEDNKKPGKEDGNKPGKEDNKKPGKEDGNGVHVVKPGDTVNDIAKANGTTAD 447

Query: 500 DILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPL 547
            I  ++ LA K   K     +   K P   A        P+   E P 
Sbjct: 448 KIASDNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEENPF 495


>gi|221503729|gb|EEE29413.1| trichohyalin, putative [Toxoplasma gondii VEG]
          Length = 2088

 Score = 41.2 bits (95), Expect = 1.3,   Method: Composition-based stats.
 Identities = 49/224 (21%), Positives = 98/224 (43%), Gaps = 26/224 (11%)

Query: 400 QEEKQRREQEAKE----KADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPS 455
           +EE+++ EQE +E    +A+ EK  +EA EKA +E+  K  +E+   K    +   G   
Sbjct: 495 EEERKKMEQEREEWQKHRAEEEKGKQEAIEKAVKEERKKLEEERNEWKMHRAEMEKG--- 551

Query: 456 VPTHSVKLPPKEEELEEVKDEGKKGKEPGTTE-TDDREETERKNQDILDNSLLAGKTHTK 514
                     K+E +E+  +E +K  E    E    R E E+  Q+ ++ ++   +   +
Sbjct: 552 ----------KQEAIEKAVEEERKKMEQEREEWQKHRAEEEKGKQEAIEKAVKEERKKME 601

Query: 515 NETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQE 574
            E            Q H+  ++K  Q+  EK +  +    E +    +  + E+E  +QE
Sbjct: 602 QEREE--------WQKHRAEEEKGKQEAIEKAVEEERKKMEQEREEWQKHRAEEEKGKQE 653

Query: 575 ENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQK 618
              +  E  ++   Q  +  +K  +  ++      +E+KQ+ Q+
Sbjct: 654 AIEKAVEEERKKMEQEREQWQKRQEEREKENEQDGEEMKQKLQR 697


>gi|302664143|ref|XP_003023706.1| hypothetical protein TRV_02139 [Trichophyton verrucosum HKI 0517]
 gi|291187715|gb|EFE43088.1| hypothetical protein TRV_02139 [Trichophyton verrucosum HKI 0517]
          Length = 2521

 Score = 41.2 bits (95), Expect = 1.3,   Method: Composition-based stats.
 Identities = 55/215 (25%), Positives = 92/215 (42%), Gaps = 44/215 (20%)

Query: 397  ANAQEEKQRREQEAK--EKAD-------REKADKEAKEKADREKADKDLQEKTP-IKAEG 446
            AN +++K     E+K  EKA+       + K D  AK++AD      +  E+ P  + EG
Sbjct: 1795 ANDKDQKDTENNESKGDEKAEDMSAATEQRKEDDPAKKEADEGHETTESDEEAPEDEKEG 1854

Query: 447  ---DDFGLGLPSVPTHSVKLPPKEEELE-EVKDEGKKGKEPGTTETDDREETERKNQDIL 502
               +D  +  P    + V   P++ +L+ E K++     + G +E    EET   NQD L
Sbjct: 1855 AGREDMDVTDPYAQENDVLDLPEDMDLDGEKKEDESSDADDGMSEIS-MEET--ANQDDL 1911

Query: 503  DNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIK 562
                   K  TK E+P +  A+ P   A     D+  Q + E         GE D     
Sbjct: 1912 PEHTNEEKKDTKPESPDVDMAENPDDNA-----DEDGQREEE--------TGEPD----- 1953

Query: 563  LTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKA 597
             ++ + +  E+E+  ++  +        ED Q+KA
Sbjct: 1954 -SEPQPDAGEEEDKEKIIPV--------EDEQQKA 1979


>gi|295405382|ref|ZP_06815192.1| immunoglobulin G-binding protein A [Staphylococcus aureus A8819]
 gi|297244718|ref|ZP_06928598.1| immunoglobulin G-binding protein A [Staphylococcus aureus A8796]
 gi|294969457|gb|EFG45476.1| immunoglobulin G-binding protein A [Staphylococcus aureus A8819]
 gi|297178235|gb|EFH37482.1| immunoglobulin G-binding protein A [Staphylococcus aureus A8796]
          Length = 519

 Score = 41.2 bits (95), Expect = 1.3,   Method: Composition-based stats.
 Identities = 58/236 (24%), Positives = 89/236 (37%), Gaps = 39/236 (16%)

Query: 341 QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSE--------LKQAT 392
           + K+L D A   KAD         N+F  E + A+  I ++ N T E        LK   
Sbjct: 269 EAKKLND-AQAPKAD---------NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDP 318

Query: 393 VLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQE--KTPIKAEGDDFG 450
            +++    E K+  + +A ++ D +K  KE   K  +E  +K  +E  K P K +G+  G
Sbjct: 319 SVSKEILAEAKKLNDAQAPKEEDNKKPGKEDGNKPGKEDGNKPGKEDNKKPGKEDGNKPG 378

Query: 451 LGLPSVP-THSVKLPPKEEELEEVKDEGKK-GKE-----------------PGTTETDDR 491
               + P       P KE+  +  K++G K GKE                 PG T  D  
Sbjct: 379 KEDNNKPGKEDGNKPGKEDNNKPGKEDGNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDIA 438

Query: 492 EETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPL 547
           +        I  ++ LA K   K     +   K P   A        P+   E P 
Sbjct: 439 KANGTTADKIAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEENPF 494


>gi|87119791|ref|ZP_01075688.1| translation initiation factor IF-2 [Marinomonas sp. MED121]
 gi|86165267|gb|EAQ66535.1| translation initiation factor IF-2 [Marinomonas sp. MED121]
          Length = 852

 Score = 41.2 bits (95), Expect = 1.3,   Method: Composition-based stats.
 Identities = 46/178 (25%), Positives = 77/178 (43%), Gaps = 20/178 (11%)

Query: 389 KQATVLARANAQEE-KQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGD 447
           +QA   A+  A+E+ K   E++A+++A+R+ A+++A  +   +KA +D+Q      +EG 
Sbjct: 115 RQAEEQAKLVAEEKAKLAAEEQARQEAERKLAEEKAAAELAEQKAKQDVQPAEKSSSEGK 174

Query: 448 DFGLGLPSV--PTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDR------EETERKNQ 499
           +  +G      P    K  PK+        E  KGK+    + D +       + +R N+
Sbjct: 175 NSNVGAKESLEPVKQAKPAPKKNHHMTADKEPSKGKKAAPQKQDGKPKNRFGADKKRGNK 234

Query: 500 DILDNSLLA--GKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGE 555
           +I+ +       K   KN        KA P Q H G Q        E  L   I V E
Sbjct: 235 NIMGDDEFGRRNKLGKKNR-------KAAP-QEH-GFQKPTAPIVHEVALPESITVAE 283


>gi|322374903|ref|ZP_08049417.1| hyalurononglucosaminidase [Streptococcus sp. C300]
 gi|321280403|gb|EFX57442.1| hyalurononglucosaminidase [Streptococcus sp. C300]
          Length = 2618

 Score = 40.9 bits (94), Expect = 1.3,   Method: Composition-based stats.
 Identities = 44/157 (28%), Positives = 66/157 (42%), Gaps = 4/157 (2%)

Query: 355 DYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKA 414
           D H+ E R     +     A S +   + F + + QA   A A ++ E      EA +K 
Sbjct: 2   DRHFFEKRCHYSIRKFAIGAASVMIGASIFGANMVQAAETA-APSETEGSITHVEALDKL 60

Query: 415 DREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVK 474
             + AD  A +KAD E A +   E+TP   EG +      + P  S    PK  E  +  
Sbjct: 61  PDDLAD--ALKKADAEAATEASHEETPATDEGTNPAASEEAKPEAS-PASPKPAETPKPV 117

Query: 475 DEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKT 511
           +  K  K+P  T T   +  E+  +D  D + L G T
Sbjct: 118 ETPKADKQPAETTTPAVKPAEKTIEDREDVNHLEGAT 154


>gi|313227085|emb|CBY22232.1| unnamed protein product [Oikopleura dioica]
          Length = 834

 Score = 40.9 bits (94), Expect = 1.3,   Method: Composition-based stats.
 Identities = 67/323 (20%), Positives = 122/323 (37%), Gaps = 64/323 (19%)

Query: 294 IYWDLANDWVNGRVGDKSDEWARTSTNIASWIGRITR-----TEGLGGVTYDQIKQLRDL 348
           ++W  AND +   V +    W+RT   +     RI        +     T  +I +L++ 
Sbjct: 307 LWWLQANDAIKASVYEDPQSWSRT--KLKECYRRIRMEVDPPADSTWAATMAEIMRLQET 364

Query: 349 ASKVKADYHWAEIRHGNRFK--AETRLAYSTI---ANVANFTSELKQATVLARANAQEEK 403
              ++           NR++   E R+A S +   ++VA  T  L  A    R   +E K
Sbjct: 365 VELLR-------FIENNRYRLPGEMRMARSNLHRQSDVATLTQTLDNAK---RGTERERK 414

Query: 404 QRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKL 463
           QR    A+E+ADR+    + +E+    + D+ L++         D+        +HS + 
Sbjct: 415 QR----AQEEADRQAHLDQLREERVARRRDELLRQ---------DWARD----RSHSPRR 457

Query: 464 PPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKN--ETPAIP 521
            P ++      DE ++G+ P      +   T       L  S     ++  +  E PA  
Sbjct: 458 SPSQKRSSTSSDEDRRGENPAKRWPVNPSRTRESGWPSLPASSKPASSNMPSSWERPAPS 517

Query: 522 TAKAPPAQAHKGI---QDKKPQDQREKPLASDIGVGES---------------DYAGIKL 563
               PP+   +       +KP+     P   DI                    D A  K 
Sbjct: 518 ARPVPPSWGKESTVASSVRKPE-----PRGWDIPSSSRRSERSSESANEDRPMDAATAKY 572

Query: 564 TKKEKELQEQEENLRVAEIIQQS 586
            +++   + ++E+LR AE+ Q +
Sbjct: 573 ERRKANKKARKESLREAELDQTA 595


>gi|167525328|ref|XP_001746999.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163774779|gb|EDQ88406.1| predicted protein [Monosiga brevicollis MX1]
          Length = 1146

 Score = 40.9 bits (94), Expect = 1.3,   Method: Composition-based stats.
 Identities = 31/116 (26%), Positives = 53/116 (45%), Gaps = 15/116 (12%)

Query: 401 EEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHS 460
           E++ ++E+ +K+K  +EKA +  KEKA R   DK  ++K P    GD            +
Sbjct: 804 EKRVKKEKVSKDKVPKEKAPRPVKEKAPRAPKDKTPKDKAPKDKAGD------AGADGKA 857

Query: 461 VKLPPKEEELEEVKDEGKKGKEPGTTETDDREET-----ERKNQDILDNSLLAGKT 511
               P+       KD GK+G E    +   + +T     + K    +D++  AGK+
Sbjct: 858 KAAKPR----SRAKDRGKEGAEGSAADEKRKSKTGVAGPDAKRSKTVDSTEDAGKS 909


>gi|19075870|ref|NP_588370.1| midasin (predicted) [Schizosaccharomyces pombe 972h-]
 gi|74676176|sp|O94248|MDN1_SCHPO RecName: Full=Midasin; AltName: Full=MIDAS-containing protein
 gi|4239674|emb|CAA20864.1| midasin (predicted) [Schizosaccharomyces pombe]
          Length = 4717

 Score = 40.9 bits (94), Expect = 1.3,   Method: Composition-based stats.
 Identities = 71/358 (19%), Positives = 139/358 (38%), Gaps = 63/358 (17%)

Query: 400  QEEKQRREQEAKEK-ADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLG---LPS 455
            +E+    EQ++ E+ A   ++D  +KE  ++   DKD QEK   +   DD G+     P 
Sbjct: 4009 EEDLLETEQKSNEQSAANNESDLVSKEDDNKALEDKDRQEKEDEEEMSDDVGIDDEIQPD 4068

Query: 456  VPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKN 515
            +  ++ + PP+ E+  ++         P   + D++E    K+ D+ D  + A     +N
Sbjct: 4069 IQENNSQPPPENEDHLDL---------PEDLKLDEKEGDVSKDSDLEDMDMEAAD---EN 4116

Query: 516  ETPAIPTAKAP------PAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKE 569
            +  A      P      P + +  + +   QD        D  + E  +        E+ 
Sbjct: 4117 KEEADAEKDEPMQDFEDPLEENNTLDEDIQQDDFSDLAEDDEKMNEDGF--------EEN 4168

Query: 570  LQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSP-------------------D 610
            +QE EE+        +   Q E  +++A D++ +  + S                    +
Sbjct: 4169 VQENEESTEDGVKSDEELEQGEVPEDQAIDNHPKMDAKSTFASAEADEENTDKGIVGENE 4228

Query: 611  EIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAIN------HFLDNDFGYYRIHNFLSQW 664
            E+ +     A+   R     DG +   ++  K  +         + D  Y  + + L +W
Sbjct: 4229 ELGEE-DGAAESGVRGNGTADGEFSSAEQVQKGEDTSTPKEAMSEADRQYQSLGDHLREW 4287

Query: 665  SPLGLMYEKDELHGVEAVYQKL-DVLFRHCI----ENLRANKNAVDAMSKAVEAGESS 717
                 ++E ++L   E+  Q   D  F H      E+L+A  NA     K+++  ES+
Sbjct: 4288 QQANRIHEWEDL--TESQSQAFDDSEFMHVKEDEEEDLQALGNAEKDQIKSIDRDESA 4343


>gi|253730462|ref|ZP_04864627.1| immunoglobulin G binding protein A [Staphylococcus aureus subsp.
           aureus USA300_TCH959]
 gi|253725792|gb|EES94521.1| immunoglobulin G binding protein A [Staphylococcus aureus subsp.
           aureus USA300_TCH959]
          Length = 520

 Score = 40.9 bits (94), Expect = 1.4,   Method: Composition-based stats.
 Identities = 59/236 (25%), Positives = 88/236 (37%), Gaps = 39/236 (16%)

Query: 341 QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQA--------- 391
           + K+L D A   KAD         N+F  E + A+  I ++ N T E +           
Sbjct: 270 EAKKLND-AQAPKAD---------NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDP 319

Query: 392 ----TVLARANAQEEKQRREQEAKEKADREKADKEAKE---KADREKADKDLQE--KTPI 442
                +LA A    + Q  ++E   K  +E  +K  KE   K  +E  +K  +E  K P 
Sbjct: 320 SVSKEILAEAKKLNDAQAPKEEDNNKPGKEDGNKPGKEDNNKPGKEDGNKPGKEDNKKPG 379

Query: 443 KAEGDDFGLGLPSVP-THSVKLPPKEEELEEVKDEGKK-GKE---------PGTTETDDR 491
           K + +  G    + P     K P KE+  +  K++G K GKE         PG T  D  
Sbjct: 380 KEDNNKPGKEDGNKPGKEDNKKPGKEDNNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDIA 439

Query: 492 EETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPL 547
           +        I  ++ LA K   K     +   K P   A        P+   E P 
Sbjct: 440 KANGTTADKIAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEENPF 495


>gi|149640031|ref|XP_001512687.1| PREDICTED: similar to diaphanous homolog 2 (Drosophila)
            [Ornithorhynchus anatinus]
          Length = 1111

 Score = 40.9 bits (94), Expect = 1.4,   Method: Composition-based stats.
 Identities = 29/115 (25%), Positives = 48/115 (41%), Gaps = 8/115 (6%)

Query: 342  IKQLRDLASKVKADYHWAEIRHGNRFKAETRLAY-----STIANVANFTSELKQATVLAR 396
            ++++   A   +  Y   +I H    K    L       S   ++  F  +L     L  
Sbjct: 947  VEKMTSFAKCARDQYEKLQIMHNTMTKLYENLGDYFIFDSKTVSIEEFFGDLSSFRSLFL 1006

Query: 397  ANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGL 451
               +E  +RRE E K K  +   +K  +EK +R+K  K L E   +  EGD+ G+
Sbjct: 1007 EAVKENNKRREMEEKSKRAKLAKEKAEQEKLERQKKKKQLME---MNKEGDETGV 1058


>gi|116182584|ref|XP_001221141.1| hypothetical protein CHGG_01920 [Chaetomium globosum CBS 148.51]
 gi|88186217|gb|EAQ93685.1| hypothetical protein CHGG_01920 [Chaetomium globosum CBS 148.51]
          Length = 1282

 Score = 40.9 bits (94), Expect = 1.4,   Method: Composition-based stats.
 Identities = 55/266 (20%), Positives = 115/266 (43%), Gaps = 40/266 (15%)

Query: 369 AETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADK------- 421
           A  +  +  I     +T  +    +L +   +E ++ + QE+++KA++E+ADK       
Sbjct: 168 AALKKRFDEIFEAMKYTKVIDNLKILRKKKGEELRELKLQESQDKANKERADKVNKLMGQ 227

Query: 422 ------EAKEKADREKADKDLQEKTPIKA---EGDDFGLGLPSVPTHSVKLPPKEEELEE 472
                 E ++K D E  ++  +E T IK+   + + F   +  + T + KL  K+E ++E
Sbjct: 228 LTREIEEGRDKYD-ELTEQMAEEGTKIKSKHEQANSFLRIVNDLQTKTEKLEYKKEAVQE 286

Query: 473 VKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHK 532
           ++           +  ++  +T++  ++ LD         T   T A    KA   Q H+
Sbjct: 287 LR-----------SRIEESADTDQVLKNALDEY-----EQTIERTVADRDRKA--TQFHE 328

Query: 533 GIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSED 592
              D K   ++    AS+ G  +SD       K E++L  Q+  +  A    + R    D
Sbjct: 329 LQGDLKSSREQHTAKASEQGKHQSDK-----DKYERQLVTQDRMIHDAATRHEIRGYDGD 383

Query: 593 LQEKAWDSYKEWKSLSPDEIKQRFQK 618
           L ++   ++ E    + ++ K+  ++
Sbjct: 384 LDDRKIAAFNERMQKTLNDKKRELER 409


>gi|160938112|ref|ZP_02085468.1| hypothetical protein CLOBOL_03006 [Clostridium bolteae ATCC
           BAA-613]
 gi|158438916|gb|EDP16672.1| hypothetical protein CLOBOL_03006 [Clostridium bolteae ATCC
           BAA-613]
          Length = 2628

 Score = 40.9 bits (94), Expect = 1.4,   Method: Composition-based stats.
 Identities = 31/144 (21%), Positives = 57/144 (39%), Gaps = 14/144 (9%)

Query: 385 TSELKQATVLARANAQEEKQRREQEAKEKADRE-------KADKEAKEKADREKADKDLQ 437
           T+   + T   R + +E ++  E    E  D+        K + E K+ AD+E+   + Q
Sbjct: 287 TASPTEGTDTGRQDTEESQKESEGSRPENTDKSEEISNNAKEEIEQKDNADKEQIHSEKQ 346

Query: 438 EKTPIKAEGDDFGLGLPSVPT----HSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREE 493
           + TP+ +    +    P V       +  LP K +    +++  K+ +EP      D   
Sbjct: 347 DDTPVASINRHYA---PVVAVKTGDETASLPEKHDSDVRIEEGTKEKEEPKENAKADNTT 403

Query: 494 TERKNQDILDNSLLAGKTHTKNET 517
            E            +GKT+  +ET
Sbjct: 404 KETAENQGSSADKTSGKTNVSSET 427


>gi|71411957|ref|XP_808187.1| myosin heavy chain [Trypanosoma cruzi strain CL Brener]
 gi|70872338|gb|EAN86336.1| myosin heavy chain, putative [Trypanosoma cruzi]
          Length = 3543

 Score = 40.9 bits (94), Expect = 1.4,   Method: Composition-based stats.
 Identities = 74/309 (23%), Positives = 129/309 (41%), Gaps = 32/309 (10%)

Query: 328  ITRTEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSE 387
            I R+E L  VT D++ +   L  ++         R  +  K    LA    A++   T E
Sbjct: 1155 IVRSEPLYSVTIDELNKTTTLNEQLTRALAQ---READNEKLAEDLAQRE-ADIEKLTDE 1210

Query: 388  LKQATV--------LARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEK 439
            L Q           LA+  A  EK   E   +E  + + A+  A+ +AD EK  +DL ++
Sbjct: 1211 LAQREADIEKLTDELAQREADNEKLTDELAQREADNEKLAEDLAQREADNEKLAEDLAQR 1270

Query: 440  TPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQ 499
               +A+ +     L      + KL   E+  +   D  K  +E    E D+ + TE   Q
Sbjct: 1271 ---EADNEKLAEDLAQREADNEKL--AEDLAQREADNEKLAEELAQREADNEKLTEELAQ 1325

Query: 500  DILDNSLLA---GKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGES 556
               DN  LA    +    NE  A   A+   A   K  ++   ++   + LA D+   E+
Sbjct: 1326 READNEKLAEDLAQREADNEKLAEDLAQR-EADNEKLTEELAQREADNEKLAEDLAQREA 1384

Query: 557  DYAGI--KLTKKEKEL--------QEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKS 606
            D   +  +L ++E ++        Q + +N ++AE + Q    +E L E+      + + 
Sbjct: 1385 DNEKLTEELAQREADIEKLAEDLAQREADNEKLAEELAQREADNEKLAEELAQREADNEK 1444

Query: 607  LSPDEIKQR 615
            L+ +E+ QR
Sbjct: 1445 LA-EELAQR 1452


>gi|326914998|ref|XP_003203809.1| PREDICTED: ribosome-binding protein 1-like [Meleagris gallopavo]
          Length = 997

 Score = 40.9 bits (94), Expect = 1.4,   Method: Composition-based stats.
 Identities = 51/224 (22%), Positives = 100/224 (44%), Gaps = 18/224 (8%)

Query: 394 LARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGL 453
           L +A +Q E ++  + AK + +  K  KE  EK++  + ++  ++   IKA   +  +  
Sbjct: 399 LNQATSQTESKQNAELAKLRQECNKLMKELSEKSEVLQQEEQQKKSWEIKAAASEKQIEQ 458

Query: 454 PSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDI--LDNSLLAGKT 511
                  V++   ++ L+EV DE +K +    +   D E+ + + Q I  L   LL+ +T
Sbjct: 459 LQAAHREVEVT-LQKRLDEVSDELRKTQSSYRSLVADAEKAKGQQQSIAELQAKLLSSET 517

Query: 512 HTKNETPAIPTAKAPPAQAH----------KGIQDKKPQDQ-REKPLASDI-GVGESDYA 559
             K++   + + K     A           K I+      Q RE     D+    E++  
Sbjct: 518 EVKSKLLELDSLKGKLQDASSENTKLLERIKSIEALLEAGQMREAEKDRDLQAANEAEMK 577

Query: 560 GIKLTKKEKE---LQEQEENLRVAEIIQQSRMQSEDLQEKAWDS 600
            ++L  +EK    L  + E   + E ++Q + ++ DL+EK W +
Sbjct: 578 QLQLRLQEKTDQLLSLEREAAELREAMEQQKTKNNDLREKNWKA 621


>gi|237829707|ref|XP_002364151.1| hypothetical protein TGME49_108600 [Toxoplasma gondii ME49]
 gi|211961815|gb|EEA97010.1| hypothetical protein TGME49_108600 [Toxoplasma gondii ME49]
          Length = 705

 Score = 40.9 bits (94), Expect = 1.4,   Method: Composition-based stats.
 Identities = 43/186 (23%), Positives = 74/186 (39%), Gaps = 10/186 (5%)

Query: 395 ARANAQEEKQRREQEAKEKADREKADKEAKE-KADREKADKDLQEKTPIKAEGDDFGLGL 453
           A  NA+E KQ  EQ    ++ +  A++ A+E K   E+A+     +TP +   ++     
Sbjct: 405 AEENAEEPKQAEEQANASQSSQTPAEENAQEPKQAEEQANASQSSETPAEENAEEPKQAE 464

Query: 454 PSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHT 513
                      P EE  EE K   ++     ++ET   E TE   Q     +        
Sbjct: 465 EQANASQSSETPAEENAEEPKQAEEQANASQSSETPAEENTEEPKQ-----AEERANASQ 519

Query: 514 KNETPAIPTAKAPPA---QAHKGIQDKKPQDQR-EKPLASDIGVGESDYAGIKLTKKEKE 569
            +ETPA   A+ P     QA+       P ++  E+P  ++     S  +     +  +E
Sbjct: 520 SSETPAEENAQEPKQGEEQANASQSSATPAEENAEEPKQAEEQANASQSSETPAEENAQE 579

Query: 570 LQEQEE 575
            ++ EE
Sbjct: 580 PKQAEE 585


>gi|326317714|ref|YP_004235386.1| protein TolA [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323374550|gb|ADX46819.1| protein TolA [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 341

 Score = 40.9 bits (94), Expect = 1.4,   Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 26/32 (81%)

Query: 400 QEEKQRREQEAKEKADREKADKEAKEKADREK 431
           Q E+ RRE+E KE+A++EK +++ KEKA REK
Sbjct: 129 QAEQDRRERERKEQAEQEKKERQQKEKAQREK 160


>gi|149238001|ref|XP_001524877.1| hypothetical protein LELG_03909 [Lodderomyces elongisporus NRRL
            YB-4239]
 gi|146451474|gb|EDK45730.1| hypothetical protein LELG_03909 [Lodderomyces elongisporus NRRL
            YB-4239]
          Length = 1436

 Score = 40.9 bits (94), Expect = 1.4,   Method: Composition-based stats.
 Identities = 37/128 (28%), Positives = 59/128 (46%), Gaps = 14/128 (10%)

Query: 386  SELKQA--TVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIK 443
            S  +QA  +V A  N  E +Q + QEA++K  RE+  K+  E   R++A K  +++    
Sbjct: 1019 SNAQQALESVTAPTNVYEVQQSKFQEAQQKL-REQKAKDLAEIQRRQQAKKLEEQQKQQL 1077

Query: 444  AEGDDFG-------LGLPSVPTHSVKLPPKEEELEEVKDEG--KKGKEPGTTETDDREET 494
               +          L  P+VP H  + PP    L + K  G  +  K+        RE+ 
Sbjct: 1078 LLQEGQELKELKELLVKPNVPEH--RAPPPVPSLSKTKSSGPVRDAKQAALIAQKKREDK 1135

Query: 495  ERKNQDIL 502
            +RKNQ I+
Sbjct: 1136 KRKNQQIV 1143


>gi|307182085|gb|EFN69463.1| DNA topoisomerase 1 [Camponotus floridanus]
          Length = 1038

 Score = 40.9 bits (94), Expect = 1.5,   Method: Composition-based stats.
 Identities = 64/297 (21%), Positives = 130/297 (43%), Gaps = 30/297 (10%)

Query: 364 GNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKAD-KE 422
           G R K     ++S+     + +SE  +      +++ ++KQ R ++ K++   +K+  ++
Sbjct: 223 GERDKDRHSTSHSSGDKEKHRSSEKDKDKHRESSSSSKDKQHRHEKDKDRHRHDKSKHRD 282

Query: 423 AKEKADREKADKDLQEKTPIK---AEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKK 479
            KEK D++K +  ++E+T +K   A  + F   L   P    + P  + EL+E  D G  
Sbjct: 283 EKEKRDKDKEEIKIKEETDMKLNHATNERFHYNLEVKPEIKEE-PMTQLELDEDDDSG-- 339

Query: 480 GKEPGTTETDDREETERKNQDILD-------------NSLLAGKTHTKNETPAIPTAKAP 526
           G+ P   + +D +E   K +  +D             N+ L  +  ++ + P    +K  
Sbjct: 340 GERPLYIKEEDDDEEAVKEEASMDSTDGNDTRLSDLHNTTLKTEEDSEEDKPLSSRSKVS 399

Query: 527 PAQAHKGIQDKK---PQDQREKP---LASDIGVGESDYAGIKLTKKEKELQEQ-EENLRV 579
           P+   K   D++   P   R+KP    +S     +  + G      E E +E+ ++ +R 
Sbjct: 400 PSVKRKIESDEEEDVPLSARKKPKRATSSKTKKKKRKHDGENDDDSEVESEEKSKKKVRA 459

Query: 580 AEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKY-AKVFYRSYSPVDGSYK 635
                  R + ++ +++ W  ++E K    D  K  F ++   VF   Y P+  + K
Sbjct: 460 KGEGASPRKRKQEEEQEVWKWWEEEK--KSDGTKWHFLEHKGPVFAPPYEPLPPNVK 514


>gi|317035431|ref|XP_001396984.2| myosin-1 [Aspergillus niger CBS 513.88]
          Length = 1532

 Score = 40.9 bits (94), Expect = 1.5,   Method: Composition-based stats.
 Identities = 48/202 (23%), Positives = 87/202 (43%), Gaps = 18/202 (8%)

Query: 404 QRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKL 463
           +R+E   +E  +   A+ E  EKA R       +E    KA+  + G     +P  S ++
Sbjct: 151 RRKETTRREDVETRLAELEQSEKAARLALLALEKELLQQKAKHGELG----ELPKSSSRI 206

Query: 464 PPKEEELEEVKDEGKKGKEPG-----TTETDDREETERKNQDILDNSLLAGKTHTKNET- 517
            P+E      +DE K  +EPG     T+     E  E++ + ++  S  A K   + +T 
Sbjct: 207 LPREVWDVNQEDEVKPAEEPGLLSWITSYLPWGESPEQRAESVIKESKSAAKPSLEAQTS 266

Query: 518 ----PAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQ 573
               PA P  K    +   G  +KK +       A+D+G G    AG    KK      +
Sbjct: 267 PASKPAEPEPKGHSRRPAGG--EKKSRGFGRSKAAADVGDGRQ--AGKPQVKKAVFESTK 322

Query: 574 EENLRVAEIIQQSRMQSEDLQE 595
           ++ + V+++   S++ +E + +
Sbjct: 323 KKEIGVSDLTLLSKISNEAIND 344


>gi|325141927|gb|EGC64367.1| IgA-specific serine endopeptidase [Neisseria meningitidis 961-5945]
 gi|325197920|gb|ADY93376.1| IgA-specific serine endopeptidase [Neisseria meningitidis G2136]
          Length = 1552

 Score = 40.9 bits (94), Expect = 1.5,   Method: Composition-based stats.
 Identities = 55/227 (24%), Positives = 95/227 (41%), Gaps = 31/227 (13%)

Query: 389  KQATVLARANAQEEKQRRE--QEAKEKADREKADKEAK-----EKADREKADKDLQEKTP 441
            +Q     R +A+  KQ+ E  +EA+E A R+KA++E        + ++E+   +L  K  
Sbjct: 1026 RQQAEAERKSAELAKQKAEAEREARELATRQKAEQERSSAELARRHEKEREAAELSAKQK 1085

Query: 442  IKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDI 501
            ++AE +   L +      + +   +  EL   ++E +K  E    +   + ETERK  +I
Sbjct: 1086 VEAEREAQALAVRR-KAEAEEAKRQAAELARQQEEARKAAELAAKQ---KAETERKAAEI 1141

Query: 502  LDNSLLAGKTHT-----KNETPAIPTAKAPPAQAH-KGIQDKKPQDQREKPL---ASDIG 552
             +    A +        K E      A++ P + + + I  +   D   + L   A +  
Sbjct: 1142 AEQKAEAEREAAELAKQKAEEEGRQAAQSQPKRRNRRAIPPELSSDATTRALPRIARNSN 1201

Query: 553  VGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSED---LQEK 596
               SDY  I L   E E         V+E +  S  Q +D   L EK
Sbjct: 1202 PDASDYEKIPLDALEDE--------DVSESVDTSDKQPQDNTELHEK 1240


>gi|195977731|ref|YP_002122975.1| cell division protein FtsQ [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
 gi|195974436|gb|ACG61962.1| cell division protein FtsQ [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
          Length = 396

 Score = 40.9 bits (94), Expect = 1.5,   Method: Composition-based stats.
 Identities = 28/85 (32%), Positives = 45/85 (52%), Gaps = 5/85 (5%)

Query: 398 NAQEEKQRREQEAKEKADREK---ADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLP 454
           N ++++  ++++ KEK   EK   A  EA  KAD+E  D + +EKT +   G D G  LP
Sbjct: 26  NKKKQQAEQDKKLKEKLLNEKIAQAQGEAASKADQEDTD-EAEEKTEVSQAGTDEGEQLP 84

Query: 455 SVPTHSVKLPPKEEELEEVKDEGKK 479
                 V   PK++ L+  K++  K
Sbjct: 85  EASEQEVS-SPKDKPLKVPKEKSPK 108


>gi|13183005|gb|AAK15023.1| IgA1 protease [Neisseria meningitidis]
          Length = 1552

 Score = 40.9 bits (94), Expect = 1.5,   Method: Composition-based stats.
 Identities = 55/227 (24%), Positives = 95/227 (41%), Gaps = 31/227 (13%)

Query: 389  KQATVLARANAQEEKQRRE--QEAKEKADREKADKEAK-----EKADREKADKDLQEKTP 441
            +Q     R +A+  KQ+ E  +EA+E A R+KA++E        + ++E+   +L  K  
Sbjct: 1026 RQQAEAERKSAELAKQKAEAEREARELATRQKAEQERSSAELARRHEKEREAAELSAKQK 1085

Query: 442  IKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDI 501
            ++AE +   L +      + +   +  EL   ++E +K  E    +   + ETERK  +I
Sbjct: 1086 VEAEREAQALAVRR-KAEAEEAKRQAAELARQQEEARKAAELAAKQ---KAETERKAAEI 1141

Query: 502  LDNSLLAGKTHT-----KNETPAIPTAKAPPAQAH-KGIQDKKPQDQREKPL---ASDIG 552
             +    A +        K E      A++ P + + + I  +   D   + L   A +  
Sbjct: 1142 AEQKAEAEREAAELAKQKAEEEGRQAAQSQPKRRNRRAIPPELSSDATTRALPRIARNSN 1201

Query: 553  VGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSED---LQEK 596
               SDY  I L   E E         V+E +  S  Q +D   L EK
Sbjct: 1202 PDASDYEKIPLDALEDE--------DVSESVDTSDKQPQDNTELHEK 1240


>gi|281344615|gb|EFB20199.1| hypothetical protein PANDA_014411 [Ailuropoda melanoleuca]
          Length = 394

 Score = 40.9 bits (94), Expect = 1.5,   Method: Composition-based stats.
 Identities = 42/208 (20%), Positives = 85/208 (40%), Gaps = 29/208 (13%)

Query: 341 QIKQLRDLASKVKADYHWAEIRH---GNRFKAETRLAYSTIANVANFTSELKQATVLARA 397
           Q++ L     K++A+    E RH     +F   T    + +  +     E+    + A  
Sbjct: 213 QVQSLMVHQRKLEAELLQIEERHQEKKRKFLESTDSFNNELKRLCGLKVEVDMEKIAAEI 272

Query: 398 NAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVP 457
              EE+ R+ QE +EK   E+A++        E+     Q  +  + + DD         
Sbjct: 273 AQAEEQARKRQEEREKEAAEQAERSQSSMVPEEE-----QTASKTEEKKDD--------- 318

Query: 458 THSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNET 517
             S+ +  +E  LEE  +  + G+E GT+  +D+E  +     + +       T +++ +
Sbjct: 319 -ESIPMETEETHLEEATESQQNGEE-GTSTPEDKESGQEGVDSLAEEGTSDSNTGSESNS 376

Query: 518 PAIPTAKAPPAQAHKGIQDKKPQDQREK 545
               T + PP        D  P+D++++
Sbjct: 377 ---ATVEEPPT-------DPTPEDEKKE 394


>gi|195164299|ref|XP_002022986.1| GL16567 [Drosophila persimilis]
 gi|194105048|gb|EDW27091.1| GL16567 [Drosophila persimilis]
          Length = 592

 Score = 40.9 bits (94), Expect = 1.5,   Method: Composition-based stats.
 Identities = 50/217 (23%), Positives = 96/217 (44%), Gaps = 36/217 (16%)

Query: 396 RANAQEEKQRRE----------QEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAE 445
           + + QEE Q+R+          Q+AK +A  +K  +E +E+  +EK ++  Q++ P +  
Sbjct: 350 KEDPQEESQKRKARSTNLKYKNQKAKSQAKTQK--EEPQEEGQKEKPEEKNQKEDPQEES 407

Query: 446 GDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNS 505
                   P       K P K+ + EE ++EG++GK     + +D +E  +K +    N 
Sbjct: 408 QKH----KPQNKNQKAK-PQKKSQKEEPQEEGQQGKPQEENQKEDPQEGSQKYKPQNKNQ 462

Query: 506 LLAGKTHTKNETPAIPTAKAPPAQAHK------GIQDKKPQDQREKPLASDIGVGESDYA 559
               +  T+ + P     K  P + ++      G Q  KPQ++ +K             A
Sbjct: 463 KAKPQAKTQKKEPQEAGQKEKPQEENQKEDPQEGSQKYKPQNKNQK-------------A 509

Query: 560 GIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEK 596
             +   +++ELQE+ +  +  E  Q+   Q +  +EK
Sbjct: 510 KPQAKTQKEELQEEGQKEKPEEENQKEDPQGKSQKEK 546



 Score = 38.9 bits (89), Expect = 5.8,   Method: Composition-based stats.
 Identities = 52/247 (21%), Positives = 103/247 (41%), Gaps = 29/247 (11%)

Query: 401 EEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHS 460
           ++ +RR++  KEK   +   +E +E+  +EK  ++ Q++ P +          P      
Sbjct: 268 QKNKRRKKSQKEKPQAKSQKEEPQEEGQKEKPQEENQKEDPQEESQKH----KPQNKNQK 323

Query: 461 VKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQD-----ILDNSLLAGKTHTKN 515
            K   K ++ EE ++EG+K K     + +D +E  +K +         N     +  T+ 
Sbjct: 324 AKSQAKTQK-EEPQEEGQKEKPQEKNQKEDPQEESQKRKARSTNLKYKNQKAKSQAKTQK 382

Query: 516 ETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEE 575
           E P     K  P + ++  +D + + Q+ KP        ++     K  KK ++ + QEE
Sbjct: 383 EEPQEEGQKEKPEEKNQK-EDPQEESQKHKP--------QNKNQKAKPQKKSQKEEPQEE 433

Query: 576 NLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSYK 635
                   QQ + Q E+ +E   +  +++K   P    Q+ +  AK   +         K
Sbjct: 434 G-------QQGKPQEENQKEDPQEGSQKYK---PQNKNQKAKPQAKTQKKEPQEAGQKEK 483

Query: 636 GTQESDK 642
             +E+ K
Sbjct: 484 PQEENQK 490


>gi|194766417|ref|XP_001965321.1| GF20711 [Drosophila ananassae]
 gi|190617931|gb|EDV33455.1| GF20711 [Drosophila ananassae]
          Length = 5735

 Score = 40.9 bits (94), Expect = 1.5,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 29/38 (76%)

Query: 397  ANAQEEKQRREQEAKEKADREKADKEAKEKADREKADK 434
            A   E++QR+E+E KE+ +REK +KE +++ +RE+ ++
Sbjct: 2026 AEKSEKEQRQEREKKERLEREKREKELRKQQEREEKER 2063


>gi|322816258|gb|EFZ24632.1| hypothetical protein TCSYLVIO_9224 [Trypanosoma cruzi]
          Length = 1998

 Score = 40.9 bits (94), Expect = 1.5,   Method: Composition-based stats.
 Identities = 45/171 (26%), Positives = 71/171 (41%), Gaps = 25/171 (14%)

Query: 437  QEKTPIKAEGD-----DFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDR 491
            QE+   K E +      F    P V T ++K PP   E EE  D+  +   P +T+T   
Sbjct: 1734 QEREEDKGENEGERMEHFPRTSPPVITSALKTPPSITEKEEGWDDVLEDMSPPSTQTGRD 1793

Query: 492  EETERKNQDILDNSLLAGKTHTKNETPAIPTAKA---PPAQAHKG---IQDKKPQDQR-- 543
            +E  +K+Q  L+ S  + +  +K       T K+    P Q   G     +K P++++  
Sbjct: 1794 DELAKKDQGALEKSPTSHEDSSKRLRLRASTKKSKIRAPRQKRLGEVLCLEKAPEEKKET 1853

Query: 544  ------EKP------LASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEI 582
                  EKP        S+  V + D A   L +KE      +E  +VA I
Sbjct: 1854 DITHHGEKPHENEPQTRSEATVSKGDVALCALEEKEMTPSVDDEEKKVATI 1904


>gi|301614638|ref|XP_002936805.1| PREDICTED: tetratricopeptide repeat protein 21B-like [Xenopus
           (Silurana) tropicalis]
          Length = 1320

 Score = 40.9 bits (94), Expect = 1.6,   Method: Composition-based stats.
 Identities = 45/186 (24%), Positives = 85/186 (45%), Gaps = 25/186 (13%)

Query: 4   LATSIDYQTNNLDQ--DKIPSEDVAKTLTS----IQDNIK---HLREFIIAWSSDLNPHK 54
           L+  ID   N+L    D+ PS   A  L S     QDN+K      E  +++S ++  + 
Sbjct: 508 LSGDIDAAQNSLQHCLDQNPSYADAHLLMSQIYLFQDNLKLCSQSLELCLSYSFEIRDYP 567

Query: 55  DRYDYIVGPIEQRLKKVSERYERVVSRDLTLVIEAGLKDLKEVGDTLKRLAETGEVILSD 114
             Y+ I    ++R+ +V E  +       TL I   L  ++  G ++K   +  EV  SD
Sbjct: 568 -LYNLIKAQTQKRMGEVQEAIK-------TLQIAMSLPGMRRAGTSVKSKGKKPEVSPSD 619

Query: 115 KSDRLLCRFMDMVETE----DEHKINKQVRDALESAGFDLESTQENIRKVESALINNNMK 170
           +    +  F+++V+      ++H+  K ++DA+       E  +  I   E AL++ +++
Sbjct: 620 R----VSIFLELVDAHRLNGEQHEATKVLQDAIIEFSGTPEELRLMIANAELALVHGDVE 675

Query: 171 DAFRFL 176
           +A   L
Sbjct: 676 EALSML 681


>gi|320040240|gb|EFW22173.1| conserved hypothetical protein [Coccidioides posadasii str.
           Silveira]
          Length = 1259

 Score = 40.9 bits (94), Expect = 1.6,   Method: Composition-based stats.
 Identities = 57/253 (22%), Positives = 109/253 (43%), Gaps = 28/253 (11%)

Query: 387 ELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEG 446
           E KQA ++ R    EEKQ   +  +E+ +R K++ E+K  A+ E   ++L++K     +G
Sbjct: 730 EAKQAELVDRQKELEEKQSEVEAKQEEINRLKSELESK-IAELEDKRRELEQK-----QG 783

Query: 447 DDFGLGLPSVPTHSVKLPPKEEELEEVK---DEGKKGKEPGTTETDDREETERKNQDILD 503
           +        + +   +L   ++EL+EVK   +E K   E    + D ++E     Q  LD
Sbjct: 784 E--------LESKQTELQAIQDELQEVKAELEEKKSQLESKQADLDKKQEELTAKQAELD 835

Query: 504 NSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKL 563
           +     K     E  A+       AQ  +     K +D++ + + ++    E  +   + 
Sbjct: 836 DV----KEKHAAELAAL------RAQLEEQTNATKERDEKIEAMTTEHQQKEEQWQKDR- 884

Query: 564 TKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAKVF 623
              E +LQE+ E L+VA   +++       +E+   S  E    + D + +  ++  K  
Sbjct: 885 GDFEAQLQEKTEELKVALEEKEALAVDGKNREERLQSIVEEMRQTHDNLNKDRERLKKTL 944

Query: 624 YRSYSPVDGSYKG 636
           +      D   KG
Sbjct: 945 HSLGEATDMKIKG 957


>gi|307172721|gb|EFN64027.1| Myosin light chain kinase, smooth muscle [Camponotus floridanus]
          Length = 7605

 Score = 40.9 bits (94), Expect = 1.6,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 91/223 (40%), Gaps = 35/223 (15%)

Query: 387  ELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREK-------ADKDLQEK 439
            ++KQ     + NA E  +   QE+K+  + EK   E  E+ ++E        A+K  QE 
Sbjct: 4140 KVKQIEKQEKVNATESIKDEIQESKKIIETEKIKSEKNEQQNKENYEEINKMAEKQEQET 4199

Query: 440  TPIKAEGDDFGLGLPSVPTHSVKLPPKEE----ELEEVKDEGKKGKEPGTTETDDREETE 495
               + E D               L  KEE    +LEE KD  +K  +    E  D  + E
Sbjct: 4200 VQKRKESD-------KSKKIEKDLNVKEETGKIKLEEAKDIERKKVQAKEKEKADEIKKE 4252

Query: 496  RKNQDILDNSLLAGKTH-TKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVG 554
            ++ +DI +    A + +  KNE   +   +           DK  Q ++E        + 
Sbjct: 4253 QELKDIKEKVKEATEQYDKKNEIEKLQKKETDEI-------DKTQQKEQEHVRIEKTEIV 4305

Query: 555  ESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKA 597
            E D+       + KE+++QEE+    + I++   + E   EKA
Sbjct: 4306 EKDH-----KIEVKEIKKQEED----KTIKKDGKEQEKEDEKA 4339



 Score = 38.2 bits (87), Expect = 9.7,   Method: Composition-based stats.
 Identities = 58/263 (22%), Positives = 107/263 (40%), Gaps = 75/263 (28%)

Query: 407  EQEAKEKADREKA-------------DKEAKEKADREKADKDLQEKTPIKAE-------G 446
            +QE K++AD  K+             +KE K K + E+  K++++   IK E        
Sbjct: 4065 QQECKKEADEMKSRNEEQKKEEIEKINKEQKSK-EIEQVTKEVEQNKSIKDERIKKDEKE 4123

Query: 447  DDFGLGLPSVPTHS---VKLPPKEEEL---EEVKDEGKKGKEPGTTETDDREETERKNQD 500
                    S+  H    VK   K+E++   E +KDE ++ K+   TE    E+ E++N++
Sbjct: 4124 HKITQETESLKKHEDGKVKQIEKQEKVNATESIKDEIQESKKIIETEKIKSEKNEQQNKE 4183

Query: 501  ILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAG 560
              +                    K    Q  + +Q +K  D+ +K +  D+ V E +   
Sbjct: 4184 NYEE-----------------INKMAEKQEQETVQKRKESDKSKK-IEKDLNVKE-ETGK 4224

Query: 561  IKL---------------------TKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWD 599
            IKL                      KKE+EL++ +E ++ A      + + E LQ+K  D
Sbjct: 4225 IKLEEAKDIERKKVQAKEKEKADEIKKEQELKDIKEKVKEATEQYDKKNEIEKLQKKETD 4284

Query: 600  SYKEWKSLSPDEIKQRFQKYAKV 622
                      D+ +Q+ Q++ ++
Sbjct: 4285 EI--------DKTQQKEQEHVRI 4299


>gi|224011559|ref|XP_002295554.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|209583585|gb|ACI64271.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 294

 Score = 40.9 bits (94), Expect = 1.6,   Method: Composition-based stats.
 Identities = 32/106 (30%), Positives = 54/106 (50%), Gaps = 5/106 (4%)

Query: 341 QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQ 400
           ++K++R    K KA+    E +   R +A+        A +      +K+A  L R   Q
Sbjct: 92  RLKRMRVQEEKQKAELAVKEEKRQKRKRAQEE---KWKAELEKAELAIKEAKRLKRMRVQ 148

Query: 401 EEKQRREQEAKEKADREKADKEAKEKADRE--KADKDLQEKTPIKA 444
           EEKQ+ E   KE+  + K  +E K KA+RE  KA++ ++E   ++A
Sbjct: 149 EEKQKAELAVKEERQKGKRAQEEKWKAEREKWKAERAIKEAQRMRA 194


>gi|156975663|ref|YP_001446570.1| translation initiation factor IF-2 [Vibrio harveyi ATCC BAA-1116]
 gi|166198944|sp|A7MZI5|IF2_VIBHB RecName: Full=Translation initiation factor IF-2
 gi|156527257|gb|ABU72343.1| hypothetical protein VIBHAR_03396 [Vibrio harveyi ATCC BAA-1116]
          Length = 894

 Score = 40.9 bits (94), Expect = 1.6,   Method: Composition-based stats.
 Identities = 31/94 (32%), Positives = 47/94 (50%), Gaps = 10/94 (10%)

Query: 389 KQATVLARANAQEEKQRREQEAKEKADRE-KADKEAKEKADREKADKDLQEKTPIKAEGD 447
           ++A   A+  A E+ QR   EA EKA RE  A +EA+EKA R +ADK  +E     A+ +
Sbjct: 125 REAEEQAKREAAEKAQR---EADEKAKREADAKREAEEKAKRAQADKAKKEMNAKNADAN 181

Query: 448 DFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGK 481
                       + +L  ++EE  + K E +  K
Sbjct: 182 T------QAKKEADELKRRQEEEAQRKAEQEAAK 209


>gi|153835044|ref|ZP_01987711.1| translation initiation factor IF-2 [Vibrio harveyi HY01]
 gi|148868521|gb|EDL67620.1| translation initiation factor IF-2 [Vibrio harveyi HY01]
          Length = 894

 Score = 40.9 bits (94), Expect = 1.6,   Method: Composition-based stats.
 Identities = 31/94 (32%), Positives = 47/94 (50%), Gaps = 10/94 (10%)

Query: 389 KQATVLARANAQEEKQRREQEAKEKADRE-KADKEAKEKADREKADKDLQEKTPIKAEGD 447
           ++A   A+  A E+ QR   EA EKA RE  A +EA+EKA R +ADK  +E     A+ +
Sbjct: 125 REAEEQAKREAAEKAQR---EADEKAKREADAKREAEEKAKRAQADKAKKEMNAKNADAN 181

Query: 448 DFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGK 481
                       + +L  ++EE  + K E +  K
Sbjct: 182 T------QAKKEADELKRRQEEEAQRKAEQEAAK 209


>gi|326474304|gb|EGD98313.1| myosin type II heavy chain [Trichophyton tonsurans CBS 112818]
          Length = 2406

 Score = 40.9 bits (94), Expect = 1.6,   Method: Composition-based stats.
 Identities = 79/318 (24%), Positives = 121/318 (38%), Gaps = 53/318 (16%)

Query: 310  KSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKA 369
            KS  W R    +   +G  TRT G      ++I+QL    +K + D    +     R K 
Sbjct: 907  KSSPWWRLFATMKPLLGE-TRTAGEVKKRDEKIQQLE---AKAQQDIAERQRIEEERRKV 962

Query: 370  ETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADR 429
            ET +           T E +++  L +    +  Q RE E  EK     AD+E+ E    
Sbjct: 963  ETEMQR------IRKTLESERSLALDKEEIFKRLQLREVELSEKLAGAIADQESLE---- 1012

Query: 430  EKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEE-VKDEGKKGKEPGTTET 488
            ++ D+ +  K  I+ E D     L        +L  +++EL+E + D  K+ K   +T  
Sbjct: 1013 DQLDELIAAKKKIEHELDLRRGQLEQAAQIMERLEGEKKELQERISDMEKQLKSVESTHG 1072

Query: 489  DDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLA 548
            +  E+ E  NQ+I  N+L                       +H  ++DKK QD   K L+
Sbjct: 1073 EYDEKIEALNQEI--NTL----------------------NSHLAMKDKKLQDLEAKLLS 1108

Query: 549  SDIGVGESDYAGIKLTKKEKEL--------QEQEENLRVAEIIQQSRMQSEDLQEKAWDS 600
            SD          ++L    KEL        Q  EEN  +   I      S   +E     
Sbjct: 1109 SD------QQLDLELANTTKELEGSKKQIKQLLEENREIQRQIADLSSTSTGYEELVRRK 1162

Query: 601  YKEWKSLSPDEIKQRFQK 618
              E   L  D  K  F+K
Sbjct: 1163 EGEVAILKADLKKHEFEK 1180


>gi|158285449|ref|XP_308315.4| AGAP007562-PA [Anopheles gambiae str. PEST]
 gi|157019997|gb|EAA04495.4| AGAP007562-PA [Anopheles gambiae str. PEST]
          Length = 3964

 Score = 40.9 bits (94), Expect = 1.6,   Method: Composition-based stats.
 Identities = 45/200 (22%), Positives = 86/200 (43%), Gaps = 21/200 (10%)

Query: 858  TIYAFERSLKN-QAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVS 916
            ++ AF+R L   +A + AE ERL     Q  +S A+ + ++          +  + RI +
Sbjct: 929  SVLAFDRELGEVRAAIRAEAERLERTRGQYGESVAEAQSVRVAFEERATILQELERRIDA 988

Query: 917  FIRS--EFEREIKELKSVIEADAKENPNPNKN-QKKLQKTRE---------KLVAQLSSR 964
            FI S  E  R+  E    IE++  +  N   +  +KL++ R+         +L+  +   
Sbjct: 989  FISSGTELVRQYPETSPYIESETHKIRNEWTDLLRKLEEHRQLHTIAIEYFELITIIEEH 1048

Query: 965  LKELNID-----NAYGLWN--EYKEDFKASFEYPLGTYEPAILGAMKDMDRLHP-IYSVS 1016
             + LN +     N   + N  +   D  A  +  + T+E + L A+K +  L   +Y   
Sbjct: 1049 YRTLNAELINANNKLTILNNADVANDLVAQVDNTIRTHETSQLDALKKIANLSTQLYGCD 1108

Query: 1017 KTIQKAGGDPSLMMDYEKVE 1036
            KT+     +  L   + K++
Sbjct: 1109 KTVTLYTENTKLFQTFYKIK 1128


>gi|3986196|dbj|BAA34955.1| myosin heavy chain [Dugesia japonica]
          Length = 1743

 Score = 40.9 bits (94), Expect = 1.6,   Method: Composition-based stats.
 Identities = 88/478 (18%), Positives = 185/478 (38%), Gaps = 65/478 (13%)

Query: 137  KQVRDALESAGFDLESTQENIRKVES---------ALINNNMKDAFRFLELAQKSKETAD 187
            K++   +E    D+ES + +++K E            +N+N+++    +   QK K+ AD
Sbjct: 732  KKLNGEIEELKKDVESLESSLQKAEQEKAAKDQQIKTLNDNVREKEEQITKMQKEKKAAD 791

Query: 188  SHIIEAIDVGTKLKENTPPTTFTSISKVLLKSNNMQDVVFTKIKEVVKKHVNAELGHRKL 247
                  +   T+          ++++K   K     D +   +    K   + E   RK+
Sbjct: 792  E-----LQKKTEESLRAEEEKVSNLNKAKAKLEQAVDEMEENLSREQKVRADVEKAKRKV 846

Query: 248  RGLAFDHTYFNDKLNQFLKEIKNHQKEYDESEKGSSKARYHAAYAHIYWDLANDWVNGRV 307
             G                 E+K +Q+  ++ E+  S+         +  + AN     ++
Sbjct: 847  EG-----------------ELKQNQEMLNDLERVKSELEEQLKRKEMELNGANS----KI 885

Query: 308  GDKSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAEIR----- 362
             D+++  A     I     RI   E       +  +Q R  A K K     AEI      
Sbjct: 886  EDENNLVATLQRKIKELQARIQELEE----DLEAERQARAKAEKAKHQLE-AEIEEVTER 940

Query: 363  ---HGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKA 419
                G   +A+T L     A +     +L++A +       + +++++  A E AD+   
Sbjct: 941  LEEQGGATQAQTDLNKKREAELMKLKRDLEEANMQHEQAIMQTRKKQQDTANEFADQLDQ 1000

Query: 420  DKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKK 479
             +++K K +REK +        ++ + +D    L S+    + L    + LE    E + 
Sbjct: 1001 LQKSKSKIEREKNE--------LRGDIEDLSGQLESLNKAKINLEKSNKGLEATISELQN 1052

Query: 480  GKEPGTTETDDREETERKNQ---DILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQD 536
              +  T +  D   +  +NQ     L  SL   ++     + A    +A   +A + ++D
Sbjct: 1053 KLDELTKQLSDAGNSNNRNQHENSELHKSLEDAESQINQLSKAKQQLQAQLEEAKQNLED 1112

Query: 537  KKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQE---QEENLRVAEIIQQSRMQSE 591
               + + +  L  D+    SD   ++ + +E++  +   Q + ++V   +QQ +  S+
Sbjct: 1113 ---ESRAKSKLNGDLRNALSDLDAMRESLEEEQEGKSDVQRQLVKVQNELQQLKSNSQ 1167


>gi|326479262|gb|EGE03272.1| hypothetical protein TEQG_02306 [Trichophyton equinum CBS 127.97]
          Length = 2406

 Score = 40.9 bits (94), Expect = 1.6,   Method: Composition-based stats.
 Identities = 79/318 (24%), Positives = 121/318 (38%), Gaps = 53/318 (16%)

Query: 310  KSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKA 369
            KS  W R    +   +G  TRT G      ++I+QL    +K + D    +     R K 
Sbjct: 907  KSSPWWRLFATMKPLLGE-TRTAGEVKKRDEKIQQLE---AKAQQDIAERQRIEEERRKV 962

Query: 370  ETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADR 429
            ET +           T E +++  L +    +  Q RE E  EK     AD+E+ E    
Sbjct: 963  ETEMQR------IRKTLESERSLALDKEEIFKRLQLREVELSEKLAGAIADQESLE---- 1012

Query: 430  EKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEE-VKDEGKKGKEPGTTET 488
            ++ D+ +  K  I+ E D     L        +L  +++EL+E + D  K+ K   +T  
Sbjct: 1013 DQLDELIAAKKKIEHELDLRRGQLEQAAQIMERLEGEKKELQERISDMEKQLKSVESTHG 1072

Query: 489  DDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLA 548
            +  E+ E  NQ+I  N+L                       +H  ++DKK QD   K L+
Sbjct: 1073 EYDEKIEALNQEI--NTL----------------------NSHLAMKDKKLQDLEAKLLS 1108

Query: 549  SDIGVGESDYAGIKLTKKEKEL--------QEQEENLRVAEIIQQSRMQSEDLQEKAWDS 600
            SD          ++L    KEL        Q  EEN  +   I      S   +E     
Sbjct: 1109 SD------QQLDLELANTTKELEGSKKQIKQLLEENREIQRQIADLSSTSTGYEELVRRK 1162

Query: 601  YKEWKSLSPDEIKQRFQK 618
              E   L  D  K  F+K
Sbjct: 1163 EGEVAILKADLKKHEFEK 1180


>gi|322712198|gb|EFZ03771.1| myosin type II heavy chain [Metarhizium anisopliae ARSEF 23]
          Length = 2388

 Score = 40.9 bits (94), Expect = 1.6,   Method: Composition-based stats.
 Identities = 114/613 (18%), Positives = 236/613 (38%), Gaps = 70/613 (11%)

Query: 382  ANFTSEL--KQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEK 439
            AN   +L   Q T+       E+ Q   ++   +  RE       EKA      +  +  
Sbjct: 1482 ANLNKQLGDAQVTIATLEKKTEKLQLNLEDLNHEVAREVQSSRNAEKASSNFTVQLAEAN 1541

Query: 440  TPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQ 499
              I +E         +V T    +  +++EL+E++ +          E      ++  NQ
Sbjct: 1542 RTIDSERQLRTQSQATVRTLQATIDARDKELQELRGQMLNALRSVDPEIRIPPPSDDSNQ 1601

Query: 500  D-ILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDY 558
              +L N  LA K     +   + +A    A++          +   +P   +I + E+ +
Sbjct: 1602 KALLKNFDLARKVEELQQNLRVQSAARTNAESQLADLRATRHESPGRPKLEEIHLNEAPF 1661

Query: 559  AGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQK 618
             G    ++  ++     N R        R  ++D+ E+  D+ +  K++    +  R   
Sbjct: 1662 NGSPTQRRAAKI-----NTRRFSNTSTPRKANQDITEQH-DTARSDKTVDTLAVNNRMDL 1715

Query: 619  YAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSPLGLMYEKDELHG 678
             A+V       +    + TQ  ++ +   +D   G     ++  Q   L  M        
Sbjct: 1716 KAEV-----EELQNQLQITQMQNRHLQSQIDR--GTPGPDSYNDQSPSLRRM-------- 1760

Query: 679  VEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGESSVRKHSFEVLSSKHQKSVIAVN 738
                 QKL+ +     E L  +   V A+ K +  GE S+R    +V +  H++ +   N
Sbjct: 1761 -----QKLEKVNSRLHEMLDDSTKKVSALEKNIRTGELSLR----DVQARSHEEILDVFN 1811

Query: 739  NFIKEITHHTRRLVKEDPKRGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQE 798
            +        +RR +    K   +E  L+D++S   K+      + ++LR      D+ QE
Sbjct: 1812 S-----QEESRRALLHSHKDAVAE--LTDVKSHFDKMRHERAKLEVELR--DTKSDL-QE 1861

Query: 799  QPPLYTIISGSEKILQGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWT 858
                    + S   L  +YT       ++Q + D+  SKL ++        +  +E +  
Sbjct: 1862 MAMAREQEAQSRSQLLQEYT-------ELQIRLDAETSKLADVSGSLEVYKSRADEYFGK 1914

Query: 859  IYAFERSL----------KNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKE 908
            +   E ++          K+QA  + +        +Q  D+T  +++LQ Q  R ++  E
Sbjct: 1915 LEQAEIAVLKASRAEQFAKSQAKESEDTYSEVMAERQKMDAT--IEDLQRQNQRLEERIE 1972

Query: 909  --SNDERIVSFIRSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLK 966
              S D   V+  +   + E+++ +S    D ++       +  +++TR+K  A+ ++  K
Sbjct: 1973 DISTDLESVTQAKKRLQHELEDYRSQRAMDIED------KESSMEQTRKKYQAEFTTLTK 2026

Query: 967  ELNIDNAYGLWNE 979
            EL++     L+ +
Sbjct: 2027 ELDLAREEKLYKQ 2039


>gi|237830135|ref|XP_002364365.1| hypothetical protein, conserved [Toxoplasma gondii ME49]
 gi|211962029|gb|EEA97224.1| hypothetical protein, conserved [Toxoplasma gondii ME49]
 gi|221507235|gb|EEE32839.1| conserved hypothetical protein [Toxoplasma gondii VEG]
          Length = 4690

 Score = 40.9 bits (94), Expect = 1.6,   Method: Composition-based stats.
 Identities = 31/101 (30%), Positives = 46/101 (45%), Gaps = 6/101 (5%)

Query: 398  NAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVP 457
            N++ E + +EQ A+E+  RE   KE    + RE   K      P K E ++   G     
Sbjct: 990  NSEREPRPKEQGAREEDCRE-GTKETSVPSSREGVRKQDSPGGPEKEEAEEPSRGEDPGE 1048

Query: 458  THSVKLPPKEEELEEVKDEGKK-----GKEPGTTETDDREE 493
               V +  K  +LE + DE K+     GKE    +TD RE+
Sbjct: 1049 VLDVLVSSKGADLEGLADEEKRQDVPNGKEAKKEKTDSRED 1089


>gi|119944497|ref|YP_942177.1| TolA family protein [Psychromonas ingrahamii 37]
 gi|119863101|gb|ABM02578.1| TolA family protein [Psychromonas ingrahamii 37]
          Length = 304

 Score = 40.9 bits (94), Expect = 1.6,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 35/56 (62%), Gaps = 5/56 (8%)

Query: 380 NVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKD 435
           N+A   SE KQA    R   ++EKQR EQE K+ A+R  A+K  K+ A++ KA +D
Sbjct: 56  NLAQRQSEKKQAE---RKKVEQEKQRIEQEKKKAAERVAAEK--KQAAEKLKAKQD 106


>gi|302331859|gb|ADL22052.1| immunoglobulin G binding protein A [Staphylococcus aureus subsp.
           aureus JKD6159]
          Length = 492

 Score = 40.9 bits (94), Expect = 1.7,   Method: Composition-based stats.
 Identities = 56/227 (24%), Positives = 85/227 (37%), Gaps = 37/227 (16%)

Query: 341 QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSE--------LKQAT 392
           + K+L D A   KAD         N+F  E + A+  I ++ N T E        LK   
Sbjct: 258 EAKKLND-AQAPKAD---------NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDP 307

Query: 393 VLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQE--KTPIKAEGDDFG 450
            +++    E K+  + +A ++ D  K  KE   K  +E  +K  +E    P K +G+  G
Sbjct: 308 SVSKEILAEAKKLNDAQAPKEEDNNKPGKEDGNKPGKEDGNKPGKEDGNKPGKEDGNKPG 367

Query: 451 LGLPSVPTHSVKLPPKEEELEEVKDEGKK-GKE---------PGTTETDDREETERKNQD 500
                        P KE+  +  K++G K GKE         PG T  D  +        
Sbjct: 368 -------KEDGNKPGKEDGNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADK 420

Query: 501 ILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPL 547
           I  ++ LA K   K     +   K P   A        P+   E P 
Sbjct: 421 IAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEENPF 467


>gi|303321544|ref|XP_003070766.1| hypothetical protein CPC735_038850 [Coccidioides posadasii C735
           delta SOWgp]
 gi|240110463|gb|EER28621.1| hypothetical protein CPC735_038850 [Coccidioides posadasii C735
           delta SOWgp]
          Length = 1252

 Score = 40.9 bits (94), Expect = 1.7,   Method: Composition-based stats.
 Identities = 57/253 (22%), Positives = 109/253 (43%), Gaps = 28/253 (11%)

Query: 387 ELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEG 446
           E KQA ++ R    EEKQ   +  +E+ +R K++ E+K  A+ E   ++L++K     +G
Sbjct: 723 EAKQAELVDRQKELEEKQSEVEAKQEEINRLKSELESK-IAELEDKRRELEQK-----QG 776

Query: 447 DDFGLGLPSVPTHSVKLPPKEEELEEVK---DEGKKGKEPGTTETDDREETERKNQDILD 503
           +        + +   +L   ++EL+EVK   +E K   E    + D ++E     Q  LD
Sbjct: 777 E--------LESKQTELQAIQDELQEVKAELEEKKSQLESKQADLDKKQEELTAKQAELD 828

Query: 504 NSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKL 563
           +     K     E  A+       AQ  +     K +D++ + + ++    E  +   + 
Sbjct: 829 DV----KEKHAAELAAL------RAQLEEQTNATKERDEKIEAMTTEHQQKEEQWQKDR- 877

Query: 564 TKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAKVF 623
              E +LQE+ E L+VA   +++       +E+   S  E    + D + +  ++  K  
Sbjct: 878 GDFEAQLQEKTEELKVALEEKEALAVDGKNREERLQSIVEEMRQTHDNLNKDRERLKKTL 937

Query: 624 YRSYSPVDGSYKG 636
           +      D   KG
Sbjct: 938 HSLGEATDMKIKG 950


>gi|254580383|ref|XP_002496177.1| ZYRO0C12254p [Zygosaccharomyces rouxii]
 gi|186703858|emb|CAQ43545.1| Probable DNA-binding protein SNT1 [Zygosaccharomyces rouxii]
 gi|238939068|emb|CAR27244.1| ZYRO0C12254p [Zygosaccharomyces rouxii]
          Length = 1432

 Score = 40.9 bits (94), Expect = 1.7,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 45/79 (56%), Gaps = 5/79 (6%)

Query: 399 AQEEKQRREQEAKEKADREKAD----KEAKEKADREKADKDLQEKTPIKAEGDDFGLGL- 453
           +++EK ++E++ +EK  +EK      K+ K+K +++K +KD +E + ++      G  L 
Sbjct: 412 SKQEKDKQEKDKQEKVKQEKVKQEKVKQEKDKQEKDKQEKDKEEASKVQDNPHSLGSSLI 471

Query: 454 PSVPTHSVKLPPKEEELEE 472
            SVP  + KL  ++   E+
Sbjct: 472 NSVPQQTRKLEHRDSNSED 490


>gi|123967262|ref|XP_001276823.1| hypothetical protein [Trichomonas vaginalis G3]
 gi|121918809|gb|EAY23575.1| conserved hypothetical protein [Trichomonas vaginalis G3]
          Length = 832

 Score = 40.9 bits (94), Expect = 1.7,   Method: Composition-based stats.
 Identities = 17/64 (26%), Positives = 42/64 (65%), Gaps = 5/64 (7%)

Query: 376 STIANVANFTSELKQATVLARANAQ-----EEKQRREQEAKEKADREKADKEAKEKADRE 430
           ++++ V +F +E K+    A+  A+     EE+Q R+++ +++ +R++ +++ KE+ +RE
Sbjct: 602 NSVSQVPDFAAEEKRRQEDAKRMAELRRQMEEEQARQEKERQERERQEKERQEKERQERE 661

Query: 431 KADK 434
           + DK
Sbjct: 662 RLDK 665


>gi|266623887|ref|ZP_06116822.1| putative cell division protein Smc [Clostridium hathewayi DSM 13479]
 gi|288864300|gb|EFC96598.1| putative cell division protein Smc [Clostridium hathewayi DSM 13479]
          Length = 1193

 Score = 40.9 bits (94), Expect = 1.7,   Method: Composition-based stats.
 Identities = 91/383 (23%), Positives = 151/383 (39%), Gaps = 82/383 (21%)

Query: 719  RKHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVK-----EDPKRGKSESYL--SDIRSE 771
            RK   E L     K++  V+   +++  +   L +     E  K  K ESYL  + +R  
Sbjct: 682  RKREIEELEGACTKALTDVDRIEQDLVMNEALLAESREELESLKSRKQESYLRQNTVRMS 741

Query: 772  LQKVNKTVMDIRIKLRLYGIFQDIPQEQPPL---YTIISGSEKILQGDYTFPPLSSLDVQ 828
            + +      +IR     YG   D+ +E   L      I  S   L  +       + D+ 
Sbjct: 742  ISRTEDKKEEIR---ESYG---DLERENSQLEEQIREIGRSRSELADEVIRLEEQNQDIN 795

Query: 829  SKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFER--------------SLKNQAHLNA 874
            S+ DS + +L          +A K ER     A                  L+N   +  
Sbjct: 796  SRLDSCHERL----------DAAKAEREEASRALSTVQLEASGLKQKDDFELENIRRVKE 845

Query: 875  EVERL----SGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIKELK 930
            +V RL    SGL+    DS   ++E   +++  K   E+      + IR+        L+
Sbjct: 846  DVRRLEEELSGLSGGTDDSNLIIEEKLAEIAGLKAQIEN------TVIRA------AGLE 893

Query: 931  SVIEADAKENPNPNKNQKKLQKTREKLVAQLS-------------SRLKELNIDNAYGLW 977
            SVI     E    ++ QK+L + RE+L  ++S              +L+E   ++A  +W
Sbjct: 894  SVIAEKTAEREEKSRQQKELFQKREELSDRMSRLDKDLFRLQSQKEKLEERLENSANYMW 953

Query: 978  NEYKEDFKASFEYPLGTYE--PAILGAMKDMDRLHPIYSVSKTIQKAGG-DPSLMMDYEK 1034
            +EY+  + A+ E   G  E  P I        R H I S+ + I+K G  + + + DY++
Sbjct: 954  DEYELTYSAALELKGGEEESLPEI--------RKH-IASLKEEIKKLGNVNVNAIEDYKE 1004

Query: 1035 VEPSDV-MAGLPDDLAKRFKALL 1056
            V    V M    DDL    + LL
Sbjct: 1005 VSERYVFMKTQHDDLVTAEETLL 1027


>gi|229595993|ref|XP_001013840.2| hypothetical protein TTHERM_00427610 [Tetrahymena thermophila]
 gi|225565664|gb|EAR93595.2| hypothetical protein TTHERM_00427610 [Tetrahymena thermophila SB210]
          Length = 2471

 Score = 40.9 bits (94), Expect = 1.7,   Method: Composition-based stats.
 Identities = 51/243 (20%), Positives = 100/243 (41%), Gaps = 38/243 (15%)

Query: 1    MNELATSIDYQTNNLDQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYI 60
            +N++ + ID +     Q     EDV K + ++  N K++ E++  W+   N    +Y  +
Sbjct: 1625 LNQINSLIDQEMKQCFQCDFLEEDVVKRINNVYLNSKYIDEYLSQWNQGKNHIDKKYVEL 1684

Query: 61   VGPIEQRLKKVSERYE---RVVSRDLTLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSD 117
                 Q +K++ E+++   RV ++D+ L+ E  L ++  +  T                 
Sbjct: 1685 -----QFIKQIKEQFQEPLRVENQDINLITEY-LSNMNRISQTYI--------------- 1723

Query: 118  RLLCRFMDMVETEDEHKINKQVRDALESAGFDLESTQENIRKV---ESALINNNMKDAFR 174
                 +M  V+ E +  INK + +   S G  LE  Q  + K    +  + +N     F+
Sbjct: 1724 -----YMQQVKKECDKNINKVLLNYKNSNG-SLEKLQILLSKTKYGDQIMQSNPFFKGFQ 1777

Query: 175  FLELAQKSKETADSHIIEAIDVGTKLKENTPPTTFTSIS----KVLLKSNNMQDVVFTKI 230
                  + +      +IE I  G   K  T     T ++    + L+K N+ Q+   TK 
Sbjct: 1778 ISNTNLRIQRFGIDEVIEQIK-GYSGKSKTNDLNKTQLNDYYQRFLIKYNSYQEKYLTKF 1836

Query: 231  KEV 233
             ++
Sbjct: 1837 DKI 1839


>gi|4325130|gb|AAD17276.1| dMi-2 protein [Drosophila melanogaster]
          Length = 1982

 Score = 40.9 bits (94), Expect = 1.7,   Method: Composition-based stats.
 Identities = 18/68 (26%), Positives = 37/68 (54%)

Query: 401  EEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHS 460
            E+K +  ++ K+K   EK++ + +++A+ +K   D++++ P++    D       V T  
Sbjct: 1572 EDKDKDSEKEKDKTSAEKSEVKQEQEAEEDKKPGDVKQENPVEEAAGDTKPSDAEVKTEV 1631

Query: 461  VKLPPKEE 468
             K  PKEE
Sbjct: 1632 AKTEPKEE 1639


>gi|2645435|gb|AAB87384.1| CHD3 [Drosophila melanogaster]
          Length = 1518

 Score = 40.9 bits (94), Expect = 1.7,   Method: Composition-based stats.
 Identities = 18/68 (26%), Positives = 37/68 (54%)

Query: 401  EEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHS 460
            E+K +  ++ K+K   EK++ + +++A+ +K   D++++ P++    D       V T  
Sbjct: 1108 EDKDKDSEKEKDKTSAEKSEVKQEQEAEEDKKPGDVKQENPVEEAAGDTKPSDAEVKTEV 1167

Query: 461  VKLPPKEE 468
             K  PKEE
Sbjct: 1168 AKTEPKEE 1175


>gi|21064287|gb|AAM29373.1| LD32039p [Drosophila melanogaster]
          Length = 789

 Score = 40.9 bits (94), Expect = 1.7,   Method: Composition-based stats.
 Identities = 18/68 (26%), Positives = 37/68 (54%)

Query: 401 EEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHS 460
           E+K +  ++ K+K   EK++ + +++A+ +K   D++++ P++    D       V T  
Sbjct: 379 EDKDKDSEKEKDKTSAEKSEVKQEQEAEEDKKPGDVKQENPVEEAAGDTKPSDAEVKTEV 438

Query: 461 VKLPPKEE 468
            K  PKEE
Sbjct: 439 AKTEPKEE 446


>gi|62472261|ref|NP_001014591.1| Mi-2, isoform B [Drosophila melanogaster]
 gi|61678453|gb|AAX52739.1| Mi-2, isoform B [Drosophila melanogaster]
          Length = 1983

 Score = 40.9 bits (94), Expect = 1.7,   Method: Composition-based stats.
 Identities = 18/68 (26%), Positives = 37/68 (54%)

Query: 401  EEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHS 460
            E+K +  ++ K+K   EK++ + +++A+ +K   D++++ P++    D       V T  
Sbjct: 1573 EDKDKDSEKEKDKTSAEKSEVKQEQEAEEDKKPGDVKQENPVEEAAGDTKPSDAEVKTEV 1632

Query: 461  VKLPPKEE 468
             K  PKEE
Sbjct: 1633 AKTEPKEE 1640


>gi|21281813|ref|NP_644899.1| immunoglobulin G binding protein A precursor [Staphylococcus aureus
           subsp. aureus MW2]
 gi|49484988|ref|YP_042209.1| immunoglobulin G binding protein A precursor [Staphylococcus aureus
           subsp. aureus MSSA476]
 gi|21203248|dbj|BAB93949.1| IMMUNOGLOBULIN G BINDING PROTEIN A PRECURSOR [Staphylococcus aureus
           subsp. aureus MW2]
 gi|49243431|emb|CAG41852.1| immunoglobulin G binding protein A precursor [Staphylococcus aureus
           subsp. aureus MSSA476]
          Length = 492

 Score = 40.9 bits (94), Expect = 1.7,   Method: Composition-based stats.
 Identities = 57/227 (25%), Positives = 84/227 (37%), Gaps = 37/227 (16%)

Query: 341 QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSE--------LKQAT 392
           + K+L D A   KAD         N+F  E + A+  I ++ N T E        LK   
Sbjct: 258 EAKKLND-AQAPKAD---------NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDP 307

Query: 393 VLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKT--PIKAEGDDFG 450
            +++    E K+  + +A ++ D  K  KE   K  +E  +K  +E    P K +G+  G
Sbjct: 308 SVSKEILAEAKKLNDAQAPKEEDNNKPGKEDGNKPGKEDGNKPGKEDNNKPGKEDGNKPG 367

Query: 451 LGLPSVPTHSVKLPPKEEELEEVK-DEGKKGKE---------PGTTETDDREETERKNQD 500
                      K P KE+  +  K D  K GKE         PG T  D  +        
Sbjct: 368 -------KEDNKKPGKEDGNKPGKEDNNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADK 420

Query: 501 ILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPL 547
           I  ++ LA K   K     +   K P   A        P+   E P 
Sbjct: 421 IAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEENPF 467


>gi|24667055|ref|NP_649154.2| Mi-2, isoform A [Drosophila melanogaster]
 gi|281366478|ref|NP_001163476.1| Mi-2, isoform C [Drosophila melanogaster]
 gi|13124018|sp|O97159|CHDM_DROME RecName: Full=Chromodomain-helicase-DNA-binding protein Mi-2 homolog;
            AltName: Full=ATP-dependent helicase Mi-2; Short=dMi-2
 gi|23093096|gb|AAF49099.2| Mi-2, isoform A [Drosophila melanogaster]
 gi|272455249|gb|ACZ94747.1| Mi-2, isoform C [Drosophila melanogaster]
          Length = 1982

 Score = 40.9 bits (94), Expect = 1.7,   Method: Composition-based stats.
 Identities = 18/68 (26%), Positives = 37/68 (54%)

Query: 401  EEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHS 460
            E+K +  ++ K+K   EK++ + +++A+ +K   D++++ P++    D       V T  
Sbjct: 1572 EDKDKDSEKEKDKTSAEKSEVKQEQEAEEDKKPGDVKQENPVEEAAGDTKPSDAEVKTEV 1631

Query: 461  VKLPPKEE 468
             K  PKEE
Sbjct: 1632 AKTEPKEE 1639


>gi|253316274|ref|ZP_04839487.1| cell wall anchor domain-containing protein [Staphylococcus aureus
           subsp. aureus str. CF-Marseille]
 gi|312828628|emb|CBX33470.1| LPXTG-motif cell wall anchor domain protein [Staphylococcus aureus
           subsp. aureus ECT-R 2]
 gi|315129091|gb|EFT85087.1| LPXTG-motif cell wall anchor domain [Staphylococcus aureus subsp.
           aureus CGS03]
          Length = 508

 Score = 40.9 bits (94), Expect = 1.7,   Method: Composition-based stats.
 Identities = 51/212 (24%), Positives = 80/212 (37%), Gaps = 29/212 (13%)

Query: 365 NRFKAETRLAYSTIANVANFTSE--------LKQATVLARANAQEEKQRREQEAKEKADR 416
           N+F  E + A+  I ++ N T E        LK    +++    E K+  + +A ++ D 
Sbjct: 272 NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDN 331

Query: 417 EKADKEAKEKADREKADKDLQE--KTPIKAEGDDFGLGLPSVP-THSVKLPPKEEELEEV 473
           +K  KE   K  +E  +K  +E  K P K +G+  G    + P       P KE+  +  
Sbjct: 332 KKPGKEDGNKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDNNKPGKEDGNKPGKEDNNKPG 391

Query: 474 KDEGKK-GKE-----------------PGTTETDDREETERKNQDILDNSLLAGKTHTKN 515
           K++G K GKE                 PG T  D  +        I  ++ LA K   K 
Sbjct: 392 KEDGNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIKP 451

Query: 516 ETPAIPTAKAPPAQAHKGIQDKKPQDQREKPL 547
               +   K P   A        P+   E P 
Sbjct: 452 GQELVVDKKQPANHADANKAQALPETGEENPF 483


>gi|83682309|emb|CAJ28144.1| immunoglobulin G binding protein A precursor [Staphylococcus
           aureus]
          Length = 401

 Score = 40.9 bits (94), Expect = 1.7,   Method: Composition-based stats.
 Identities = 56/237 (23%), Positives = 88/237 (37%), Gaps = 29/237 (12%)

Query: 340 DQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSE--------LKQA 391
           D   Q  +L S+ K        +  N+F  E + A+  I ++ N T E        LK  
Sbjct: 162 DDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDD 221

Query: 392 TVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQE--KTPIKAEGDDF 449
             +++    E K+  + +A ++ D +K  KE   K  +E  +K  +E  K P K +G+  
Sbjct: 222 PSVSKEILAEAKKLNDAQAPKEEDNKKPGKEDGNKPGKEDGNKPGKEDNKKPGKEDGNKP 281

Query: 450 GLGLPSVP-THSVKLPPKEEELEEVKDEGKK-GKE-----------------PGTTETDD 490
           G    + P       P KE+  +  K++G K GKE                 PG T  D 
Sbjct: 282 GKEDNNKPGKEDGNKPGKEDNNKPGKEDGNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDI 341

Query: 491 REETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPL 547
            +        I  ++ LA K   K     +   K P   A        P+   E P 
Sbjct: 342 AKANGTTADKIAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEENPF 398


>gi|198424745|ref|XP_002121874.1| PREDICTED: similar to leucine zipper-EF-hand containing
           transmembrane protein 1 [Ciona intestinalis]
          Length = 671

 Score = 40.5 bits (93), Expect = 1.7,   Method: Composition-based stats.
 Identities = 41/171 (23%), Positives = 83/171 (48%), Gaps = 26/171 (15%)

Query: 27  KTLTSIQDNIKHLREFIIAWSSDLNPH----KDRYDYIVGPIEQRLKKVSERYERVVSRD 82
           K L + + ++K L E ++ +  D+N      KD  D ++    +   ++ +R  +++ R 
Sbjct: 513 KILDAAKSDLKDLVEDVVEYQDDVNTLRSEVKDEEDGLISKDTKAGARIQKRIGKLIGRM 572

Query: 83  LTLVIEAGLKDLKEVGDTLKRLAETGEVI-----LSDKSDRLLCRFMDMVETEDEHKINK 137
             +V++   +D KEV D  +R  + GE++     L    +  LCR  D ++T+ + KIN 
Sbjct: 573 EQIVVDLEKED-KEVIDE-ERSVDVGEMMQAVHALQVIPEEKLCRIFDTLDTDKDGKIN- 629

Query: 138 QVRDALESAGFDLES-TQENIRKVESALINNNMKDAFRFLELAQKSKETAD 187
                +E AG  ++   +EN+      + ++ +++  + LE   K  ET D
Sbjct: 630 -----IEEAGNIIKVLNEENVE-----VTHHQLEEIVKLLE---KQTETPD 667


>gi|261365476|ref|ZP_05978359.1| putative cell division protein FtsN [Neisseria mucosa ATCC 25996]
 gi|288566006|gb|EFC87566.1| putative cell division protein FtsN [Neisseria mucosa ATCC 25996]
          Length = 365

 Score = 40.5 bits (93), Expect = 1.7,   Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 35/43 (81%), Gaps = 2/43 (4%)

Query: 399 AQEEKQRREQEAKEKADREKADKEA--KEKADREKADKDLQEK 439
           A +EK+R E+EA+EKAD+ KADKE   KEKA++E+A ++ +++
Sbjct: 102 AAKEKERAEKEAQEKADKAKADKERADKEKAEKERAVREAEDE 144


>gi|71660950|ref|XP_817503.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gi|70882699|gb|EAN95652.1| hypothetical protein, conserved [Trypanosoma cruzi]
          Length = 1587

 Score = 40.5 bits (93), Expect = 1.7,   Method: Composition-based stats.
 Identities = 115/566 (20%), Positives = 228/566 (40%), Gaps = 76/566 (13%)

Query: 93   DLKEVGDTLKRLAETGEVILSDKSDRLLCRFMDMVETEDE--HKINKQVRDALESAGFDL 150
            + +E+   L+R+++  + + + + + L     + +E  DE  H + KQ+ DAL +     
Sbjct: 757  ECEELAKNLRRISDLLDALKTSEKEAL-----EGIEARDEEIHDLQKQLEDALNNQNVGA 811

Query: 151  ESTQENIRKVESALINNNMKDA--------------FRFLELAQKSKETADSHIIEAIDV 196
             + +   R+ E  +  N  K                 R LE   +     D+    A+D 
Sbjct: 812  RALELKERQNEELMEINQRKQKELNAHRQKRRTAHEARSLEPTLQLYTVKDAGPENALDP 871

Query: 197  GTKLKENTPPTTFTSISKVLLKSNNMQDVVFTKIKEVVKKHVNAELGHRKLRGLAFDHTY 256
               ++E     T    +  + +SN +Q    T  +++ +   + E  + +LR  A D+  
Sbjct: 872  EEIMREPLLSITMDEYTNQIQRSNQLQQENDTLRQQLQQLSDDMETINSQLREAAADNQN 931

Query: 257  FNDKLNQFLKEIKN---------HQKEYDESEKGSSKARYHAAYAHIYWDLANDWVNGRV 307
             +D+L    +EI            Q E  E+E   +K+  +A  A     L  +  N ++
Sbjct: 932  LSDQLRAKYEEIVKANNTIQSLYRQHETQENEL-QNKSIENAKQAEELEKLTIE--NEKL 988

Query: 308  GDKSDEWARTSTNIASWI-GRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHGNR 366
             D+ ++ A  +  +A  +  +    E L     D+++Q +   ++  AD    +     R
Sbjct: 989  ADELEKLATDNEKLADELEQKAAENERLA----DELEQ-KAAENERLADELEQKAAENER 1043

Query: 367  FKAETRLAYSTIANVANFTSELKQ--------ATVLARANAQEEKQRREQEAKEKADREK 418
               E        A       EL+Q        A  L +  A+ E+   E E K   +   
Sbjct: 1044 LADELE---QKAAENERLADELEQKAAENERLADELEQKTAENERLADELEQKAAENERL 1100

Query: 419  ADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGK 478
            AD+  ++ A+ E+   +L++KT   AE +     L      + +L    EELE+   E +
Sbjct: 1101 ADELEQKAAENERLADELEQKT---AENERLADELEQKAAENERLA---EELEQKAAENE 1154

Query: 479  KGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKK 538
            K         D+ E+   +N+ + D          + E  A    +       K  +++K
Sbjct: 1155 K-------LADELEQKAAENERLAD----------ELEQKAAENERLADELEQKAAENEK 1197

Query: 539  PQDQREKPLASDIGVG-ESDYAGIKLTKKEKEL-QEQEENLRVAEIIQQSRMQSEDLQEK 596
              D+ E+  A +  +  E +   ++  K   EL Q+  EN R+A+ ++Q   ++E L ++
Sbjct: 1198 LADELEQKAAENERLADELEQKAVENEKLADELEQKAAENERLADELEQKAAENERLADE 1257

Query: 597  AWDSYKEWKSLSPDEIKQRFQKYAKV 622
                  E + L+ DE++Q+  +  K+
Sbjct: 1258 LEQKAAENEKLA-DELEQKAAENEKL 1282


>gi|322794085|gb|EFZ17295.1| hypothetical protein SINV_14571 [Solenopsis invicta]
          Length = 4105

 Score = 40.5 bits (93), Expect = 1.8,   Method: Composition-based stats.
 Identities = 55/226 (24%), Positives = 112/226 (49%), Gaps = 21/226 (9%)

Query: 398  NAQEEKQRREQEAKEKADREKADKEAKEKAD---REKADKDLQEKTPIKAEGDDFGLGLP 454
            N ++E+ ++E +  E++D  +  KEA+++ +   +E+    +QEK  I    D++     
Sbjct: 3450 NGKKEQNKKEYKKIEESDSFEKHKEAEKRQEIKNQEEKIDTVQEKKKI----DEYK---R 3502

Query: 455  SVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLA----GK 510
                 S+K   K EE ++ KD GKK ++    +  D+ + E+K  DI DN+ L      K
Sbjct: 3503 VEEIRSIKEEAKNEETKKSKDIGKKEEQKEKKDETDKIKKEQK--DIKDNNKLKLIEQHK 3560

Query: 511  THTKNETPAIPTAKAPPAQAHKGIQDKKPQ-DQREKPLASDIGVGESDYAGIKLTKKEKE 569
               K E            +  + I+ +K +  Q+E    ++I   + D    K+ K++++
Sbjct: 3561 ERDKTEENQEKVLNELQQKKQESIKTEKIELIQKENNKETEIKEIKKDIEH-KILKEDEK 3619

Query: 570  LQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQR 615
            L ++++NL   E   Q+  Q+ED+ +K  +  K+ K    +E++++
Sbjct: 3620 LDKEQKNLEDRECTAQN--QNEDI-DKIKEENKKVKDQKTEELEKK 3662


>gi|315122894|ref|YP_004063383.1| hypothetical protein CKC_05750 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496296|gb|ADR52895.1| hypothetical protein CKC_05750 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 827

 Score = 40.5 bits (93), Expect = 1.8,   Method: Composition-based stats.
 Identities = 52/210 (24%), Positives = 89/210 (42%), Gaps = 41/210 (19%)

Query: 422 EAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGK 481
           +A+E   +E A ++ QE        +D GL LPS PT  +     +E L+    +G +G+
Sbjct: 575 KAEEVNPQEPALQETQE--------EDLGLALPSAPTAPIVFSKIQEPLQ----DGIEGQ 622

Query: 482 EPGTTETDDREETERK-NQDILDNSLLAGKTHTKNETPAIPTAKAP----PAQAHKGIQD 536
            P  TE   +EETE   ++D+  NS               PT+  P     AQA     +
Sbjct: 623 AP-ETEKQAKEETETNVSEDVYHNSY--------------PTSSTPMGELSAQA-----E 662

Query: 537 KKP---QDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDL 593
           K P   ++    PL +     E         K +KE QE+ + +  A+  +  +      
Sbjct: 663 KTPVLVEEANFTPL-TPAQKAEKKSEKKAEKKSDKEAQEEIDKIINAQYRRDVKANIARQ 721

Query: 594 QEKAWDSYKEWKSLSPDEIKQRFQKYAKVF 623
           + ++    + W  LS +EI ++F    ++F
Sbjct: 722 EARSKRDRERWSKLSKEEISKKFNLIYELF 751


>gi|261392927|emb|CAX50512.1| IgA-specific serine endopeptidase (IgA protease) [Neisseria
            meningitidis 8013]
          Length = 1552

 Score = 40.5 bits (93), Expect = 1.8,   Method: Composition-based stats.
 Identities = 55/227 (24%), Positives = 95/227 (41%), Gaps = 31/227 (13%)

Query: 389  KQATVLARANAQEEKQRRE--QEAKEKADREKADKEAK-----EKADREKADKDLQEKTP 441
            +Q     R +A+  KQ+ E  +EA+E A R+KA++E        + ++E+   +L  K  
Sbjct: 1026 RQQAEAERKSAELAKQKAEAEREARELATRQKAEQERSSAELARRHEKEREAAELSAKQK 1085

Query: 442  IKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDI 501
            ++AE +   L +      + +   +  EL   ++E +K  E    +   + ETERK  +I
Sbjct: 1086 VEAEREAQALAVRR-KAEAEEAKRQAAELARQQEEARKAAELAAKQ---KAETERKAAEI 1141

Query: 502  LDNSLLAGKTHT-----KNETPAIPTAKAPPAQAH-KGIQDKKPQDQREKPL---ASDIG 552
             +    A +        K E      A++ P + + + I  +   D   + L   A +  
Sbjct: 1142 AEQKAEAEREAAELAKQKAEEEGRQAAQSQPKRRNRRAIPPELSSDATTRALPRIARNSN 1201

Query: 553  VGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSED---LQEK 596
               SDY  I L   E E         V+E +  S  Q +D   L EK
Sbjct: 1202 PDASDYEEIPLDALEDE--------DVSESVDTSDKQPQDNTELHEK 1240


>gi|229132458|ref|ZP_04261311.1| Penicillin-binding protein, 1A [Bacillus cereus BDRD-ST196]
 gi|228651000|gb|EEL06982.1| Penicillin-binding protein, 1A [Bacillus cereus BDRD-ST196]
          Length = 911

 Score = 40.5 bits (93), Expect = 1.8,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 38/55 (69%), Gaps = 4/55 (7%)

Query: 396 RANAQEEKQRREQEAKEKADRE---KADKEAKEKADREKADKDLQEKTPIKAEGD 447
           +A  +E K++ ++EAK KAD E   KAD+EA++KA+ ++  ++  E TP  A+G+
Sbjct: 852 KAADEEAKKKADEEAKRKADEEAKRKADEEARKKAEEQQQQQNTGEDTP-HADGN 905


>gi|212543263|ref|XP_002151786.1| spindle-pole body protein (Pcp1), putative [Penicillium marneffei
           ATCC 18224]
 gi|210066693|gb|EEA20786.1| spindle-pole body protein (Pcp1), putative [Penicillium marneffei
           ATCC 18224]
          Length = 1242

 Score = 40.5 bits (93), Expect = 1.8,   Method: Composition-based stats.
 Identities = 60/242 (24%), Positives = 98/242 (40%), Gaps = 24/242 (9%)

Query: 386 SELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAE 445
           +ELK A +  +      K+   Q  ++        +E +EKA R +AD+ +Q +     E
Sbjct: 248 TELKVARITMQQEISRYKKGLHQAERDLEAYRLQLQELREKAKRRQADEAIQREMDYMRE 307

Query: 446 GDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDIL--- 502
                     + T   ++   +EEL  VKD+     E    E  D E T R+ + I+   
Sbjct: 308 ---------EIATREAQVNNLQEELRNVKDKDSDEVERLRDEIVDLETTLREKERIIDAK 358

Query: 503 DNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIK 562
           D  +   K     ++ A+   +A   +A +  Q  + QD  EK  A       +    I+
Sbjct: 359 DEEIEILKEDDGQDSNAVAELEAELDRARQ--QLAEFQDDLEKAKADAREANRNREQAIE 416

Query: 563 LTKKE----KELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQK 618
             +K     KELQ++  N   +     ++  S  L+E+A D  KE   L  DE     Q 
Sbjct: 417 QKEKAEENLKELQDEMANKSFS-----TKGLSRQLEERAEDLEKELNQLR-DEYNDLKQD 470

Query: 619 YA 620
           YA
Sbjct: 471 YA 472


>gi|121634498|ref|YP_974743.1| IgA1 protease [Neisseria meningitidis FAM18]
 gi|120866204|emb|CAM09944.1| IgA1 protease [Neisseria meningitidis FAM18]
 gi|316983676|gb|EFV62657.1| igA-specific serine endopeptidase [Neisseria meningitidis H44/76]
 gi|325131846|gb|EGC54546.1| IgA-specific serine endopeptidase [Neisseria meningitidis M6190]
 gi|325137896|gb|EGC60471.1| IgA-specific serine endopeptidase [Neisseria meningitidis ES14902]
 gi|325200614|gb|ADY96069.1| IgA-specific serine endopeptidase [Neisseria meningitidis H44/76]
          Length = 1568

 Score = 40.5 bits (93), Expect = 1.8,   Method: Composition-based stats.
 Identities = 55/227 (24%), Positives = 95/227 (41%), Gaps = 31/227 (13%)

Query: 389  KQATVLARANAQEEKQRRE--QEAKEKADREKADKEAK-----EKADREKADKDLQEKTP 441
            +Q     R +A+  KQ+ E  +EA+E A R+KA++E        + ++E+   +L  K  
Sbjct: 1026 RQQAEAERKSAELAKQKAEAEREARELATRQKAEQERSSAELARRHEKEREAAELSAKQK 1085

Query: 442  IKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDI 501
            ++AE +   L +      + +   +  EL   ++E +K  E    +   + ETERK  +I
Sbjct: 1086 VEAEREAQALAVRR-KAEAEEAKRQAAELARQQEEARKAAELAAKQ---KAETERKAAEI 1141

Query: 502  LDNSLLAGKTHT-----KNETPAIPTAKAPPAQAH-KGIQDKKPQDQREKPL---ASDIG 552
             +    A +        K E      A++ P + + + I  +   D   + L   A +  
Sbjct: 1142 AEQKAEAEREAAELAKQKAEEEGRQAAQSQPKRRNRRAIPPELSSDATTRALPRIARNSN 1201

Query: 553  VGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSED---LQEK 596
               SDY  I L   E E         V+E +  S  Q +D   L EK
Sbjct: 1202 PDASDYEEIPLDALEDE--------DVSESVDTSDKQPQDNTELHEK 1240


>gi|73966001|ref|XP_537645.2| PREDICTED: similar to SWI/SNF-related matrix-associated
           actin-dependent regulator of chromatin e1 isoform 1
           [Canis familiaris]
          Length = 435

 Score = 40.5 bits (93), Expect = 1.8,   Method: Composition-based stats.
 Identities = 43/199 (21%), Positives = 83/199 (41%), Gaps = 31/199 (15%)

Query: 351 KVKADYHWAEIRH---GNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRRE 407
           K++A+    E RH     +F   T    + +  +     E+    + A     EE+ R+ 
Sbjct: 264 KLEAELLQIEERHQEKKRKFLESTDSFNNELKRLCGLKVEVDMEKIAAEIAQAEEQARKR 323

Query: 408 QEAKEKADREKADK-EAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPK 466
           QE +EK   E+A++ ++    + E A    QEK       DD           S+ +  +
Sbjct: 324 QEEREKEAAEQAERSQSSMVPEEEPAASKTQEKK------DD----------ESIPMETE 367

Query: 467 EEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAP 526
           E  LEE  +  + G+E GT+  +D+E  +     + +       T +++ +    T + P
Sbjct: 368 ETHLEEATESQQNGEE-GTSTPEDKESGQEGVDSMAEEGTSDSNTGSESNS---ATVEEP 423

Query: 527 PAQAHKGIQDKKPQDQREK 545
           P        D  P+D++++
Sbjct: 424 PT-------DPTPEDEKKE 435


>gi|262215904|gb|ACY36944.1| tenectin isoform 2 [Drosophila melanogaster]
 gi|262215906|gb|ACY36945.1| tenectin isoform 1 [Drosophila melanogaster]
          Length = 2819

 Score = 40.5 bits (93), Expect = 1.8,   Method: Composition-based stats.
 Identities = 33/125 (26%), Positives = 54/125 (43%), Gaps = 9/125 (7%)

Query: 399 AQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPT 458
           A+E     E++ K  A  E+ + EAK  +    +D+  QE  P +  GD+  L L     
Sbjct: 508 AEEGSGEEEKDVKVTAAPEETEDEAKPTSAPVASDEKEQEPKPSEGSGDE-ELDLKPTTA 566

Query: 459 HSVKLPPKEEELEEVKDEGKKGKEPGTTE-------TDDREETERKNQDILDNSLLAGKT 511
            +       EE EE +DEGK  + P + +       T+  EE   + +D+   +  AG+ 
Sbjct: 567 PTAGATSASEESEE-QDEGKSTEAPTSVDDIEPAKPTESSEEASGEGEDVAKETTPAGEA 625

Query: 512 HTKNE 516
               E
Sbjct: 626 SIAGE 630


>gi|327268361|ref|XP_003218966.1| PREDICTED: x-linked retinitis pigmentosa GTPase regulator-like
           [Anolis carolinensis]
          Length = 788

 Score = 40.5 bits (93), Expect = 1.8,   Method: Composition-based stats.
 Identities = 44/192 (22%), Positives = 86/192 (44%), Gaps = 18/192 (9%)

Query: 394 LARANAQEEKQ-RREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFG-L 451
           ++RAN  E +   RE+EA+   D E  DK+ +     E + +D  ++   +  GD    L
Sbjct: 452 ISRANHSESQTAEREKEAESAFDYETGDKKEENSGTDESSTEDDSDENEGRTLGDTTDVL 511

Query: 452 GLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKT 511
            +    TH ++L P ++ LE    +    K+   T  ++   +  + +++  N   A K 
Sbjct: 512 NM----THVMRLNPSDQTLELAPIQ----KDKNQTSEEEESGSSGEEEEVDSNEKEADK- 562

Query: 512 HTKNETPAIPTAKAPPAQA---HKGIQDKKPQDQREKPLASDIGVGESDYAG----IKLT 564
           H  +E  A+      P  A   +K ++ +K      + L  +I   E + AG     +  
Sbjct: 563 HKGDEQDAVEHDNQAPENAGHSNKSLKSEKENQMAIETLEDEILSDEEEIAGGGDKGEYD 622

Query: 565 KKEKELQEQEEN 576
           KKE +++E++ +
Sbjct: 623 KKEDKVKEEQNS 634


>gi|118092092|ref|XP_421324.2| PREDICTED: similar to Golgi-associated microtubule-binding protein
            [Gallus gallus]
          Length = 1975

 Score = 40.5 bits (93), Expect = 1.8,   Method: Composition-based stats.
 Identities = 92/448 (20%), Positives = 185/448 (41%), Gaps = 67/448 (14%)

Query: 88   EAGLKDLKEVGDTLKRLAETGEVILSDKSDRLLCRFMDMVETEDEHKINKQVRDALESAG 147
            ++ ++ ++E  D L++     ++++  KSD+LL    ++   E+E+++ KQ    L+   
Sbjct: 1389 DSEMRQIREKHDVLQKSLREKDILIKSKSDQLLSVSENLSNKENENELLKQAVTNLKERN 1448

Query: 148  FDLESTQENIRKV----ESALINNNMKDA-FRFLE-------LAQKSKETADSHIIEAID 195
              LE    +IRK+    E  ++    K+  FR L+       +  K KE     + E   
Sbjct: 1449 LILEM---DIRKLKEENEKIVVRCREKETEFRALQETNMQFSMMLKEKEFESHSMKEKAL 1505

Query: 196  VGTKLKENTPPTTFTSISKVLLKSNNMQDVVFTKIKEVVKKHVNAELGHRKLRGLAF--- 252
               KL +         ++++L +  +MQ+   T  +E  +  V   L  +++   A    
Sbjct: 1506 AFEKLLKEKEQGKTGELNQLLNEVKSMQEKAVTFQQE--RDQVMVALKQKQMESSALQSE 1563

Query: 253  -DHTYFND-KLNQFLKEIKNHQKEYDESEKGSSKARYHAAYAHIYWDLANDWVNGRVGDK 310
              H +  + +LNQ L+ ++NH  E ++S    + A                 +  +V   
Sbjct: 1564 IQHLHEKEQRLNQELERLRNHLIEMEDSYTREALAAEDRETK----------LRKKVSIL 1613

Query: 311  SDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKAE 370
             ++   +ST + +             +  + +++  +L SK + +               
Sbjct: 1614 EEKLVSSSTAVEN-------ASHQANLQVESLQEQLNLVSKQRDE--------------- 1651

Query: 371  TRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADRE 430
                  T+  +A    ++KQ   L+  N Q   ++ +QE K     E  +K  KE A+ +
Sbjct: 1652 ------TVLQLAISQDQVKQ-YALSLTNLQMVLEQFQQEEKAMYSAE-LEKHQKETAEWK 1703

Query: 431  KADKDLQEKT-PIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETD 489
            K  K+L+EK   ++   ++    L +    + +L  KEE++EE+K EG+  +E      +
Sbjct: 1704 KKAKNLEEKVISLQENLEEANAALDAASRLTEQLDVKEEQIEELKKEGEIRREMLEDVQN 1763

Query: 490  DR----EETERKNQDILDNSLLAGKTHT 513
                    TE K   +L  +L  G  HT
Sbjct: 1764 KLMNLINSTEGKVDKLLMRNLFIGHFHT 1791


>gi|8163668|gb|AAF73792.1|AF154023_1 surface protein PspC [Streptococcus pneumoniae]
          Length = 695

 Score = 40.5 bits (93), Expect = 1.8,   Method: Composition-based stats.
 Identities = 40/192 (20%), Positives = 83/192 (43%), Gaps = 6/192 (3%)

Query: 387 ELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEG 446
           E KQA        + ++++ E EAK +AD ++ D+ +K +  R K     ++ TP K E 
Sbjct: 253 ESKQAEATRLKKIKTDREKAEGEAKRRADAKEQDESSKRRKSRVKRGDLGEQATPDKKEN 312

Query: 447 D----DFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDIL 502
           D    D  +G  ++P+ S+K  P+++  E  K   +  K+    + +DR          L
Sbjct: 313 DAKSSDSSVGEETLPSPSLK--PEKKVAEAEKKVAEAKKKAEDQKEEDRRNYPTNTYKTL 370

Query: 503 DNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIK 562
           +  +       K     +   +A   +  + ++  K + + +K  A+ +   ++D    +
Sbjct: 371 ELEIAESDVEVKEAELELVKEEAKEPRNEEKVKQAKAEVESKKAEATRLEKIKTDRKKAE 430

Query: 563 LTKKEKELQEQE 574
              K K  +E +
Sbjct: 431 EEAKRKAAEEDK 442



 Score = 38.5 bits (88), Expect = 7.4,   Method: Composition-based stats.
 Identities = 62/281 (22%), Positives = 119/281 (42%), Gaps = 65/281 (23%)

Query: 368 KAETRLAYSTIA------NVANFTSELKQATV-LARANAQE---EKQRREQEAKEKADRE 417
           K E R  Y TI        +A    E+K+A + L +  A E   E++ ++ EA+ ++ + 
Sbjct: 198 KEEDRRNYPTITYKTLELEIAESDVEVKKAELELVKVKANEPRDEEKIKQAEAEVESKQA 257

Query: 418 KADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEG 477
           +A +  K K DREKA+ + + +   K +                     +E  +  K   
Sbjct: 258 EATRLKKIKTDREKAEGEAKRRADAKEQ---------------------DESSKRRKSRV 296

Query: 478 KKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAK---------APPA 528
           K+G + G   T D++E + K+ D          +    ET   P+ K            A
Sbjct: 297 KRG-DLGEQATPDKKENDAKSSD----------SSVGEETLPSPSLKPEKKVAEAEKKVA 345

Query: 529 QAHKGIQDKKPQDQREKPLAS----DIGVGESDY----AGIKLTKKEKELQEQEENLRVA 580
           +A K  +D+K +D+R  P  +    ++ + ESD     A ++L K+E +    EE ++ A
Sbjct: 346 EAKKKAEDQKEEDRRNYPTNTYKTLELEIAESDVEVKEAELELVKEEAKEPRNEEKVKQA 405

Query: 581 EI------IQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQR 615
           +        + +R++      K  +   + K+   D++K++
Sbjct: 406 KAEVESKKAEATRLEKIKTDRKKAEEEAKRKAAEEDKVKEK 446


>gi|68533611|gb|AAH98606.1| Sb:cb152 protein [Danio rerio]
          Length = 1003

 Score = 40.5 bits (93), Expect = 1.9,   Method: Composition-based stats.
 Identities = 37/147 (25%), Positives = 63/147 (42%), Gaps = 19/147 (12%)

Query: 385 TSELKQATVLARANAQEEKQRREQEAKEKADR-------------------EKADKEAKE 425
           T+E  +       +  E  QR ++  +E+A+R                   E A KEAK 
Sbjct: 535 TTEFMELFSNMEKDYSERLQREKEIVEERAERRLEILKNLVNRTIEEMTTDENAAKEAKM 594

Query: 426 KADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGT 485
           +      +    + T IK + +   L L +VP    KL     ELEE+K E  K ++  +
Sbjct: 595 ELLDTMIEAMRSDLTKIKGDAESVQLCLANVPESPGKLSHLRTELEEIKAELLKSQQQLS 654

Query: 486 TETDDREETERKNQDILDNSLLAGKTH 512
            ++ + EE+  + QD+ D  L A + +
Sbjct: 655 LKSKEFEESCIQMQDLNDQLLQATRNY 681


>gi|74184809|dbj|BAE27998.1| unnamed protein product [Mus musculus]
 gi|123242714|emb|CAM23189.1| myosin, heavy polypeptide 10, non-muscle [Mus musculus]
 gi|123261983|emb|CAM23376.1| myosin, heavy polypeptide 10, non-muscle [Mus musculus]
          Length = 2013

 Score = 40.5 bits (93), Expect = 1.9,   Method: Composition-based stats.
 Identities = 72/301 (23%), Positives = 124/301 (41%), Gaps = 73/301 (24%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   EVL  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 1013 AEAKIKKMEEEVLLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 1067

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQ--------PPLYTIISGSE 810
            K E  +SD+   L+K  KT  ++ + K +L G   D+ Q+Q          L   ++  E
Sbjct: 1068 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDL-QDQIAELQAQVDELKVQLTKKE 1126

Query: 811  KILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFER 864
            + LQG      D T    ++L V  +  +  ++L E F                    E+
Sbjct: 1127 EELQGALARGDDETLHKNNALKVARELQAQIAELQEDFES------------------EK 1168

Query: 865  SLKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFER 924
            + +N+A             +Q  D + +L+ L+T+L        +  E     +R++ E+
Sbjct: 1169 ASRNKAE------------KQKRDLSEELEALKTELEDTLDTTAAQQE-----LRTKREQ 1211

Query: 925  EIKELKSVIEADAKENPNPNKNQKKLQKTR-EKLVAQL--SSRLKELNIDNAYGLWNEYK 981
            E+ ELK  +E + K +    ++ ++   T  E+L  QL  + R K     N  GL  + K
Sbjct: 1212 EVAELKKALEDETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNK 1271

Query: 982  E 982
            E
Sbjct: 1272 E 1272


>gi|284054709|ref|ZP_06384919.1| hypothetical protein AplaP_24984 [Arthrospira platensis str.
           Paraca]
          Length = 1126

 Score = 40.5 bits (93), Expect = 1.9,   Method: Composition-based stats.
 Identities = 53/221 (23%), Positives = 98/221 (44%), Gaps = 23/221 (10%)

Query: 382 ANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTP 441
           A+ T EL  A     A ++ E   +E +   ++++ KA KE  ++   +K  KDL+E   
Sbjct: 53  ADKTKELLDAEDEEAAKSKGENLEKESDKTTESEQGKATKEESQEEATKK--KDLEEAKK 110

Query: 442 IKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEG-------KKG-KEPGTTETDDREE 493
           IKA+GD       +      +   +E++ E   ++G       ++G K+PG  E  D   
Sbjct: 111 IKAQGDAKAAEAEAEGEEKPEGEAEEQQKENSPEDGFLESVGTQEGLKDPGVVEAPDLSG 170

Query: 494 TERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGV 553
                    D +  A  T T++         A    +HK  QDK  + Q +  + ++  +
Sbjct: 171 KPAPRSPNADPAFQAAVTQTEH--------LAAEQSSHKPAQDKAREAQ-DASVDTEQQM 221

Query: 554 GESDYAGIKLTKKEKELQE--QEENL-RVAEIIQQSRMQSE 591
            E++ A        KE+QE  +EE +  +  I++Q++  S+
Sbjct: 222 REAE-ASQSEEASHKEVQEFNKEEFISNLLAILEQNKPDSQ 261


>gi|88812294|ref|ZP_01127545.1| hypothetical protein NB231_02803 [Nitrococcus mobilis Nb-231]
 gi|88790545|gb|EAR21661.1| hypothetical protein NB231_02803 [Nitrococcus mobilis Nb-231]
          Length = 1018

 Score = 40.5 bits (93), Expect = 1.9,   Method: Composition-based stats.
 Identities = 28/72 (38%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 362 RHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQR-REQ--EAKEKADREK 418
           R   R  AE   A    A       E + A+ +  ANA+ E+ R REQ  +A+++A+RE+
Sbjct: 302 REAERLAAELEQAQGVTAAAEAALEEERAASRMRMANAEAERDRLREQGEQAQQEAERER 361

Query: 419 ADKEAKEKADRE 430
           AD EAK KA  E
Sbjct: 362 ADLEAKLKASTE 373


>gi|307546310|ref|YP_003898789.1| cell division protein ZipA [Halomonas elongata DSM 2581]
 gi|307218334|emb|CBV43604.1| cell division protein ZipA [Halomonas elongata DSM 2581]
          Length = 519

 Score = 40.5 bits (93), Expect = 2.0,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 31/50 (62%)

Query: 379 ANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKAD 428
           +++  F S L++     R N ++E+ R+EQE  E+  RE+A++E + + D
Sbjct: 246 SSMQRFGSSLQKTLAERRDNKRQERARKEQERAERKQREQAEREEQARHD 295


>gi|183985668|gb|AAI66177.1| LOC100158525 protein [Xenopus (Silurana) tropicalis]
          Length = 1601

 Score = 40.5 bits (93), Expect = 2.0,   Method: Composition-based stats.
 Identities = 60/302 (19%), Positives = 121/302 (40%), Gaps = 66/302 (21%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   ++L  + Q S      F+KE       I   T +L +E+ K       + 
Sbjct: 986  AEAKIKKMEEDILVLEDQNS-----KFLKEKKLLEERIAESTSQLAEEEEKAKNLAKLKN 1040

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTIIS----------- 807
            K E  ++D+   L+K  KT  ++ + K +L G   D+  +   L   I            
Sbjct: 1041 KQEMMITDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIEELKLQLAKKEE 1100

Query: 808  --------GSEKILQGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTI 859
                    G E++LQ + T   +  L  Q                      ++E+     
Sbjct: 1101 ELQAALARGDEEVLQKNNTLKVVRELQAQIA-------------------ELQEDLESEK 1141

Query: 860  YAFERSLKNQAHLNAEVERLSGLAQQPSDSTADLKELQT-------QLSRAKKYKESNDE 912
             +  ++ K +  L+ E+E L    +   D+TA  +EL+T       +L ++ + +  N E
Sbjct: 1142 ASRNKAEKQKRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKSIEEETRNHE 1201

Query: 913  RIVSFIRSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKELNIDN 972
              +  +R      ++EL   +E   +   N  KN++ L+   ++L  ++ S L+++  ++
Sbjct: 1202 AQIQEMRQRQATALEELSEQLEQAKRFKGNLEKNKQSLESDNKELATEVKS-LQQMKAES 1260

Query: 973  AY 974
             Y
Sbjct: 1261 EY 1262


>gi|325911052|gb|ADZ45254.1| pneumococcal surface protein C [Streptococcus pneumoniae]
          Length = 681

 Score = 40.5 bits (93), Expect = 2.0,   Method: Composition-based stats.
 Identities = 56/235 (23%), Positives = 104/235 (44%), Gaps = 48/235 (20%)

Query: 381 VANFTSELKQATV-LARANAQEEKQR---REQEAKEKADREKADKEAKEKADREKADKDL 436
           +A    E+K+A + L +  A+E +     ++ EAK ++ + +A K  K K DREKA+++ 
Sbjct: 174 IAESDVEVKKAELELLKEEAKESRDEGTIKQAEAKVESKKAEATKLEKIKTDREKAEEEA 233

Query: 437 QEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETER 496
           + +        D  L   +V T            ++      K   PG   T D++E + 
Sbjct: 234 KRRA-------DAKLQEANVATSG----------QDKSKRRAKRAVPGEPATPDKKENDA 276

Query: 497 KNQDILDNSLLAGKTHTKNETPAIPTAK---------APPAQAHKGIQDKKPQDQREKPL 547
           K+ D          +    ET   P+ K             +A K  +D+K +D+R  P 
Sbjct: 277 KSSD----------SSVGEETLPSPSLKPEKKVAEAEKKVEEAEKKAKDQKEEDRRNYPT 326

Query: 548 AS----DIGVGESDYAGIKLTKKEKELQEQEEN-LRVAEIIQQSRMQSEDLQEKA 597
            +    ++ + ESD   +K+ + E EL ++E N  R  E ++Q++ + E  + +A
Sbjct: 327 NTYKTLELEIAESD---VKVKEAELELVKEEVNEPRNEEKVKQAKAEVESKKAEA 378


>gi|224538110|ref|ZP_03678649.1| hypothetical protein BACCELL_03001 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224520238|gb|EEF89343.1| hypothetical protein BACCELL_03001 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 618

 Score = 40.5 bits (93), Expect = 2.0,   Method: Composition-based stats.
 Identities = 49/242 (20%), Positives = 103/242 (42%), Gaps = 34/242 (14%)

Query: 566 KEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSP------DEIKQRFQKY 619
           K++ L E+ E L+ +   + +  +   LQ       KEWK++ P      D I +RF   
Sbjct: 383 KKRALCEKAEALKDSTDWKATADELTKLQ-------KEWKTIGPVAKKYSDAIWKRFISA 435

Query: 620 AKVFYRSYSPVDGSYKGTQ-----------ESDKAINHFLDNDFGYYRIHNFLSQWSPLG 668
              F+   +    S +  +           E   AI+  +D D     +   + +W+ +G
Sbjct: 436 CDYFFEQKNKATSSQRSVEIDNLNKKKEIIEKLGAIDENMDTDEATQLVRELMKEWNNIG 495

Query: 669 LM--YEKDELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGESSVRKHSFEVL 726
            +   EKD L+  +  + ++D LF H       N +A +      ++  SS+++ S + L
Sbjct: 496 HVPFKEKDRLY--KQYHGQVDKLFDH------FNISAANKKLSNFKSNISSIQEGSPQSL 547

Query: 727 SSKHQKSVIAVNNFIKEITHHTRRLVKEDPKRGKSESYLSDIRSELQKVNKTVMDIRIKL 786
             + +K V A +    E+  +   L        K  S L+++  +++K+   +  ++ K+
Sbjct: 548 YREREKLVRAADAMKNELQTYENNLGFLTASSKKGNSLLTELNRKVEKLKADIELVKQKI 607

Query: 787 RL 788
           ++
Sbjct: 608 KV 609


>gi|8163714|gb|AAF73817.1|AF154044_1 surface protein PspC [Streptococcus pneumoniae]
          Length = 681

 Score = 40.5 bits (93), Expect = 2.0,   Method: Composition-based stats.
 Identities = 56/235 (23%), Positives = 104/235 (44%), Gaps = 48/235 (20%)

Query: 381 VANFTSELKQATV-LARANAQEEKQR---REQEAKEKADREKADKEAKEKADREKADKDL 436
           +A    E+K+A + L +  A+E +     ++ EAK ++ + +A K  K K DREKA+++ 
Sbjct: 174 IAESDVEVKKAELELLKEEAKESRDEGTIKQAEAKVESKKAEATKLEKIKTDREKAEEEA 233

Query: 437 QEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETER 496
           + +        D  L   +V T            ++      K   PG   T D++E + 
Sbjct: 234 KRRA-------DAKLQEANVATSG----------QDKSKRRAKRAVPGEPATPDKKENDA 276

Query: 497 KNQDILDNSLLAGKTHTKNETPAIPTAK---------APPAQAHKGIQDKKPQDQREKPL 547
           K+ D          +    ET   P+ K             +A K  +D+K +D+R  P 
Sbjct: 277 KSSD----------SSVGEETLPSPSLKPEKKVAEAEKKVEEAEKKAKDQKEEDRRNYPT 326

Query: 548 AS----DIGVGESDYAGIKLTKKEKELQEQEEN-LRVAEIIQQSRMQSEDLQEKA 597
            +    ++ + ESD   +K+ + E EL ++E N  R  E ++Q++ + E  + +A
Sbjct: 327 NTYKTLELEIAESD---VKVKEAELELVKEEVNEPRNEEKVKQAKAEVESKKAEA 378


>gi|333023489|ref|ZP_08451553.1| hypothetical protein STTU_0993 [Streptomyces sp. Tu6071]
 gi|332743341|gb|EGJ73782.1| hypothetical protein STTU_0993 [Streptomyces sp. Tu6071]
          Length = 5731

 Score = 40.5 bits (93), Expect = 2.1,   Method: Composition-based stats.
 Identities = 51/260 (19%), Positives = 93/260 (35%), Gaps = 25/260 (9%)

Query: 308  GDKSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAE--IRHGN 365
            G   DEW R     A   G   R     G  Y + +   D     + +   A   + H  
Sbjct: 1314 GMSPDEWGRAMERHARGQGLDAREAARFGAAYREARMEGDARGWQRVEESVASRLLDHA- 1372

Query: 366  RFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKAD----REKADK 421
                E R+A  +    ++      +   ++ A A    ++ E+      D    RE+ D+
Sbjct: 1373 ---IEDRVANRSPEQWSDLVRRFAERHGMSSAEAGGWAKQAERAWAPGGDIARFRERFDQ 1429

Query: 422  EAKEKADREKADKDLQEKTPIKAEGDDF---GLGLPSVPTHSVKLPPKEEELEEVKDEGK 478
              +E A     D   +  +P+   G+D    G GLP++       P +     + +  G+
Sbjct: 1430 RVEELATARITDDTSRTPSPVATNGEDAGASGTGLPAIS------PERAGVEAQRRGGGE 1483

Query: 479  KGKEPGTTETDDR-----EETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKG 533
              +E  + E   R     EE   + +D  + +  +G          +P    P + A++ 
Sbjct: 1484 PAREEASREAPARAVPAPEEPTTRRRDTAEPATRSGAGPRGAVDDTVPATAKPASPAYEA 1543

Query: 534  IQD-KKPQDQREKPLASDIG 552
            +    KP   RE+P    +G
Sbjct: 1544 VPAVVKPAPGREEPADEPVG 1563


>gi|313241844|emb|CBY34054.1| unnamed protein product [Oikopleura dioica]
          Length = 1380

 Score = 40.5 bits (93), Expect = 2.1,   Method: Composition-based stats.
 Identities = 48/211 (22%), Positives = 97/211 (45%), Gaps = 15/211 (7%)

Query: 397 ANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSV 456
           + A+E K++ E+E K +A+ E+     +++ +      + Q +    AEG         +
Sbjct: 536 SQAEEVKKQLEKEKKRRAELEEQSVNLEQERNELTQKAEAQNELLDDAEGR-----CEEL 590

Query: 457 PTHSVKLPPKEEELEE-VKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTH--- 512
             + ++L  K  EL+E ++DE +   E    +    +E+    +DI D  L   K     
Sbjct: 591 IGNKIELDSKIRELQEKLEDEEEMNNELVAKKRKLEDESSELKKDIDDLELTLAKIEKEK 650

Query: 513 --TKNETPAIPTAKAPPAQA-HKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKE 569
             T+N++  +    A  +++ HK  ++KK   +  K    D+   E     + L+K + +
Sbjct: 651 HATENKSKNVTEELATISESIHKLEKEKKALQEAHKQTLGDLQSEEEKV--VNLSKSKGK 708

Query: 570 LQEQEENLRVA-EIIQQSRMQSEDLQEKAWD 599
           L++Q ++L +  E  ++SRM  E  + K  D
Sbjct: 709 LEQQVDDLEIGLEAEKKSRMDLERAKRKLED 739


>gi|282923772|ref|ZP_06331449.1| immunoglobulin G-binding protein A [Staphylococcus aureus A9765]
 gi|282593014|gb|EFB98015.1| immunoglobulin G-binding protein A [Staphylococcus aureus A9765]
          Length = 520

 Score = 40.5 bits (93), Expect = 2.1,   Method: Composition-based stats.
 Identities = 59/236 (25%), Positives = 87/236 (36%), Gaps = 39/236 (16%)

Query: 341 QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSE--------LKQAT 392
           + K+L D A   KAD         N+F  E + A+  I ++ N T E        LK   
Sbjct: 270 EAKKLND-AQAPKAD---------NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDP 319

Query: 393 VLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQE--KTPIKAEGDDFG 450
            +++    E K+  + +A ++ D  K  KE   K  +E   K  +E  K P K +G+  G
Sbjct: 320 SVSKEILAEAKKLNDAQAPKEEDNNKPGKEDNNKPGKEDNKKPGKEDNKKPGKEDGNKPG 379

Query: 451 LGLPSVP---------THSVKLPPKEEELEEVKDEGKK-GKE---------PGTTETDDR 491
                 P             K P KE+  +  K++G K GKE         PG T  D  
Sbjct: 380 KEDNKKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDIA 439

Query: 492 EETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPL 547
           +        I  ++ LA K   K     +   K P   A        P+   E P 
Sbjct: 440 KANGTTADKIAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEENPF 495


>gi|242786117|ref|XP_002480740.1| spindle-pole body protein (Pcp1), putative [Talaromyces stipitatus
           ATCC 10500]
 gi|218720887|gb|EED20306.1| spindle-pole body protein (Pcp1), putative [Talaromyces stipitatus
           ATCC 10500]
          Length = 1243

 Score = 40.5 bits (93), Expect = 2.1,   Method: Composition-based stats.
 Identities = 57/231 (24%), Positives = 88/231 (38%), Gaps = 27/231 (11%)

Query: 386 SELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAE 445
           +ELK A +  +      K+   Q  ++        +E +EKA R +AD+ +Q +     E
Sbjct: 248 TELKVARITMQQEISRYKKSLHQAERDLEAYRLQLQELREKAKRRQADEAIQREMDYMRE 307

Query: 446 GDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILD-- 503
                     + T   ++   +EEL  VKD+     E    E  D E T R+   I+D  
Sbjct: 308 ---------EIATREAQVNNLQEELRNVKDKDSDEVERLRDEIGDLEATLREKDRIIDAK 358

Query: 504 ----NSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQD---KKPQDQREKPLASDIGVGES 556
                SL   +    N    +        Q  +  QD   K   D RE     +  + + 
Sbjct: 359 DEEIESLKEDEGQNGNAVAELEAELDRARQQLEEFQDHIEKARSDAREANRNREQALQQK 418

Query: 557 DYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSL 607
           + A   L    KELQE+  N   +     ++  S  L+EKA D  KE   L
Sbjct: 419 EKAEENL----KELQEEMANKSFS-----TKGLSRQLEEKAEDLEKELNQL 460


>gi|294661251|ref|YP_003573127.1| hypothetical protein Aasi_1714 [Candidatus Amoebophilus asiaticus
           5a2]
 gi|227336402|gb|ACP20999.1| hypothetical protein Aasi_1714 [Candidatus Amoebophilus asiaticus
           5a2]
          Length = 891

 Score = 40.5 bits (93), Expect = 2.1,   Method: Composition-based stats.
 Identities = 58/237 (24%), Positives = 107/237 (45%), Gaps = 24/237 (10%)

Query: 259 DKLNQFLKEIKNHQKEYDESEKGSSKARYHAAYAHIYWDLANDWVNGRVGDKSDEWARTS 318
           D+ N   +E K  + E +++++ +  AR  +  A      A+D    +   +  E AR  
Sbjct: 548 DQANTASEEAKAARNEAEKAQQQAEAARDQSNTASGDAKTASD--EAKKAQQQAEAARDQ 605

Query: 319 TNIASWIGRITRTEGLGGVTYDQIKQLRDLASK-----VKADYHWAEIRHGNRFKAETRL 373
            N AS   +  R E        Q +  RD A+      +KA     +     +  AET  
Sbjct: 606 ANTASEETKAARNEAEKA--QQQAEAARDQANTASEEAIKAQEATEKATKQAKDDAETAT 663

Query: 374 AYSTIANVA--------NFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKE 425
             +T AN A        N   E +QA       A ++ ++ +++A+EKA +++A K AKE
Sbjct: 664 NAATQANTASEEAKTARNEAIEAQQAAEKEATKAMKQVEQIKKKAQEKAQQKQAKKLAKE 723

Query: 426 KADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKE 482
           +  R+KA+++  E+   +A+       +  V   ++K+  KE   ++V+D  ++ KE
Sbjct: 724 ETARKKAEQEAIEEDKKQAD------LVAKVKEEAIKV-AKEAVKKQVEDATEQAKE 773


>gi|319651950|ref|ZP_08006072.1| DNA-binding ferritin-like protein [Bacillus sp. 2_A_57_CT2]
 gi|317396349|gb|EFV77065.1| DNA-binding ferritin-like protein [Bacillus sp. 2_A_57_CT2]
          Length = 145

 Score = 40.5 bits (93), Expect = 2.1,   Method: Composition-based stats.
 Identities = 25/86 (29%), Positives = 45/86 (52%), Gaps = 5/86 (5%)

Query: 851 IKEERYWTIYAFERSLKNQA--HLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKE 908
           IK   ++T++A    L N+A  H++   ER+  L  +P    A +KE+    S  +   +
Sbjct: 30  IKGRNFFTLHAKFEELYNEANVHVDELAERILALEAKP---VATMKEVLETSSLEEATGK 86

Query: 909 SNDERIVSFIRSEFEREIKELKSVIE 934
            N+E +V  +  +FE+ + EL+  IE
Sbjct: 87  ENEEEMVQSVVDDFEKMVDELQEAIE 112


>gi|115873145|ref|XP_788216.2| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
 gi|115945709|ref|XP_001180515.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
          Length = 558

 Score = 40.5 bits (93), Expect = 2.1,   Method: Composition-based stats.
 Identities = 56/214 (26%), Positives = 96/214 (44%), Gaps = 7/214 (3%)

Query: 387 ELKQATVLARANAQEEKQRREQEAKEKADRE-KADKEAKEKADREKADKDLQEKTPIKAE 445
           E K  +VL R  +  +KQ   +E   K + E K   E KE+  R+K DK+L E   ++ E
Sbjct: 156 ENKGESVLDRLKSTVKKQEEVEEKNAKLEVEYKTRVEEKEEELRQK-DKELLEHKRLQEE 214

Query: 446 GDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQ-DILDN 504
             +    L  +      L   ++E+EEV +E  K KE    E   ++  E K++ + +D 
Sbjct: 215 ALETQKRL--LEEKEEALAKMKQEMEEVFEEQVKEKETALMEQLKQQREELKHEKEKVDT 272

Query: 505 SLLA-GKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKL 563
           SL    K   + +       +    +  + I++K+ Q   +        + E      KL
Sbjct: 273 SLQEFSKQLAEKDRSMKEEQEEMQRKLEESIREKEAQMLAQLEAEKQAVIEEKQKVEEKL 332

Query: 564 -TKKEKELQEQEENLRVAEIIQQSRMQSEDLQEK 596
            T  EK+   +EE  R+ EIIQQ   +  D++++
Sbjct: 333 QTALEKDKGLEEEKQRLDEIIQQKEKEKTDMEDE 366


>gi|261335747|emb|CBH18741.1| hypothetical protein, conserved [Trypanosoma brucei gambiense
           DAL972]
          Length = 675

 Score = 40.5 bits (93), Expect = 2.2,   Method: Composition-based stats.
 Identities = 30/101 (29%), Positives = 49/101 (48%), Gaps = 9/101 (8%)

Query: 877 ERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERI---------VSFIRSEFEREIK 927
           ++LSG+A   S    +LKEL+ QLS     K S ++ +         V+  +S  E+E+K
Sbjct: 76  KQLSGVADSKSSLEKELKELRKQLSDVTGSKSSLEKELKELRKQLSDVTGSKSSIEKELK 135

Query: 928 ELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL 968
           EL+  +        +  K  K+L+K    +V   SS  KE+
Sbjct: 136 ELRKQLSDVTGSKSSLEKELKELRKQPSDVVGSKSSLEKEM 176


>gi|52783138|sp|Q80YF0|MD1L1_CRIGR RecName: Full=Mitotic spindle assembly checkpoint protein MAD1;
           AltName: Full=Mitotic arrest deficient 1-like protein 1;
           Short=MAD1-like protein 1
 gi|29725736|gb|AAO91656.1| mitotic checkpoint protein [Cricetulus griseus]
          Length = 717

 Score = 40.5 bits (93), Expect = 2.2,   Method: Composition-based stats.
 Identities = 29/100 (29%), Positives = 56/100 (56%), Gaps = 8/100 (8%)

Query: 401 EEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHS 460
           E +QR+ QEA +K    +A +E  E+AD E+  KDL++K  ++ +       + ++ +  
Sbjct: 195 ELQQRKCQEASQKIQELQASQE--ERADHEQKIKDLEQKLCLQEQDAAV---VKNMKSEL 249

Query: 461 VKLPPKEEELEEVKDEG---KKGKEPGTTETDDREETERK 497
           ++LP  E EL+ +++E    ++ KE     T++ E  +RK
Sbjct: 250 LRLPRMERELKRLREENTHLREMKETNGLLTEELEGLQRK 289


>gi|282912350|ref|ZP_06320146.1| immunoglobulin G binding protein A [Staphylococcus aureus subsp.
           aureus WBG10049]
 gi|282324046|gb|EFB54362.1| immunoglobulin G binding protein A [Staphylococcus aureus subsp.
           aureus WBG10049]
 gi|312436777|gb|ADQ75848.1| immunoglobulin G binding protein A [Staphylococcus aureus subsp.
           aureus TCH60]
          Length = 504

 Score = 40.5 bits (93), Expect = 2.2,   Method: Composition-based stats.
 Identities = 54/220 (24%), Positives = 83/220 (37%), Gaps = 23/220 (10%)

Query: 341 QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQ 400
           + K+L D A   KAD         N+F  E + A+  I ++ N T E +   + +  +  
Sbjct: 270 EAKKLND-AQAPKAD---------NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDP 319

Query: 401 EEKQRREQEAKEKADREKADKEAKEKADREKADKDLQE--KTPIKAEGDDFGLGLPSVP- 457
              +    EAK+  D +   +E   K  +E  +K  +E  K P K +G+  G      P 
Sbjct: 320 SVSKEILAEAKKLNDAQAPKEEDNNKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDNKKPG 379

Query: 458 THSVKLPPKEEELEEVKDEGKK-GKE---------PGTTETDDREETERKNQDILDNSLL 507
                 P KE+  +  K++G K GKE         PG T  D  +        I  ++ L
Sbjct: 380 KEDGNKPGKEDGNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADKIAADNKL 439

Query: 508 AGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPL 547
           A K   K     +   K P   A        P+   E P 
Sbjct: 440 ADKNMIKPGQELVVDKKQPANHADANKAQALPETGEENPF 479


>gi|77359943|ref|YP_339518.1| translation initiation factor IF-2 [Pseudoalteromonas haloplanktis
           TAC125]
 gi|90101372|sp|Q3IJ53|IF2_PSEHT RecName: Full=Translation initiation factor IF-2
 gi|76874854|emb|CAI86075.1| protein chain initiation factor IF-2 [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 886

 Score = 40.5 bits (93), Expect = 2.2,   Method: Composition-based stats.
 Identities = 34/156 (21%), Positives = 64/156 (41%), Gaps = 17/156 (10%)

Query: 328 ITRTEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSE 387
           +T + G       ++++ R    K   +    E+R      AE +L        A   +E
Sbjct: 76  VTGSTGKAKSVQVEVRKTRTYVKKSAMEQEQEELR----LAAEEKLRLEEQQKAAQEAAE 131

Query: 388 LKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADRE-KADKDLQEKTPIKAEG 446
           LK      R   ++  ++ ++EAK KAD E+  K+ +   ++  K++KD  E   ++ E 
Sbjct: 132 LKAKQEAERKAKEDADRKAKEEAKRKADAERKAKQKQMTPEQSAKSEKDRIEAERLQKEA 191

Query: 447 DDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKE 482
           ++              L   EEE +   +E +K  E
Sbjct: 192 EE------------AALKKAEEEAKRQAEEARKLAE 215


>gi|152993070|ref|YP_001358791.1| DNA recombination protein [Sulfurovum sp. NBC37-1]
 gi|151424931|dbj|BAF72434.1| DNA recombination protein [Sulfurovum sp. NBC37-1]
          Length = 515

 Score = 40.5 bits (93), Expect = 2.2,   Method: Composition-based stats.
 Identities = 50/211 (23%), Positives = 91/211 (43%), Gaps = 20/211 (9%)

Query: 894  KELQTQLSR-AKKYKESNDERIVSFIRSEFEREIKELKSVIEADAKENPNPNKNQKKLQK 952
            KEL+T+  R AK+  + N E+   F +   +  IK L++ IE   K+  +    +    +
Sbjct: 180  KELKTEFERLAKQIFDGNSEKFAEFSKQNLDSMIKPLQTQIEEFKKQVSDTYNAE---SQ 236

Query: 953  TREKLVAQLSSRLKELN---IDNAYGLWNEYKEDFKASFEYPLGTYEPAILGAMKDMDRL 1009
             R  L  +++S LKELN     +A  L N  K + K       G +   +L  + +   L
Sbjct: 237  DRAVLKNEINS-LKELNEKISTDAINLTNALKGESKQQ-----GVWGEMVLEHVLEASGL 290

Query: 1010 HPIYSVSKTIQKAGGDPSLMMDYEKVEPSDVMAGLPDDLAKRFKALLSWKGWHQLTPAPK 1069
               +   + +       SL  D  +V   DV+  LPD+      A  S   + +   A  
Sbjct: 291  RKGHEFEREV-------SLRTDDNEVLRPDVIVHLPDNRDLIIDAKTSLISYERFINAED 343

Query: 1070 ISTPSFEVSSYVNPKRMHADTESDIYFEEFK 1100
             +  +  +++++N  +MH +  S+  +E  K
Sbjct: 344  EANKAKHLAAHLNSIKMHIEELSNKNYERLK 374


>gi|295109091|emb|CBL23044.1| Putative transposase, YhgA-like. [Ruminococcus obeum A2-162]
          Length = 376

 Score = 40.1 bits (92), Expect = 2.2,   Method: Composition-based stats.
 Identities = 26/60 (43%), Positives = 40/60 (66%), Gaps = 4/60 (6%)

Query: 388 LKQATVLARANAQEEKQRREQEAKEKADREK--ADKEAKEKADREKADKDLQEKTPIKAE 445
           LK+ T   +  A EEKQR ++E K++AD EK  AD+E K++A+ EK   D +++  I+AE
Sbjct: 289 LKRNTAREKQRADEEKQRADEE-KQRADEEKQRADEE-KQRANEEKQRADEEKQLRIEAE 346


>gi|109493035|ref|XP_221535.4| PREDICTED: similar to 4631422O05Rik protein [Rattus norvegicus]
 gi|109494205|ref|XP_001056823.1| PREDICTED: similar to 4631422O05Rik protein [Rattus norvegicus]
          Length = 1129

 Score = 40.1 bits (92), Expect = 2.3,   Method: Composition-based stats.
 Identities = 34/161 (21%), Positives = 77/161 (47%), Gaps = 2/161 (1%)

Query: 341 QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQ 400
           +IK L++  +K+K+ +    +    R  A+  L    I ++A    E +    +A A AQ
Sbjct: 222 RIKALKEELTKLKS-FALMVVDEQQRLTAQLALQRQKIQDLATSAKETQGKLAVAEARAQ 280

Query: 401 EEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHS 460
           EE+Q+  +  KE   +    ++ ++K   +  ++D Q +  ++ +       +  +   +
Sbjct: 281 EEEQKAARLEKELQTQTTEFQQNQDKIMAKLTNEDSQNRQ-LRQKLAALSRQIDELEETN 339

Query: 461 VKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDI 501
             L   EEEL+++K++  KG+   +   D+ +E  ++  D+
Sbjct: 340 RSLRKAEEELQDIKEKINKGEYGDSGIMDEVDELRKRVLDM 380


>gi|3452458|gb|AAC32880.1| cytotoxin associated protein III [Helicobacter pylori]
          Length = 1183

 Score = 40.1 bits (92), Expect = 2.4,   Method: Composition-based stats.
 Identities = 44/188 (23%), Positives = 80/188 (42%), Gaps = 24/188 (12%)

Query: 101 LKRLAETGEVILSDKSDRLLCRFMDMVETEDEHKINKQVRDALESAGFDLESTQENIRKV 160
           L  LA T   I  D  D+L  + +   ET      NK ++D L S   +L     N+ K 
Sbjct: 544 LNNLAIT-SYIRRDLEDKLWAKGLSPQET------NKLIKDFLNSNK-ELVEKVSNLNKA 595

Query: 161 ESALIN----NNMKDAFRFLELAQKSKETADSHIIEAIDVGTKLKENTPPTTFTSISKVL 216
            +   N    + +K A + LE + + +E  +  +++ ++     K               
Sbjct: 596 VAEAKNTGNYDEVKKAQKDLEKSLRKREHLEKEVVKKLENRNDNKNRMEAKA-------- 647

Query: 217 LKSNNMQDVVFTKIKEVVKKHVNAELGHRKLRGLAFDHTYFNDKLNQFLKEIKNHQKEYD 276
            ++N+ +D +F  I E   K   A    + L+G+  +    +DKL    K++K+  K +D
Sbjct: 648 -QANSQKDKIFAIINEEASKEARAAAYVQNLKGIRME---LSDKLENINKDLKDFDKSFD 703

Query: 277 ESEKGSSK 284
           E + G +K
Sbjct: 704 EFKNGKNK 711


>gi|146185520|ref|XP_001032012.2| UBX domain containing protein [Tetrahymena thermophila]
 gi|146142736|gb|EAR84349.2| UBX domain containing protein [Tetrahymena thermophila SB210]
          Length = 2004

 Score = 40.1 bits (92), Expect = 2.4,   Method: Composition-based stats.
 Identities = 41/192 (21%), Positives = 80/192 (41%), Gaps = 35/192 (18%)

Query: 309 DKSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFK 368
           D S +    + NI  W+   T +   GG     +   +D    +K++             
Sbjct: 603 DSSKDKEDGNQNIYDWVDSPTNSSASGGTNKKVLDNQKDFLKSIKSE------------- 649

Query: 369 AETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKAD 428
           AET+     I  +    +ELK+     + + +EE ++R+Q  +E+  +E+ D      A 
Sbjct: 650 AETQ-----IQKLQQEEAELKERIQKLKQDEEEESKQRQQRLQEQKKKEEED------AA 698

Query: 429 REKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTET 488
           R K +  L+E+T  K            +     K   +++ELE +++E KK KE      
Sbjct: 699 RIKQNLILEEETEKK-----------RIEELQNKKKKEQQELERIQNEYKKQKEEELERI 747

Query: 489 DDREETERKNQD 500
              +E +++ ++
Sbjct: 748 AKLKEIKKQQEE 759


>gi|169648429|gb|ACA62216.1| Mi-2 [Drosophila melanogaster]
          Length = 393

 Score = 40.1 bits (92), Expect = 2.4,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 46/92 (50%)

Query: 401 EEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHS 460
           E+K +  ++ K+K   EK++ + +++A+ +K   D++++ P++    D       V T  
Sbjct: 5   EDKDKDSEKEKDKTSAEKSEVKQEQEAEEDKKPGDVKQENPVEEAAGDTKPSDAEVKTEV 64

Query: 461 VKLPPKEEELEEVKDEGKKGKEPGTTETDDRE 492
            K  PKEE  +    E  K +E      DD++
Sbjct: 65  AKTEPKEETKDPEVKEEPKTEEKEKERVDDKK 96


>gi|261335322|emb|CBH18316.1| hypothetical protein, conserved, (fragment) [Trypanosoma brucei
            gambiense DAL972]
          Length = 1209

 Score = 40.1 bits (92), Expect = 2.4,   Method: Composition-based stats.
 Identities = 66/286 (23%), Positives = 118/286 (41%), Gaps = 34/286 (11%)

Query: 695  ENLRANKNAVDAMSKAVEAGESSVRKHSFEVLSSKH--QKSVIAVNNFIKEITHHTRRLV 752
            + LR   + V+    ++E     +RK   +V  SK   +K +  +   + ++T     L 
Sbjct: 931  KELRKQLSDVNGSKSSLEKELKELRKQLSDVTDSKSSLEKELKELRKQLSDVTGSKSSLE 990

Query: 753  KEDPKRGKSESYLSDIRSELQKVNKTVMDIRIKLR-LYGIFQDIPQEQPPLYTIISGSEK 811
            KE  K+      LSD+      + K + ++R +L  + G    + +E     + ++GS+ 
Sbjct: 991  KELRKQ------LSDVNGSKSSLEKELKELRKQLSDVTGSKSSLEKELRKQLSDVNGSKS 1044

Query: 812  ILQGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERSLKNQAH 871
             L+ +         DV    +SS  K       D T++           + E+ LK    
Sbjct: 1045 SLEKELKELRKQLSDVTDS-ESSLEKELRKQLSDVTDSK---------SSLEKELKELR- 1093

Query: 872  LNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERI---------VSFIRSEF 922
                 ++LS +A   S    +LKEL+ QLS     K S ++ +         V+  +S  
Sbjct: 1094 -----KQLSDVADSKSSLEKELKELRKQLSDVTDSKSSLEKELKELRKQLSDVAGSKSSL 1148

Query: 923  EREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL 968
            E+E+KEL+  +   A    +  K  K+L+K    +    SS  KEL
Sbjct: 1149 EKELKELRKQLSDVADSKSSLGKELKELRKQLSDVTDSESSLEKEL 1194


>gi|270004992|gb|EFA01440.1| hypothetical protein TcasGA2_TC030701 [Tribolium castaneum]
          Length = 18024

 Score = 40.1 bits (92), Expect = 2.4,   Method: Composition-based stats.
 Identities = 45/219 (20%), Positives = 90/219 (41%), Gaps = 32/219 (14%)

Query: 398  NAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVP 457
            N QE   +R Q+     D+++  KE +E+   +   K+ + +  I  E D          
Sbjct: 5809 NKQEIVLKRTQK-----DKKEMVKEEQEQVVLKPVKKETKVEEVITKEDDK--------- 5854

Query: 458  THSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNET 517
                   PK++EL   +D+ +  + P   E    EE  +    + D+ ++A     K E 
Sbjct: 5855 -------PKKDELVHTEDKTRGWRRPKKEEKRVEEEKPKDKVHVEDSIMIAVSEKEKVEE 5907

Query: 518  PAIPTAKA--PPAQAHKGIQDKKPQDQREKPLASDIGVGES---------DYAGIKLTKK 566
               P  +    P +  K I+D+KP+D+     ++ I V E          +  G +  +K
Sbjct: 5908 QPQPETRGWRRPKKEQKPIEDEKPKDKVHVEDSTMIAVSEKEKIDEKPQPETKGWRRPRK 5967

Query: 567  EKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWK 605
              E ++ +E +RV +    +  + + + E+     + W+
Sbjct: 5968 PTEEEKPQEPVRVEDSTSIAVSEDKKVDEQPQPETRGWR 6006


>gi|222613034|gb|EEE51166.1| hypothetical protein OsJ_31941 [Oryza sativa Japonica Group]
          Length = 1088

 Score = 40.1 bits (92), Expect = 2.4,   Method: Composition-based stats.
 Identities = 35/148 (23%), Positives = 57/148 (38%), Gaps = 18/148 (12%)

Query: 854 ERYWTIYAFERSLKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKE----- 908
           E+Y    A E   + +A   A VE    L ++ S+    L      ++  K YKE     
Sbjct: 739 EQYVRTRADEERKEKRAAQRAAVEAYKQLLEEASEGHTILIHKMQDINSNKDYKEFKRKW 798

Query: 909 SNDERIVSFIRSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL 968
             D R  +  R E              DA  N      ++K+Q  R  ++A+  S L+E 
Sbjct: 799 GTDPRFEALDRKE-------------RDALFNEKVKSIEEKVQSVRNAVIAEFKSMLRES 845

Query: 969 NIDNAYGLWNEYKEDFKASFEYPLGTYE 996
               +   W + KE+F++   Y    +E
Sbjct: 846 KDITSTSRWTKVKENFRSDARYKAMKHE 873


>gi|302505838|ref|XP_003014876.1| hypothetical protein ARB_06633 [Arthroderma benhamiae CBS 112371]
 gi|291178447|gb|EFE34236.1| hypothetical protein ARB_06633 [Arthroderma benhamiae CBS 112371]
          Length = 2406

 Score = 40.1 bits (92), Expect = 2.5,   Method: Composition-based stats.
 Identities = 77/318 (24%), Positives = 121/318 (38%), Gaps = 53/318 (16%)

Query: 310  KSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKA 369
            KS  W R    +   +G  TRT G      ++I+QL   A +        +I    R + 
Sbjct: 907  KSSPWWRLFATMKPLLGE-TRTAGEVKKRDEKIQQLEAKAQQ--------DIAERQRIED 957

Query: 370  ETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADR 429
            E R   + +  +   T E +++  L +    +  Q RE E  EK     AD+E+ E    
Sbjct: 958  ERRKIETEMQRIRK-TLESERSLALDKEEIFKRLQLREVELSEKLAGAIADQESLE---- 1012

Query: 430  EKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEE-VKDEGKKGKEPGTTET 488
            ++ D+ +  K  I+ E D     L        +L  +++EL+E + D  K+ K   +T  
Sbjct: 1013 DQLDELIAAKKKIEHELDLRRGQLEQAAQIMERLEGEKKELQERISDMEKQLKSVESTHG 1072

Query: 489  DDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLA 548
            +  E+    NQ+I  N+L                       +H  ++DKK QD   K L+
Sbjct: 1073 EYDEKIGALNQEI--NTL----------------------NSHLAMKDKKLQDLEAKLLS 1108

Query: 549  SDIGVGESDYAGIKLTKKEKEL--------QEQEENLRVAEIIQQSRMQSEDLQEKAWDS 600
            SD          ++L    KEL        Q  EEN  +   I      S   +E     
Sbjct: 1109 SD------QQLDLELANTTKELEGSKKQIKQLLEENREIQRQIADLSSTSTGYEELVRRK 1162

Query: 601  YKEWKSLSPDEIKQRFQK 618
              E   L  D  K  F+K
Sbjct: 1163 EGEVAILKADLKKHEFEK 1180


>gi|270007958|gb|EFA04406.1| hypothetical protein TcasGA2_TC014705 [Tribolium castaneum]
          Length = 1336

 Score = 40.1 bits (92), Expect = 2.5,   Method: Composition-based stats.
 Identities = 30/100 (30%), Positives = 50/100 (50%), Gaps = 5/100 (5%)

Query: 868 NQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIK 927
           N    NA+V +L  L  Q  ++  +LKE Q +L         N+    S IR E  +  K
Sbjct: 424 NDKDANAQVTKLQQLLDQERNTVEELKEKQRKLIAQISSLAQNE----SAIREESSKYEK 479

Query: 928 ELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKE 967
           EL ++++ + KE     +N+ +L+K  EK +A +   L+E
Sbjct: 480 EL-TILKHNYKELQRKAENENELRKKTEKYLADIKRTLEE 518


>gi|169648445|gb|ACA62224.1| Mi-2 [Drosophila melanogaster]
          Length = 393

 Score = 40.1 bits (92), Expect = 2.5,   Method: Composition-based stats.
 Identities = 18/68 (26%), Positives = 37/68 (54%)

Query: 401 EEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHS 460
           E+K +  ++ K+K   EK++ + +++A+ +K   D++++ P++    D       V T  
Sbjct: 5   EDKDKDSEKEKDKTSAEKSEVKQEQEAEEDKKPGDVKQENPVEEAAGDTKPSDAEVKTEV 64

Query: 461 VKLPPKEE 468
            K  PKEE
Sbjct: 65  AKTEPKEE 72


>gi|163914553|ref|NP_001106360.1| RING1 and YY1 binding protein [Xenopus laevis]
 gi|161611766|gb|AAI55956.1| LOC100127335 protein [Xenopus laevis]
 gi|213623172|gb|AAI69386.1| Hypothetical protein LOC100127335 [Xenopus laevis]
 gi|213626388|gb|AAI69358.1| Hypothetical protein LOC100127335 [Xenopus laevis]
          Length = 333

 Score = 40.1 bits (92), Expect = 2.5,   Method: Composition-based stats.
 Identities = 24/64 (37%), Positives = 36/64 (56%), Gaps = 2/64 (3%)

Query: 384 FTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEA--KEKADREKADKDLQEKTP 441
           F +E  +   L R     EK  RE+  +EK DREK DKE   ++K DREK D++  ++  
Sbjct: 97  FENEKPEKDKLDREKLDREKLDREKLDREKVDREKFDKEKLDRDKIDREKLDREKNDREK 156

Query: 442 IKAE 445
           ++ E
Sbjct: 157 LERE 160


>gi|115903825|ref|XP_787192.2| PREDICTED: similar to Eukaryotic translation initiation factor 3,
           subunit 8 [Strongylocentrotus purpuratus]
 gi|115949004|ref|XP_001177052.1| PREDICTED: similar to Eukaryotic translation initiation factor 3,
           subunit 8 [Strongylocentrotus purpuratus]
          Length = 1170

 Score = 40.1 bits (92), Expect = 2.5,   Method: Composition-based stats.
 Identities = 21/47 (44%), Positives = 29/47 (61%), Gaps = 4/47 (8%)

Query: 398 NAQEEKQRREQEAKEKAD--REKADKEAKEKAD--REKADKDLQEKT 440
           N +EE Q +  E+KEK D  +EK + E +EK D  +EK   + QEKT
Sbjct: 636 NTEEESQEKTDESKEKTDEIQEKTEGEGQEKTDESQEKTKGESQEKT 682


>gi|157110326|ref|XP_001651055.1| hypothetical protein AaeL_AAEL005529 [Aedes aegypti]
 gi|108878779|gb|EAT43004.1| hypothetical protein AaeL_AAEL005529 [Aedes aegypti]
          Length = 3217

 Score = 40.1 bits (92), Expect = 2.5,   Method: Composition-based stats.
 Identities = 53/272 (19%), Positives = 110/272 (40%), Gaps = 19/272 (6%)

Query: 387  ELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEG 446
            E + AT +A    +++++++  E  +K + ++ADKE  +      A++      P++A+ 
Sbjct: 2403 EPQAATTIASIAPEQDEEQKPVEDDKKPELDEADKEPTDVPVEHDAEEQKPAVEPVEADE 2462

Query: 447  DDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGT-TETDDRE--ETERKNQDILD 503
            ++         T   ++   EEE   V  E  + ++P + TE+D++    T     D+++
Sbjct: 2463 EE------PAATRIPEVEADEEEKPAVAVESDEEEKPASATESDEQTPVTTMASAMDVVE 2516

Query: 504  NSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLAS------DIGVGESD 557
                     + +ET           +A K +    P  + EKP  S      +    ESD
Sbjct: 2517 EDEKVKPMPSADETEKDEMTPVEADEAEKPVSTDAPAVETEKPAVSMDEEEEEEKPIESD 2576

Query: 558  YAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKE----WKSLSPDEIK 613
                K   +  +  ++EE     E +     + E   ++  ++ +E      S + DE+K
Sbjct: 2577 EEEHKPAVEPVQADDEEEEKPAQEPVDAEHDEEEKPAQEPVEADEEVAVTTASPAADEMK 2636

Query: 614  QRFQKYAKVFYRSYSPVDGSYKGTQESDKAIN 645
               ++     Y+   P   +     E DK I+
Sbjct: 2637 PEVEEEKPTLYKEEEPATETSVKDDEQDKPID 2668


>gi|329312810|gb|AEB87223.1| Immunoglobulin G-binding protein A [Staphylococcus aureus subsp.
           aureus T0131]
          Length = 418

 Score = 40.1 bits (92), Expect = 2.5,   Method: Composition-based stats.
 Identities = 52/219 (23%), Positives = 82/219 (37%), Gaps = 37/219 (16%)

Query: 341 QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSE--------LKQAT 392
           + K+L D A   KAD         N+F  E + A+  I ++ N T E        LK   
Sbjct: 200 EAKKLND-AQAPKAD---------NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDP 249

Query: 393 VLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQE--KTPIKAEGDDFG 450
            +++    E K+  + +A ++ D  K  KE   K  +E  +K  +E  K P K +G+   
Sbjct: 250 SVSKEILAEAKKLNDAQAPKEEDNNKPGKEDNNKPGKEDGNKPGKEDNKKPGKEDGNK-- 307

Query: 451 LGLPSVPTHSVKLPPKEEELEEVKDEGKKGK--EPGTTETDDREETERKNQDILDNSLLA 508
                        P KE+  +  K++G      +PG T  D  +        I  ++ LA
Sbjct: 308 -------------PGKEDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADKIAADNKLA 354

Query: 509 GKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPL 547
            K   K     +   K P   A        P+   E P 
Sbjct: 355 AKNMIKPGQELVVDKKQPANHADANKAQALPETGEENPF 393


>gi|325911072|gb|ADZ45264.1| pneumococcal surface protein C [Streptococcus pneumoniae]
          Length = 699

 Score = 40.1 bits (92), Expect = 2.5,   Method: Composition-based stats.
 Identities = 59/239 (24%), Positives = 110/239 (46%), Gaps = 48/239 (20%)

Query: 412 EKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPK----- 466
           ++A+ E   +EAKE  D EK  +  ++    KAE       L ++ T   K   +     
Sbjct: 185 KEAELELVKEEAKEPRDEEKIKQAKEKVESKKAEATR----LENIKTDRKKAEEEAKRKA 240

Query: 467 EEELEEV----------KDEGKKGKEPGTTETDDREETERKNQD-------ILDNSLLAG 509
           + +L+E           K  GK+G  PG   T D++E + K+ D       +  +SL +G
Sbjct: 241 DAKLKEANVATSDQGNPKGRGKRGV-PGELATPDKKENDAKSSDSSVGEETLPSSSLKSG 299

Query: 510 KTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLAS----DIGVGESDY----AGI 561
           K  T+ E            +A K  +D+K +D+R  P  +    D+ + ESD     A +
Sbjct: 300 KKVTEAEKKV--------EEAEKKAKDQKEEDRRNYPTNTYKTLDLEIAESDVKVKEAEL 351

Query: 562 KLTKKE-KELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYK----EWKSLSPDEIKQR 615
           +L K+E KE +++E+  +  E ++  + ++  L++   D  K    + K+   D++K++
Sbjct: 352 ELVKEEAKEPRDEEKIKQAKEKVESKKAEATRLEKIKTDRKKAEEAKRKAAEEDKVKEK 410


>gi|295424207|ref|NP_001035487.2| filamin A-interacting protein 1-like isoform 1 [Mus musculus]
          Length = 1131

 Score = 40.1 bits (92), Expect = 2.5,   Method: Composition-based stats.
 Identities = 35/161 (21%), Positives = 74/161 (45%), Gaps = 2/161 (1%)

Query: 341 QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQ 400
           +IK L++  +K+K+ +    +    R  A+  L    I  +     E +    LA A AQ
Sbjct: 222 RIKTLKEELTKLKS-FALMVVDEQQRLTAQLALQRQKIQALTTSAKETQGKLALAEARAQ 280

Query: 401 EEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHS 460
           EE+Q+  +  KE   +     + ++K   +  ++D Q +  ++ +       +  +   +
Sbjct: 281 EEEQKATRLEKELQTQTTEFHQNQDKIMAKLTNEDSQNRQ-LRQKLAALSRQIDELEETN 339

Query: 461 VKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDI 501
             L   EEEL+++KD+  KG+   +   D+ +E  ++  D+
Sbjct: 340 RSLRKAEEELQDIKDKINKGEYGNSGIMDEVDELRKRVLDM 380


>gi|189344715|gb|ACD92726.1| downregulated in ovarian cancer 1-like protein [Mus musculus]
          Length = 1131

 Score = 40.1 bits (92), Expect = 2.6,   Method: Composition-based stats.
 Identities = 35/161 (21%), Positives = 74/161 (45%), Gaps = 2/161 (1%)

Query: 341 QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQ 400
           +IK L++  +K+K+ +    +    R  A+  L    I  +     E +    LA A AQ
Sbjct: 222 RIKTLKEELTKLKS-FALMVVDEQQRLTAQLALQRQKIQALTTSAKETQGKLALAEARAQ 280

Query: 401 EEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHS 460
           EE+Q+  +  KE   +     + ++K   +  ++D Q +  ++ +       +  +   +
Sbjct: 281 EEEQKATRLEKELQTQTTEFHQNQDKIMAKLTNEDSQNRQ-LRQKLAALSRQIDELEETN 339

Query: 461 VKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDI 501
             L   EEEL+++KD+  KG+   +   D+ +E  ++  D+
Sbjct: 340 RSLRKAEEELQDIKDKINKGEYGNSGIMDEVDELRKRVLDM 380


>gi|160387022|sp|Q6P6L0|FIL1L_MOUSE RecName: Full=Filamin A-interacting protein 1-like; AltName:
           Full=Protein down-regulated in ovarian cancer 1 homolog;
           Short=DOC-1
          Length = 1131

 Score = 40.1 bits (92), Expect = 2.6,   Method: Composition-based stats.
 Identities = 35/161 (21%), Positives = 74/161 (45%), Gaps = 2/161 (1%)

Query: 341 QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQ 400
           +IK L++  +K+K+ +    +    R  A+  L    I  +     E +    LA A AQ
Sbjct: 222 RIKTLKEELTKLKS-FALMVVDEQQRLTAQLALQRQKIQALTTSAKETQGKLALAEARAQ 280

Query: 401 EEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHS 460
           EE+Q+  +  KE   +     + ++K   +  ++D Q +  ++ +       +  +   +
Sbjct: 281 EEEQKATRLEKELQTQTTEFHQNQDKIMAKLTNEDSQNRQ-LRQKLAALSRQIDELEETN 339

Query: 461 VKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDI 501
             L   EEEL+++KD+  KG+   +   D+ +E  ++  D+
Sbjct: 340 RSLRKAEEELQDIKDKINKGEYGNSGIMDEVDELRKRVLDM 380


>gi|133853458|gb|ABO39035.1| immunoglobulin G binding protein A precursor [Staphylococcus aureus
           subsp. aureus]
          Length = 520

 Score = 40.1 bits (92), Expect = 2.6,   Method: Composition-based stats.
 Identities = 59/237 (24%), Positives = 87/237 (36%), Gaps = 41/237 (17%)

Query: 341 QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQA--------- 391
           + K+L D A   KAD         N+F  E + A+  I ++ N T E +           
Sbjct: 270 EAKKLND-AQAPKAD---------NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDP 319

Query: 392 ----TVLARANAQEEKQRREQEAKEKADREKADKEAKE------KADREKADKDLQEKTP 441
                +LA A    + Q  ++E   K  +E  +K  KE      K D +K  K+   K P
Sbjct: 320 SVSKEILAEAKKLNDAQAPKEEDNNKPGKEDGNKPGKEDNNKPGKEDNKKPGKEDNNK-P 378

Query: 442 IKAEGDDFGLGLPSVP-THSVKLPPKEEELEEVKDEGKK-GKE---------PGTTETDD 490
            K + +  G    + P     K P KE+  +  K++G K GKE         PG T  D 
Sbjct: 379 GKEDNNKPGKEDGNKPGKEDNKKPGKEDNNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDI 438

Query: 491 REETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPL 547
            +        I  ++ LA K   K     +   K P   A        P+   E P 
Sbjct: 439 AKANGTTADKIAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEENPF 495


>gi|194374301|dbj|BAG57046.1| unnamed protein product [Homo sapiens]
          Length = 318

 Score = 40.1 bits (92), Expect = 2.6,   Method: Composition-based stats.
 Identities = 28/115 (24%), Positives = 53/115 (46%), Gaps = 20/115 (17%)

Query: 374 AYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKE-AKEKADREKA 432
           A   IA + +   ELK+  +  R   QE+    +++ ++K  R+K +KE ++EK +R ++
Sbjct: 11  AQENIAGIPSAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREKRERSRS 70

Query: 433 DKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTE 487
            +  + ++P  A                   P K+E+  E+ +   K KEP   E
Sbjct: 71  PRRTKSRSPSPA-------------------PEKKEKTPELPEPSVKVKEPSVQE 106


>gi|328872521|gb|EGG20888.1| SNF2-related domain-containing protein [Dictyostelium fasciculatum]
          Length = 2077

 Score = 40.1 bits (92), Expect = 2.6,   Method: Composition-based stats.
 Identities = 42/181 (23%), Positives = 89/181 (49%), Gaps = 14/181 (7%)

Query: 370 ETRLAYSTIANVANFTSELKQATVLARAN-AQEEKQRREQEAKEKADREKADKEAKEKAD 428
           ++ L +  +      TSE ++    AR N A+ EK++ +Q  KE+ ++E+ ++  KEK +
Sbjct: 579 DSPLTHEDLGGFDTTTSEKEEQE--ARENEAKLEKEKHDQLEKERLEKERLEQLEKEKLE 636

Query: 429 REKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKE--EELEEVKDEG----KKGKE 482
           +E+ +K+  EK  ++ E  +  L    +    ++   KE  E+LE+ + E     K+  E
Sbjct: 637 QERLEKERLEKERLEKERLE-QLEKERLEKERLEQLEKERLEQLEKERIENERLEKEKLE 695

Query: 483 PGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQ 542
               E  ++E  E+  ++ L+N  +A +   + E       K    +  K ++D++ + +
Sbjct: 696 RLEKERLEKERLEQLEKERLENERIANEKKAEEER----IVKGREEKERKRLEDERVEKE 751

Query: 543 R 543
           R
Sbjct: 752 R 752


>gi|326472023|gb|EGD96032.1| hypothetical protein TESG_03493 [Trichophyton tonsurans CBS 112818]
          Length = 1377

 Score = 40.1 bits (92), Expect = 2.6,   Method: Composition-based stats.
 Identities = 39/154 (25%), Positives = 70/154 (45%), Gaps = 10/154 (6%)

Query: 456 VPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKN 515
           VPT   + PPK +E    +D+ K  + P   E    EET+ ++Q       +  +     
Sbjct: 212 VPTVEEQEPPKIDEEPRAEDDLKVDEAPKVEELPAEEETKAEDQLGTTEEPIPDEPQPVE 271

Query: 516 ETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEE 575
           E  A+PT +A P +A   +++ KPQD   +               ++  K E+ + EQE 
Sbjct: 272 E--AVPTEEANPEEA--SLEETKPQDTAPEVEEKFEEAAPEPETQVEEDKFEETIPEQEA 327

Query: 576 NLR---VAEII---QQSRMQSEDLQEKAWDSYKE 603
            L    V++I+   ++ + + +   E+A +S KE
Sbjct: 328 KLEENVVSDIVPLPEEVQQEGDKQPEQATESVKE 361


>gi|257459304|ref|ZP_05624418.1| putative CAP-Gly domain containing protein [Campylobacter gracilis
           RM3268]
 gi|257443317|gb|EEV18446.1| putative CAP-Gly domain containing protein [Campylobacter gracilis
           RM3268]
          Length = 328

 Score = 40.1 bits (92), Expect = 2.6,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 42/79 (53%), Gaps = 7/79 (8%)

Query: 374 AYSTIANVANFTSELKQATVLARAN-------AQEEKQRREQEAKEKADREKADKEAKEK 426
           A +T  ++A  T E  +  + A  N       A++EKQRR+ E  E+A +E  ++ A+EK
Sbjct: 148 AVTTAGSLAKPTKEAIEGKIAALENEILQAKLAEQEKQRRDAEIAERARKEAEERAAREK 207

Query: 427 ADREKADKDLQEKTPIKAE 445
           A+ E   K  + +   +AE
Sbjct: 208 AEMEARAKAREAEILARAE 226


>gi|114669123|ref|XP_001166222.1| PREDICTED: myosin, heavy polypeptide 10, non-muscle isoform 1 [Pan
            troglodytes]
          Length = 1967

 Score = 40.1 bits (92), Expect = 2.6,   Method: Composition-based stats.
 Identities = 70/300 (23%), Positives = 122/300 (40%), Gaps = 71/300 (23%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   E+L  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 1014 AEAKIKKMEEEILLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 1068

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTII-------SGSEK 811
            K E  +SD+   L+K  KT  ++ + K +L G   D+  +   L   I       +  E+
Sbjct: 1069 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKLQLAKKEE 1128

Query: 812  ILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERS 865
             LQG      D T    ++L V  +  +  ++L E F                    E++
Sbjct: 1129 ELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFES------------------EKA 1170

Query: 866  LKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFERE 925
             +N+A             +Q  D + +L+ L+T+L        +  E     +R++ E+E
Sbjct: 1171 SRNKAE------------KQKRDLSEELEALKTELEDTLDTTAAQQE-----LRTKREQE 1213

Query: 926  IKELKSVIEADAKENPNPNKNQKKLQKTR-EKLVAQL--SSRLKELNIDNAYGLWNEYKE 982
            + ELK  +E + K +    ++ ++   T  E+L  QL  + R K     N  GL  + KE
Sbjct: 1214 VAELKKALEEETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKE 1273


>gi|23344105|gb|AAN28373.1| colicin structural protein [Escherichia coli]
          Length = 575

 Score = 40.1 bits (92), Expect = 2.6,   Method: Composition-based stats.
 Identities = 71/288 (24%), Positives = 117/288 (40%), Gaps = 40/288 (13%)

Query: 300 NDWVNGRVGDKSDEWARTSTNIASW-IGRITRTEGLGGVTYDQIKQLRDLASKVKADYHW 358
           ND     V +++ E AR   + A+  + R    +      Y+  K   D A+K  AD   
Sbjct: 305 NDTHPVEVAERNYEQARAELDQANKDVARNQERQAKAVQVYNSRKSELDAANKTLADAK- 363

Query: 359 AEIRHGNRFKAETRLAYSTIANVANFTSELKQATV---LARANAQEEKQRREQEAKEKAD 415
           AEI+   RF  E   A   +  +A   ++  Q  V    A  +A  + +     A   A 
Sbjct: 364 AEIKQFERFAREPMAAGHRMWQMAGLKAQRAQTDVNNKKAAFDAAAKDKSDADAALGAAL 423

Query: 416 REKADKEAKEKADREKADKDLQEKTPIKAEG----------DDFG--LGLPSVPTHSVKL 463
             +  KE KEK  ++K DK+ +   P KA G          DD G   G P     + KL
Sbjct: 424 ERRKQKENKEKDSKDKLDKESKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKL 483

Query: 464 PPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTA 523
             +++E +   D  KK  E    E     E  ++ +D       + KT+       I   
Sbjct: 484 --RDKEFKSFDDFRKKFWE----EVSKDPELSKQFKD-------SNKTN-------IQKG 523

Query: 524 KAPPAQAHKGIQDKKPQD-QREKPLASDIGVGESDYAGIKLTKKEKEL 570
           KAP A+    +  ++  +   +KP++ D GV + D   I++T  ++ +
Sbjct: 524 KAPFARKKDQVGGRERFELHHDKPISQDGGVYDMD--NIRVTTPKRHI 569


>gi|297274975|ref|XP_002808200.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat domain-containing
           protein 12-like [Macaca mulatta]
          Length = 2058

 Score = 40.1 bits (92), Expect = 2.6,   Method: Composition-based stats.
 Identities = 46/172 (26%), Positives = 78/172 (45%), Gaps = 22/172 (12%)

Query: 389 KQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDD 448
           K+  V    N +EE+ + ++E+ EK+ RE+  K+ KE+ +    DKD +    + A  + 
Sbjct: 737 KEKHVSKERNFKEERDKIKKES-EKSFREEKIKDLKEERENIPTDKDSEFTLGMSAIEES 795

Query: 449 FGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKN---------- 498
            GL L       + +  +E+ ++E K++ +K  +   T+  D E+ ERKN          
Sbjct: 796 MGLHLVE---KEIDVEKQEKHIKESKEKPEKRSQ---TKEKDIEKMERKNFEKEKKIKHE 849

Query: 499 ----QDILDNSLLAGKTHTKNETPAIPTAKA-PPAQAHKGIQDKKPQDQREK 545
               +D LD S  A K   K+   +  T K    ++  K     K  D REK
Sbjct: 850 HKSEKDKLDLSECADKIKEKDRLYSHHTEKCHKESEKSKNTATIKKTDDREK 901


>gi|237834995|ref|XP_002366795.1| hypothetical protein TGME49_042750 [Toxoplasma gondii ME49]
 gi|211964459|gb|EEA99654.1| hypothetical protein TGME49_042750 [Toxoplasma gondii ME49]
 gi|221503725|gb|EEE29409.1| conserved hypothetical protein [Toxoplasma gondii VEG]
          Length = 3900

 Score = 40.1 bits (92), Expect = 2.6,   Method: Composition-based stats.
 Identities = 33/132 (25%), Positives = 59/132 (44%), Gaps = 4/132 (3%)

Query: 382  ANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKT- 440
            A   ++ ++   LARA  +  +Q+   E + +  R++A+K  +++    +A   LQE+  
Sbjct: 3423 AESEAQRQELEALARAKTELSRQKTALELEAERLRQEAEKLRRDQETHAEARNKLQEEAR 3482

Query: 441  PIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQD 500
             I  E      GL  +     +L  KEE LEE + E     E       + + +ER+ + 
Sbjct: 3483 QIHEEAKQLDEGLARLRMAQQQLEGKEEALEETRIE---LAERAAALKREEQMSERRKES 3539

Query: 501  ILDNSLLAGKTH 512
            +L  S  A K  
Sbjct: 3540 VLHPSWAASKAQ 3551


>gi|38328190|gb|AAH62166.1| Filip1l protein [Mus musculus]
          Length = 958

 Score = 40.1 bits (92), Expect = 2.6,   Method: Composition-based stats.
 Identities = 35/161 (21%), Positives = 74/161 (45%), Gaps = 2/161 (1%)

Query: 341 QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQ 400
           +IK L++  +K+K+ +    +    R  A+  L    I  +     E +    LA A AQ
Sbjct: 49  RIKTLKEELTKLKS-FALMVVDEQQRLTAQLALQRQKIQALTTSAKETQGKLALAEARAQ 107

Query: 401 EEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHS 460
           EE+Q+  +  KE   +     + ++K   +  ++D Q +  ++ +       +  +   +
Sbjct: 108 EEEQKATRLEKELQTQTTEFHQNQDKIMAKLTNEDSQNRQ-LRQKLAALSRQIDELEETN 166

Query: 461 VKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDI 501
             L   EEEL+++KD+  KG+   +   D+ +E  ++  D+
Sbjct: 167 RSLRKAEEELQDIKDKINKGEYGNSGIMDEVDELRKRVLDM 207


>gi|327289756|ref|XP_003229590.1| PREDICTED: plectin-like [Anolis carolinensis]
          Length = 4389

 Score = 40.1 bits (92), Expect = 2.7,   Method: Composition-based stats.
 Identities = 72/279 (25%), Positives = 114/279 (40%), Gaps = 35/279 (12%)

Query: 366  RFKAETRLAYS-TIANVANFTSELKQATVLARANAQE--EKQRREQ--EAKEKADREKAD 420
            R KAE   A S  +   A    +  +    A+A AQE  EKQR+E   EA ++A  E+A 
Sbjct: 1897 RIKAEKEAALSRQLVEEAERMKQRAEEEAQAQAKAQEDAEKQRKEAELEAAKRAQAEQAA 1956

Query: 421  KEAKEKADREKA------DKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVK 474
             + KE AD E A      ++ L++K  ++ E     L L         L   EEE + +K
Sbjct: 1957 LKQKELADAEMAKHKKFSEQTLRQKAQVEQELTKVKLQLEQTDHQKNIL---EEEQQRLK 2013

Query: 475  DEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAK--------AP 526
            DE  +       +   + E E     I    L+  KT  + E  A+            A 
Sbjct: 2014 DEVTEA-----MKQKAQVEEELFKVKIQMEELIKLKTRIEGENKALIMKDKDNMQKFLAE 2068

Query: 527  PAQAHKGIQDKKPQDQREKPLASDI-GVGESDYAGIK------LTKKEKELQEQEENLRV 579
             A+  K + ++  +   E   A+ +  + E D A  +      L +K   +QE       
Sbjct: 2069 EAEKMKQVAEEAARLSIEAQEAARLRELAEQDLAQQRALAEKILKEKMVAVQEATRLKAE 2128

Query: 580  AEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQK 618
            AE++Q+ +  +++ Q K     KE   L   E  + FQK
Sbjct: 2129 AEMLQKQKDLAQE-QAKKLQEDKEQMQLRLTEEAEGFQK 2166


>gi|326477112|gb|EGE01122.1| RNA polymerase Rpb1 C-terminal repeat domain-containing protein
           [Trichophyton equinum CBS 127.97]
          Length = 1387

 Score = 40.1 bits (92), Expect = 2.7,   Method: Composition-based stats.
 Identities = 39/154 (25%), Positives = 70/154 (45%), Gaps = 10/154 (6%)

Query: 456 VPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKN 515
           VPT   + PPK +E    +D+ K  + P   E    EET+ ++Q       +  +     
Sbjct: 212 VPTVEEQEPPKIDEEPRAEDDLKVDEAPKVEELPAEEETKAEDQLGTTEEPIPDEPQPVE 271

Query: 516 ETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEE 575
           E  A+PT +A P +A   +++ KPQD   +               ++  K E+ + EQE 
Sbjct: 272 E--AVPTEEANPEEA--SLEETKPQDTAPEVEEKFEEAAPEPETQVEEDKFEETIPEQEA 327

Query: 576 NLR---VAEII---QQSRMQSEDLQEKAWDSYKE 603
            L    V++I+   ++ + + +   E+A +S KE
Sbjct: 328 KLEENVVSDIVPLPEEVQQEGDKQPEQATESVKE 361


>gi|170055563|ref|XP_001863637.1| conserved hypothetical protein [Culex quinquefasciatus]
 gi|167875512|gb|EDS38895.1| conserved hypothetical protein [Culex quinquefasciatus]
          Length = 2930

 Score = 40.1 bits (92), Expect = 2.7,   Method: Composition-based stats.
 Identities = 64/272 (23%), Positives = 108/272 (39%), Gaps = 37/272 (13%)

Query: 397  ANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSV 456
            A AQ+E  + E+E K  AD E    +     D ++ +KD ++K P+ A+ D     +   
Sbjct: 1769 APAQDEVAKDEEEQKPTADEE----QTPAADDEQEPEKDAEQK-PVAADDDQ----VTDA 1819

Query: 457  PTHSVKLPPKEEELEEVKDEGKKGKE---PGTTETD-----DREETERKNQDILDNSLLA 508
            P  S  +   EE+     DE +K  E   P    TD     D +E+  + Q  ++     
Sbjct: 1820 PVQSTTVVADEEQKPVEADEEQKPVEADVPEVKPTDAPVKADDDESAEEEQPAVEPVAAD 1879

Query: 509  GKTHTKNETPAIPTAKAPPAQAHKGI---QDKKP----QDQREKPLASDIGVGESDYAGI 561
             +   + + PA   A        K +   +++KP    ++Q+  P A D    E   A  
Sbjct: 1880 EQDEEEEDKPATTVAPVSADDETKPVEADEEQKPVEADEEQKPTPAADD----EQKPASD 1935

Query: 562  KLTKKEKEL-----QEQEENLRVAEIIQQSRMQSEDLQEKAWD----SYKEWKSLSPDEI 612
              T+++K        EQ+     AE  Q +   ++D  EK  D    S  E +  + DE 
Sbjct: 1936 DTTEEQKPTPAAADDEQKPESDDAEKEQDAPAVADDETEKTTDAPVVSADEEQKPTADEE 1995

Query: 613  KQRFQKYAKVFYRSYSPVDGSYKGTQESDKAI 644
            +++    A        P D +     ESD  +
Sbjct: 1996 EEKPATPAASDDEQEQPADAATTPLPESDDQV 2027



 Score = 39.7 bits (91), Expect = 3.5,   Method: Composition-based stats.
 Identities = 45/187 (24%), Positives = 75/187 (40%), Gaps = 14/187 (7%)

Query: 376  STIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKD 435
            +T A+VA+   E  + TV A +  +EEK+  E  A    + +K  +EA        AD++
Sbjct: 1505 TTTASVASADEE--KTTVAAPSADEEEKKPEEMVAPSADEEDKKPEEAATTVAAPSADEE 1562

Query: 436  LQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETD------ 489
             Q+   + A   D     P     +V  P  +EE ++ + E    +E      D      
Sbjct: 1563 EQKPEEMVAPSADEEEKKPEEAATTVAAPSADEEEKQPEIEVSSDEEQKPAFDDEKKPEA 1622

Query: 490  DREETERKNQDILDNSLLAGKTHTK------NETPAIPTAKAPPAQAHKGIQDKKPQDQR 543
            D E+T       +D+    G T  +      +E     T  AP   A K  ++    D  
Sbjct: 1623 DEEQTSATTVASIDSDDRVGVTEAEQKPVEADEEDKAATTVAPVMDAEKPAEEAPAADDE 1682

Query: 544  EKPLASD 550
            +KP+ +D
Sbjct: 1683 QKPVEAD 1689



 Score = 38.2 bits (87), Expect = 9.7,   Method: Composition-based stats.
 Identities = 44/212 (20%), Positives = 82/212 (38%), Gaps = 10/212 (4%)

Query: 407  EQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPK 466
            EQ+    AD E+   EA E+      + D +E+ P++A+        P       +  P 
Sbjct: 2053 EQKPTPVADEEQKPVEADEEQKPTPVEAD-EEQKPVEADEAQKPTQAPVEADEEEQPAPV 2111

Query: 467  EEELEEVKDEGKKGKEPGTTETDDR----EETERKNQDILDNSLLAGKTHTKNETPAIPT 522
             ++ E   DE ++  +P T   D+     E+ E       +  + A +     E+ A   
Sbjct: 2112 ADDHESADDEEEE--KPATPVADEEQKPVEDEETTPAADAEKPVEADEVQKPTESAAEAD 2169

Query: 523  AKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEI 582
             +  P  A      +KP ++ +KP  + +   E+  A       E   +EQ+      E 
Sbjct: 2170 EEQKPTPAADA---EKPVEEEQKPTQASVEADEATPAAEAEKPVEAADEEQKPTESAVEA 2226

Query: 583  IQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQ 614
              Q    + D QE      +E  ++  DE+++
Sbjct: 2227 EDQKPTPAADAQEPVESDEEEKPAVEADEVQK 2258


>gi|115717773|ref|XP_782010.2| PREDICTED: similar to EG:49E4.1 [Strongylocentrotus purpuratus]
 gi|115945658|ref|XP_001178421.1| PREDICTED: similar to EG:49E4.1 [Strongylocentrotus purpuratus]
          Length = 4507

 Score = 40.1 bits (92), Expect = 2.7,   Method: Composition-based stats.
 Identities = 44/186 (23%), Positives = 79/186 (42%), Gaps = 28/186 (15%)

Query: 389  KQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDD 448
            + ++ L+  N ++E+  ++ ++  K D     K   + A++EK DKD            D
Sbjct: 1544 RASSKLSDGNLEQERDVKDIDS-SKDDSRPPTKFTVDGAEKEKNDKD-----------TD 1591

Query: 449  FGLGLPSVPTHSVKLPPKEEELEEV--KDEGKKGKEPGTTETDDREETERKNQDILDNSL 506
             G  +    T   KL   +EE E +  +D  K+   P T  +D  EE E+  +D      
Sbjct: 1592 SGKTISRALT---KLSDGKEEKENIQDRDSSKETSRPPTKLSDGEEEKEKDVKD------ 1642

Query: 507  LAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKK 566
                TH   ETP  PT  +      + IQD++ + +  +  +S +  G  +    K  K 
Sbjct: 1643 ----THNGKETPRPPTNLSDGKTEKEDIQDRESKQEASRA-SSKLSEGREEKDNAKDVKD 1697

Query: 567  EKELQE 572
             + ++E
Sbjct: 1698 TENIKE 1703


>gi|169648441|gb|ACA62222.1| Mi-2 [Drosophila melanogaster]
          Length = 393

 Score = 40.1 bits (92), Expect = 2.7,   Method: Composition-based stats.
 Identities = 18/68 (26%), Positives = 37/68 (54%)

Query: 401 EEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHS 460
           E+K +  ++ K+K   EK++ + +++A+ +K   D++++ P++    D       V T  
Sbjct: 5   EDKDKDSEKEKDKTSAEKSEVKQEQEAEEDKKPGDVKQENPVEEAAGDTKPSDAEVKTEV 64

Query: 461 VKLPPKEE 468
            K  PKEE
Sbjct: 65  AKTEPKEE 72


>gi|148745056|gb|AAI42509.1| SMARCE1 protein [Bos taurus]
          Length = 376

 Score = 40.1 bits (92), Expect = 2.7,   Method: Composition-based stats.
 Identities = 41/193 (21%), Positives = 82/193 (42%), Gaps = 19/193 (9%)

Query: 341 QIKQLRDLASKVKADYHWAEIRH---GNRFKAETRLAYSTIANVANFTSELKQATVLARA 397
           Q++ L     K++A+    E RH     +F   T    + +  +     E+    + A  
Sbjct: 195 QVQSLMVHQRKLEAELLQIEERHQEKKRKFLESTESFNNELKRLCGLKVEVDMEKIAAEI 254

Query: 398 NAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVP 457
              EE+ R+ QE +E        KEA E+A+R ++   + E+ P  ++ +D         
Sbjct: 255 AQAEEQARKRQEERE--------KEAAEQAERSQSSI-IPEEEPAASKTED------KKE 299

Query: 458 THSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNET 517
             S+ +  +E  LE+  +  + G+E GT+  +D+E  +     + +       T +++ +
Sbjct: 300 DESMPMETEETHLEDTTESQQNGEE-GTSTPEDKESGQEGVDSLAEEGTSDSNTGSESNS 358

Query: 518 PAIPTAKAPPAQA 530
            A+      PA A
Sbjct: 359 AAVEEPPTDPAPA 371


>gi|332685823|ref|YP_004455597.1| chromosome partition protein Smc [Melissococcus plutonius ATCC
           35311]
 gi|332369832|dbj|BAK20788.1| chromosome partition protein Smc [Melissococcus plutonius ATCC
           35311]
          Length = 1192

 Score = 40.1 bits (92), Expect = 2.8,   Method: Composition-based stats.
 Identities = 36/172 (20%), Positives = 78/172 (45%), Gaps = 11/172 (6%)

Query: 829 SKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAEVERLSGLA---QQ 885
           S+ +   +K  EIF    +  A+  E++   Y  ++  + Q+ L   VE+ + L    QQ
Sbjct: 800 SQMEVYKNKAQEIFNQIQSKQAVMNEQF--AYLLQQKNEKQSQLTGIVEKKASLTHQLQQ 857

Query: 886 PSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIKELKSVIEADAKENPNPNK 945
            +D + D +  +  L+          E+I + I  E + + ++L+  I        + NK
Sbjct: 858 LNDHSVDHQTTEKDLAMQLDQLSDEREKIQTLIYEEKQTQ-QQLQKEINQTEANLADKNK 916

Query: 946 NQKKLQKTREKLVAQLSSRLKELNIDNAYGLWNEYKEDFKASFEYPLGTYEP 997
            Q++L   + ++  ++     E+ +D++       +E++  +F+Y    YEP
Sbjct: 917 QQQQLLSRQTQI--EIQKDRTEVRLDHSL---QYLQEEYNLTFDYAQSNYEP 963


>gi|195470186|ref|XP_002087389.1| GE16637 [Drosophila yakuba]
 gi|194173490|gb|EDW87101.1| GE16637 [Drosophila yakuba]
          Length = 4999

 Score = 40.1 bits (92), Expect = 2.8,   Method: Composition-based stats.
 Identities = 45/195 (23%), Positives = 88/195 (45%), Gaps = 43/195 (22%)

Query: 401  EEKQRREQEAKEKADREKADKEAKEKADR-EKADKDLQEK------TPIKAEGDDFGLGL 453
            E+ QR E+E KE+ +++K +K+ +++ +R EK  K LQE+         + E +      
Sbjct: 1925 EKNQRHEREKKERQEKDKREKDLRKQVEREEKERKALQEEREKEDRKAKEEEKEREREKK 1984

Query: 454  PSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHT 513
                    +   +E   +E +D+ ++ KE    +  ++E+ ER N++         K   
Sbjct: 1985 AQEDREKKEREERELREKEQRDKEQREKEIREKDLREKEQRERDNRE---------KELR 2035

Query: 514  KNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQ 573
            + E                  ++ + ++QREK L       E D       ++EKE +E+
Sbjct: 2036 EKELRE---------------KEMREKEQREKELHR-----EKD-------QREKEHREK 2068

Query: 574  EENLRVAEIIQQSRM 588
            E++ R  E+ Q+SR+
Sbjct: 2069 EQSRRAMEVEQESRV 2083


>gi|169648417|gb|ACA62210.1| Mi-2 [Drosophila melanogaster]
          Length = 393

 Score = 40.1 bits (92), Expect = 2.8,   Method: Composition-based stats.
 Identities = 18/68 (26%), Positives = 37/68 (54%)

Query: 401 EEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHS 460
           E+K +  ++ K+K   EK++ + +++A+ +K   D++++ P++    D       V T  
Sbjct: 5   EDKDKDSEKEKDKTSAEKSEVKQEQEAEEDKKPGDVKQENPVEEAAGDTKPSDAEVKTEV 64

Query: 461 VKLPPKEE 468
            K  PKEE
Sbjct: 65  AKTEPKEE 72


>gi|169648399|gb|ACA62201.1| Mi-2 [Drosophila melanogaster]
          Length = 393

 Score = 40.1 bits (92), Expect = 2.8,   Method: Composition-based stats.
 Identities = 18/68 (26%), Positives = 37/68 (54%)

Query: 401 EEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHS 460
           E+K +  ++ K+K   EK++ + +++A+ +K   D++++ P++    D       V T  
Sbjct: 5   EDKDKDSEKEKDKTSAEKSEVKQEQEAEEDKKPGDVKQENPVEEAAGDTKPSDAEVKTEV 64

Query: 461 VKLPPKEE 468
            K  PKEE
Sbjct: 65  AKTEPKEE 72


>gi|169648395|gb|ACA62199.1| Mi-2 [Drosophila melanogaster]
 gi|169648397|gb|ACA62200.1| Mi-2 [Drosophila melanogaster]
 gi|169648401|gb|ACA62202.1| Mi-2 [Drosophila melanogaster]
 gi|169648403|gb|ACA62203.1| Mi-2 [Drosophila melanogaster]
 gi|169648405|gb|ACA62204.1| Mi-2 [Drosophila melanogaster]
 gi|169648407|gb|ACA62205.1| Mi-2 [Drosophila melanogaster]
 gi|169648409|gb|ACA62206.1| Mi-2 [Drosophila melanogaster]
 gi|169648411|gb|ACA62207.1| Mi-2 [Drosophila melanogaster]
 gi|169648413|gb|ACA62208.1| Mi-2 [Drosophila melanogaster]
 gi|169648415|gb|ACA62209.1| Mi-2 [Drosophila melanogaster]
 gi|169648421|gb|ACA62212.1| Mi-2 [Drosophila melanogaster]
 gi|169648425|gb|ACA62214.1| Mi-2 [Drosophila melanogaster]
 gi|169648433|gb|ACA62218.1| Mi-2 [Drosophila melanogaster]
 gi|169648437|gb|ACA62220.1| Mi-2 [Drosophila melanogaster]
 gi|169648439|gb|ACA62221.1| Mi-2 [Drosophila melanogaster]
 gi|169648443|gb|ACA62223.1| Mi-2 [Drosophila melanogaster]
 gi|169648449|gb|ACA62226.1| Mi-2 [Drosophila melanogaster]
 gi|169648451|gb|ACA62227.1| Mi-2 [Drosophila melanogaster]
          Length = 393

 Score = 40.1 bits (92), Expect = 2.8,   Method: Composition-based stats.
 Identities = 18/68 (26%), Positives = 37/68 (54%)

Query: 401 EEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHS 460
           E+K +  ++ K+K   EK++ + +++A+ +K   D++++ P++    D       V T  
Sbjct: 5   EDKDKDSEKEKDKTSAEKSEVKQEQEAEEDKKPGDVKQENPVEEAAGDTKPSDAEVKTEV 64

Query: 461 VKLPPKEE 468
            K  PKEE
Sbjct: 65  AKTEPKEE 72


>gi|24641961|ref|NP_536743.2| mushroom body defect, isoform C [Drosophila melanogaster]
 gi|22832727|gb|AAN09584.1| mushroom body defect, isoform C [Drosophila melanogaster]
          Length = 1871

 Score = 40.1 bits (92), Expect = 2.8,   Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 53/99 (53%), Gaps = 4/99 (4%)

Query: 895  ELQTQLSRAKKYKESNDERIVSFIRSEFEREIKEL---KSVIEADAKENPNPNKNQKKLQ 951
            E QT+LS   + ++ + +++V  ++ E ++E KEL   KSVIEA  K + +  + ++  Q
Sbjct: 1373 EAQTKLSDDLQRQKESAQQLVDNLKVELDKERKELAKVKSVIEAQTKLSDDLQRQKESAQ 1432

Query: 952  KTREKLVAQLSSRLKEL-NIDNAYGLWNEYKEDFKASFE 989
            +  + L  +L    KEL  + +A G   +  +D +   E
Sbjct: 1433 QLVDNLKMELDKERKELAQVKSAIGAQTKLSDDLECQKE 1471



 Score = 38.9 bits (89), Expect = 5.3,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 53/97 (54%), Gaps = 4/97 (4%)

Query: 897  QTQLSRAKKYKESNDERIVSFIRSEFEREIKEL---KSVIEADAKENPNPNKNQKKLQKT 953
            QT+LS   + ++ + +++V  ++ E E+E KEL   KSVIEA  K + +  + ++  Q+ 
Sbjct: 1207 QTKLSDDLECQKESGQQLVDNLKVELEKERKELAQVKSVIEAQTKLSDDLQREKESAQQL 1266

Query: 954  REKLVAQLSSRLKEL-NIDNAYGLWNEYKEDFKASFE 989
             + L  +L    KEL  +++A+    +  +D +   E
Sbjct: 1267 VDNLKVELDKERKELAQVNSAFEAQTKLSDDLQRQKE 1303


>gi|56205559|emb|CAI25527.1| myosin, heavy polypeptide 10, non-muscle [Mus musculus]
 gi|56206613|emb|CAI25575.1| myosin, heavy polypeptide 10, non-muscle [Mus musculus]
          Length = 2007

 Score = 40.1 bits (92), Expect = 2.9,   Method: Composition-based stats.
 Identities = 72/301 (23%), Positives = 124/301 (41%), Gaps = 73/301 (24%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   EVL  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 1007 AEAKIKKMEEEVLLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 1061

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQ--------PPLYTIISGSE 810
            K E  +SD+   L+K  KT  ++ + K +L G   D+ Q+Q          L   ++  E
Sbjct: 1062 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDL-QDQIAELQAQVDELKVQLTKKE 1120

Query: 811  KILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFER 864
            + LQG      D T    ++L V  +  +  ++L E F                    E+
Sbjct: 1121 EELQGALARGDDETLHKNNALKVARELQAQIAELQEDFES------------------EK 1162

Query: 865  SLKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFER 924
            + +N+A             +Q  D + +L+ L+T+L        +  E     +R++ E+
Sbjct: 1163 ASRNKAE------------KQKRDLSEELEALKTELEDTLDTTAAQQE-----LRTKREQ 1205

Query: 925  EIKELKSVIEADAKENPNPNKNQKKLQKTR-EKLVAQL--SSRLKELNIDNAYGLWNEYK 981
            E+ ELK  +E + K +    ++ ++   T  E+L  QL  + R K     N  GL  + K
Sbjct: 1206 EVAELKKALEDETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNK 1265

Query: 982  E 982
            E
Sbjct: 1266 E 1266


>gi|284161186|ref|YP_003399809.1| SMC domain protein [Archaeoglobus profundus DSM 5631]
 gi|284011183|gb|ADB57136.1| SMC domain protein [Archaeoglobus profundus DSM 5631]
          Length = 868

 Score = 40.1 bits (92), Expect = 2.9,   Method: Composition-based stats.
 Identities = 54/239 (22%), Positives = 103/239 (43%), Gaps = 25/239 (10%)

Query: 750 RLVKEDPKRGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLYTIISGS 809
           RL+ ED +    +SY      +L+ V K +++I  KL      +DI   +  L ++IS  
Sbjct: 441 RLLSEDDRLNLIKSY----TKKLENVRKDLIEIENKL------EDIKNVKKELESVISEE 490

Query: 810 EKILQGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYA----FERS 865
            +IL+       L +L          +K FE     W      EE    + A     E  
Sbjct: 491 SRILREYELAKELENL-------KKSTKGFEEAEAAWKEYRKLEELALKLSADISVIESD 543

Query: 866 LKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFERE 925
           LK++  LN+++  L+    +  +  ++LK++     +  +   +   R+VS  + + ER+
Sbjct: 544 LKSEQELNSKLIELNSKIDEVEEKLSNLKKIDESTLKELESYYNEFNRLVS-AKHDLERK 602

Query: 926 IKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKELNIDNAYGLWNEYKEDF 984
           ++ELKS      K     ++  K+L+  + ++ A   S   +    N Y L+ E +  +
Sbjct: 603 LEELKSCESEIVKAEDELSETLKRLESLKNEIEALGYS---DETYRNVYNLYTELRSRY 658


>gi|282907104|ref|ZP_06314952.1| immunoglobulin G-binding protein A [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|297589143|ref|ZP_06947784.1| immunoglobulin G binding protein A [Staphylococcus aureus subsp.
           aureus MN8]
 gi|282330003|gb|EFB59524.1| immunoglobulin G-binding protein A [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|297577654|gb|EFH96367.1| immunoglobulin G binding protein A [Staphylococcus aureus subsp.
           aureus MN8]
          Length = 520

 Score = 39.7 bits (91), Expect = 2.9,   Method: Composition-based stats.
 Identities = 58/236 (24%), Positives = 87/236 (36%), Gaps = 39/236 (16%)

Query: 341 QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSE--------LKQAT 392
           + K+L D A   KAD         N+F  E + A+  I ++ N T E        LK   
Sbjct: 270 EAKKLND-AQAPKAD---------NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDP 319

Query: 393 VLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQE--KTPIKAEGDDFG 450
            +++    E K+  + +A ++ D  K  KE   K  +E  +K  +E  K P K +G+  G
Sbjct: 320 SVSKEILAEAKKLNDAQAPKEEDNNKPGKEDNNKPGKEDGNKPGKEDNKKPGKEDGNKPG 379

Query: 451 LGLPSVP-THSVKLPPKEEELEEVKDEGKK-GKE-----------------PGTTETDDR 491
                 P       P KE+  +  K++G K GKE                 PG T  D  
Sbjct: 380 KEDNKKPGKEDGNKPGKEDGNKPGKEDGNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDIA 439

Query: 492 EETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPL 547
           +        I  ++ LA K   K     +   K P   A        P+   E P 
Sbjct: 440 KANGTTADKIAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEENPF 495


>gi|154417657|ref|XP_001581848.1| hypothetical protein [Trichomonas vaginalis G3]
 gi|121916079|gb|EAY20862.1| conserved hypothetical protein [Trichomonas vaginalis G3]
          Length = 919

 Score = 39.7 bits (91), Expect = 2.9,   Method: Composition-based stats.
 Identities = 38/212 (17%), Positives = 98/212 (46%), Gaps = 5/212 (2%)

Query: 400 QEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTH 459
           +E+K+     A+EK + E    E K++ +    ++  +E+TP++ + ++     P+    
Sbjct: 685 EEKKEEESPVAEEKKEEETPVAEEKKEEETPAVEEKKEEETPVEEKKEE---ETPAEEKK 741

Query: 460 SVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPA 519
             + P +E++ EE   E KK + P T E   +EE     ++  +      +   + ETPA
Sbjct: 742 EEETPVEEKKEEETPAEEKKEETPATEEK--KEEESPVAEEKKEEETPVAEEKKEEETPA 799

Query: 520 IPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRV 579
           +   K       +  +++ P +++++         E +    +  ++E  ++E++E    
Sbjct: 800 VEEKKEEETPVEEKKEEETPAEEKKEEETPVEEKKEEETPAEEKKEEETPVEEKKEEETP 859

Query: 580 AEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDE 611
           AE  ++    +++ +E+     ++ + ++P +
Sbjct: 860 AEEKKEEETPAQEKKEETPAVKEKKEEVAPQQ 891


>gi|239916458|gb|ACS34715.1| CagA [Helicobacter pylori NCTC 11639]
          Length = 1189

 Score = 39.7 bits (91), Expect = 3.0,   Method: Composition-based stats.
 Identities = 44/188 (23%), Positives = 80/188 (42%), Gaps = 24/188 (12%)

Query: 101 LKRLAETGEVILSDKSDRLLCRFMDMVETEDEHKINKQVRDALESAGFDLESTQENIRKV 160
           L  LA T   I  D  D+L  + +   ET      NK ++D L S   +L     N+ K 
Sbjct: 552 LNNLAIT-SYIRRDLEDKLWAKGLSPQET------NKLIKDFLNSNK-ELVEKVSNLNKA 603

Query: 161 ESALIN----NNMKDAFRFLELAQKSKETADSHIIEAIDVGTKLKENTPPTTFTSISKVL 216
            +   N    + +K A + LE + + +E  +  +++ ++     K               
Sbjct: 604 VAEAKNTGNYDEVKKAQKDLEKSLRKREHLEKEVVKKLENRNDNKNRMEAKA-------- 655

Query: 217 LKSNNMQDVVFTKIKEVVKKHVNAELGHRKLRGLAFDHTYFNDKLNQFLKEIKNHQKEYD 276
            ++N+ +D +F  I E   K   A    + L+G+  +    +DKL    K++K+  K +D
Sbjct: 656 -QANSQKDKIFAIINEEASKEARAAAYVQNLKGIRME---LSDKLENINKDLKDFDKSFD 711

Query: 277 ESEKGSSK 284
           E + G +K
Sbjct: 712 EFKNGKNK 719


>gi|313236520|emb|CBY11834.1| unnamed protein product [Oikopleura dioica]
          Length = 1589

 Score = 39.7 bits (91), Expect = 3.0,   Method: Composition-based stats.
 Identities = 52/216 (24%), Positives = 102/216 (47%), Gaps = 18/216 (8%)

Query: 397 ANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDL-QEKTPI--KAEG-----DD 448
           + A+E K+ ++ E      +++ +KE K +A+ E+   +L QE+  +  KAE      DD
Sbjct: 536 SQAEEGKKMQDLEKNYDEVKKQLEKEKKRRAELEEQSVNLEQERNELTQKAEAQNELLDD 595

Query: 449 FGLGLPSVPTHSVKLPPKEEELEE-VKDEGKKGKEPGTTETDDREETERKNQDILDNSLL 507
                  +  + ++L  K  EL+E ++DE +   E    +    +E+    +DI D  L 
Sbjct: 596 AEGRCEELIGNKIELDSKIRELQEKLEDEEEMNNELVAKKRKLEDESSELKKDIDDLELT 655

Query: 508 AGKTH-----TKNETPAIPTAKAPPAQA-HKGIQDKKPQDQREKPLASDIGVGESDYAGI 561
             K       T+N++  +    A  +++ HK  ++KK   +  K    D+   E     +
Sbjct: 656 LAKIEKEKHATENKSKNVTEELATISESIHKLEKEKKALQEAHKQTLGDLQSEEEKV--V 713

Query: 562 KLTKKEKELQEQEENLRVA-EIIQQSRMQSEDLQEK 596
            L+K + +L++Q ++L +  E  ++SRM  E  + K
Sbjct: 714 NLSKSKGKLEQQVDDLEIGLEAEKKSRMDLERAKRK 749


>gi|149052999|gb|EDM04816.1| myosin, heavy polypeptide 10, non-muscle, isoform CRA_b [Rattus
            norvegicus]
          Length = 1976

 Score = 39.7 bits (91), Expect = 3.0,   Method: Composition-based stats.
 Identities = 72/301 (23%), Positives = 124/301 (41%), Gaps = 73/301 (24%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   EVL  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 976  AEAKIKKMEEEVLLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 1030

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQ--------PPLYTIISGSE 810
            K E  +SD+   L+K  KT  ++ + K +L G   D+ Q+Q          L   ++  E
Sbjct: 1031 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDL-QDQIAELQAQVDELKVQLTKKE 1089

Query: 811  KILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFER 864
            + LQG      D T    ++L V  +  +  ++L E F                    E+
Sbjct: 1090 EELQGALARGDDETLHKNNALKVARELQAQIAELQEDFES------------------EK 1131

Query: 865  SLKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFER 924
            + +N+A             +Q  D + +L+ L+T+L        +  E     +R++ E+
Sbjct: 1132 ASRNKAE------------KQKRDLSEELEALKTELEDTLDTTAAQQE-----LRTKREQ 1174

Query: 925  EIKELKSVIEADAKENPNPNKNQKKLQKTR-EKLVAQL--SSRLKELNIDNAYGLWNEYK 981
            E+ ELK  +E + K +    ++ ++   T  E+L  QL  + R K     N  GL  + K
Sbjct: 1175 EVAELKKALEDETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNK 1234

Query: 982  E 982
            E
Sbjct: 1235 E 1235


>gi|33598964|ref|NP_780469.1| myosin-10 [Mus musculus]
 gi|71152969|sp|Q61879|MYH10_MOUSE RecName: Full=Myosin-10; AltName: Full=Cellular myosin heavy chain,
            type B; AltName: Full=Myosin heavy chain 10; AltName:
            Full=Myosin heavy chain, non-muscle IIb; AltName:
            Full=Non-muscle myosin heavy chain B; Short=NMMHC-B;
            AltName: Full=Non-muscle myosin heavy chain IIb;
            Short=NMMHC II-b; Short=NMMHC-IIB
 gi|56205560|emb|CAI25528.1| myosin, heavy polypeptide 10, non-muscle [Mus musculus]
 gi|56206614|emb|CAI25576.1| myosin, heavy polypeptide 10, non-muscle [Mus musculus]
 gi|57242967|gb|AAH89011.1| Myosin, heavy polypeptide 10, non-muscle [Mus musculus]
          Length = 1976

 Score = 39.7 bits (91), Expect = 3.0,   Method: Composition-based stats.
 Identities = 72/301 (23%), Positives = 124/301 (41%), Gaps = 73/301 (24%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   EVL  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 976  AEAKIKKMEEEVLLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 1030

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQ--------PPLYTIISGSE 810
            K E  +SD+   L+K  KT  ++ + K +L G   D+ Q+Q          L   ++  E
Sbjct: 1031 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDL-QDQIAELQAQVDELKVQLTKKE 1089

Query: 811  KILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFER 864
            + LQG      D T    ++L V  +  +  ++L E F                    E+
Sbjct: 1090 EELQGALARGDDETLHKNNALKVARELQAQIAELQEDFES------------------EK 1131

Query: 865  SLKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFER 924
            + +N+A             +Q  D + +L+ L+T+L        +  E     +R++ E+
Sbjct: 1132 ASRNKAE------------KQKRDLSEELEALKTELEDTLDTTAAQQE-----LRTKREQ 1174

Query: 925  EIKELKSVIEADAKENPNPNKNQKKLQKTR-EKLVAQL--SSRLKELNIDNAYGLWNEYK 981
            E+ ELK  +E + K +    ++ ++   T  E+L  QL  + R K     N  GL  + K
Sbjct: 1175 EVAELKKALEDETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNK 1234

Query: 982  E 982
            E
Sbjct: 1235 E 1235


>gi|325913908|ref|ZP_08176267.1| PAS domain S-box [Xanthomonas vesicatoria ATCC 35937]
 gi|325539983|gb|EGD11620.1| PAS domain S-box [Xanthomonas vesicatoria ATCC 35937]
          Length = 1178

 Score = 39.7 bits (91), Expect = 3.0,   Method: Composition-based stats.
 Identities = 47/214 (21%), Positives = 95/214 (44%), Gaps = 30/214 (14%)

Query: 83  LTLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLLC-RFMDMVE----TEDEHKINK 137
           + L  E  ++D  E+       A+ G V + +   R+   R   M+E    T +E K + 
Sbjct: 624 VVLFQEVEVRDPLELAGPRDAAADRGHVQVLENELRITRERLQSMIEELESTNEELKSSN 683

Query: 138 Q----VRDALESAGFDLESTQENIRKVESALINNNMKDAFRFLELAQKSKETADSHIIEA 193
           +    + + L+SA  +LE+++E ++ V   +   N + A R  ELA  + +  +  ++E+
Sbjct: 684 EEYQSLNEELQSANEELETSKEELQSVNEEVTTVNGELAHRVQELAHANSDLKN--LLES 741

Query: 194 IDVGTKLKENTPPTTFTSISKVLLKSNNMQDVVFTKIKEVVKKHVNAELGHRKLRGLAFD 253
             + T   +N             L+  N    + T I  +V+  ++  + H KL  +A+D
Sbjct: 742 TQIATLFLDNE------------LRVTNFTPAI-TDILPLVESDIHRPISHIKLH-VAYD 787

Query: 254 HTYFNDKLNQFLKEIKNHQKEYDESEKGSSKARY 287
                D + + ++ +  H +E    E  ++ ARY
Sbjct: 788 E--LQDDVRRVIRTLAVHDREV---ENPATHARY 816


>gi|1477559|gb|AAC47238.1| non-muscle myosin heavy chain II [Caenorhabditis elegans]
          Length = 2003

 Score = 39.7 bits (91), Expect = 3.0,   Method: Composition-based stats.
 Identities = 34/116 (29%), Positives = 55/116 (47%), Gaps = 13/116 (11%)

Query: 867  KNQAHLNAEVERLSGLAQ----QPS--DSTADLKELQTQLSRAK----KYKESNDERIVS 916
            K Q H NAE  R +   Q    Q S  + T   +EL  QL R +    +    NDE + +
Sbjct: 1057 KQQRH-NAETARRAAETQLREEQESCLEKTRKAEELTNQLMRKESELSQISIRNDEELAA 1115

Query: 917  FIRSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKELNIDN 972
              R + EREI+E+++ ++   +E       ++K +K R  +  +L S  +EL   N
Sbjct: 1116 --RQQLEREIREIRAQLDDAIEETNKEQAARQKAEKARRDMAEELESYKQELEESN 1169



 Score = 38.9 bits (89), Expect = 5.5,   Method: Composition-based stats.
 Identities = 102/516 (19%), Positives = 206/516 (39%), Gaps = 71/516 (13%)

Query: 92   KDLKEVGDTLKRLAETGEVILSDKSDRLLCRFMDMVETEDEHKINKQVR---DALESAGF 148
            ++LK   + L+R     EV +SD        +   +E  DE ++  + R   ++ E A  
Sbjct: 869  QELKVTAEKLRR----SEVFISD--------YKQQMEKMDEERLVLKTRLDAESSERAEI 916

Query: 149  DLESTQENIRKVESALINNNMKDAFRFLELAQKSKETADSHIIEAIDVGTKLKENTPPTT 208
              E ++   R+ E   +   +++  + LE+ ++  + ADS   +  ++   L+EN     
Sbjct: 917  FEERSRMAARRDE---LEGILEEVSKRLEIEEQKAKKADSESRKLTEMVRHLEENLEDEE 973

Query: 209  FTSISKVLLKSNNMQDVVFTKIKEVVKKHVNAELGHRKLRGLAFDHTYFNDKLNQFLKEI 268
              S  K+LL+ N+++    +++KE+  + +  E    KL       +     L +  +++
Sbjct: 974  -RSRQKLLLEKNSIE----SRLKELEAQGLELEDSGNKL-------SKEKKALEERCEDL 1021

Query: 269  KNHQKEYDESEKGS----SKARYHAAYAHIYWDLANDWVNGRVGDKSDEWARTS--TNIA 322
             +  +  DE E+      +KAR  A  A I  +L  +       + +   A T       
Sbjct: 1022 SS--RLIDEVERSKQLVKAKARLEATVAEINDELEKEKQQRHNAETARRAAETQLREEQE 1079

Query: 323  SWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVA 382
            S + +  + E L      +  +L  ++  ++ D   A  +   R   E R          
Sbjct: 1080 SCLEKTRKAEELTNQLMRKESELSQIS--IRNDEELAARQQLEREIREIRAQLDDAIEET 1137

Query: 383  NFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPI 442
            N     +Q    AR +  EE +  +QE +E  D+     + K K D E A    Q +  +
Sbjct: 1138 NKEQAARQKAEKARRDMAEELESYKQELEESNDKTVLHSQLKAKRDEEYAHLQKQLEETV 1197

Query: 443  KAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDIL 502
            K+                      EE +EE+K + +K  E    ET D+ + ++ + D  
Sbjct: 1198 KSS---------------------EEVVEEMKAQNQKKIEE-LNETIDQLKRQKISADKA 1235

Query: 503  DNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDK-KPQDQREKPLASDIGVGESDYAGI 561
             +S  +   + + E   I +A+    +  K  +     +D + + + S++     D    
Sbjct: 1236 KSSAESDNENFRAELSNIASARLEAEKKRKAAETSLMEKDHKMREMQSNL-----DDLMA 1290

Query: 562  KLTKKEKELQEQEENLRVAEIIQQSRMQ---SEDLQ 594
            KL+K   EL+  ++     E +  + ++   S D+Q
Sbjct: 1291 KLSKMNNELESIQKAKSADETLNSNLLKKNASLDMQ 1326


>gi|302756025|ref|XP_002961436.1| hypothetical protein SELMODRAFT_437797 [Selaginella moellendorffii]
 gi|300170095|gb|EFJ36696.1| hypothetical protein SELMODRAFT_437797 [Selaginella moellendorffii]
          Length = 769

 Score = 39.7 bits (91), Expect = 3.1,   Method: Composition-based stats.
 Identities = 37/158 (23%), Positives = 69/158 (43%), Gaps = 11/158 (6%)

Query: 814 QGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERSLKN-QAHL 872
           Q ++    +  LD +SKF+  +    E+      +NA+++E    +   +   +  +A L
Sbjct: 589 QEEFLAQTVQQLDYKSKFEVLWQ---EVNLRSEQDNAMQQEHERAVSTLQEKFQTMEAEL 645

Query: 873 NAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIKELKSV 932
           NA +  L    +        L++   QL  +      N E      ++EF+REI  LK  
Sbjct: 646 NARISSLEKQLRSKESCVIQLEQEIAQLHDSMDILNQNHEERRKRDQTEFQREITALKLE 705

Query: 933 IEADAKENPNPNKNQKK------LQKTR-EKLVAQLSS 963
           ++   + N + ++  +K      L+KTR E  +  LSS
Sbjct: 706 LQTAKQANHSLSEQLEKQQQNSLLEKTRLEAQIQDLSS 743


>gi|229163818|ref|ZP_04291761.1| S-layer y domain protein [Bacillus cereus R309803]
 gi|228619638|gb|EEK76521.1| S-layer y domain protein [Bacillus cereus R309803]
          Length = 888

 Score = 39.7 bits (91), Expect = 3.1,   Method: Composition-based stats.
 Identities = 58/263 (22%), Positives = 122/263 (46%), Gaps = 40/263 (15%)

Query: 376 STIANVANFTSELKQATVLARANAQEEKQRREQEAKEKA----DREKADKEAKE---KAD 428
           S++A + N T    +A    ++N + E Q++ +  KE+      RE+  K+ +E   K D
Sbjct: 24  SSLAEIENKTRNSIEALPHIQSNEKSELQKQLEAVKERQIELEKREEILKQQEELFVKVD 83

Query: 429 REKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGK--KGKEPGTT 486
             K +KD      +K +G+           H V+L   ++EL+E+K +    +GK P   
Sbjct: 84  ELKQEKD----ELLKQDGE-----------HKVQLEEVQQELDELKKQQAELEGKNPLQV 128

Query: 487 ETDDREE----TERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQD------ 536
           + ++ E+     +++ +    N+L   + + + E       +       K  QD      
Sbjct: 129 KDNNEEKKAAELKKQEELEEKNALEIKENNNQEEKTLEELEEQKKKDELKKQQDELRKQQ 188

Query: 537 ---KKPQDQREKPLASDIGVGE-SDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSED 592
              KK Q + E+ +  ++ V +  + A  KL  K+KE Q +++ L + +  +Q++ + E 
Sbjct: 189 EELKKQQLEMEQQIKQELEVKQKEEQAKQKLELKQKEEQAKQK-LELKQKEEQAKQELE- 246

Query: 593 LQEKAWDSYKEWKSLSPDEIKQR 615
           L++K   + +E++    +E ++R
Sbjct: 247 LKQKEEQTKREFELKQKEEQEKR 269


>gi|301606674|ref|XP_002932943.1| PREDICTED: hypoxia up-regulated protein 1 [Xenopus (Silurana)
           tropicalis]
          Length = 985

 Score = 39.7 bits (91), Expect = 3.1,   Method: Composition-based stats.
 Identities = 51/170 (30%), Positives = 74/170 (43%), Gaps = 36/170 (21%)

Query: 456 VPTHSVKLPPKEEELEEVKDEGK-KGKEPGTTETDDREETERKNQDILDNSLLAGKTHTK 514
           VPT     P KEEE E      K K KE GTT T++ EE +++ +          +   K
Sbjct: 606 VPTE----PTKEEEQESADAADKQKDKEKGTTATNEEEEGKKEEEKSEPQEEKEKQETGK 661

Query: 515 NETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGES-----DYAGIKLTKKEKE 569
            E     +AKAP   A K    KK      + L  DIGV ++     D++  +L K  K+
Sbjct: 662 EEA----SAKAPEVDAKKHTAPKK------QKLVDDIGVEQTLNDIPDFSEEELKKASKK 711

Query: 570 LQEQEENLRVAEIIQQSRMQSEDLQEKAWDS-----YKEWKSLSPDEIKQ 614
           LQ+  E           R  ++  +EKA +S     ++    L+ DE KQ
Sbjct: 712 LQDLTE-----------RDLNKHEREKAANSLEAFIFETQDKLNQDEFKQ 750


>gi|71983975|ref|NP_492186.3| Non-muscle MYosin family member (nmy-2) [Caenorhabditis elegans]
 gi|14530418|emb|CAA99841.2| C. elegans protein F20G4.3, confirmed by transcript evidence
            [Caenorhabditis elegans]
 gi|14530566|emb|CAA99931.2| C. elegans protein F20G4.3, confirmed by transcript evidence
            [Caenorhabditis elegans]
          Length = 2003

 Score = 39.7 bits (91), Expect = 3.2,   Method: Composition-based stats.
 Identities = 34/116 (29%), Positives = 55/116 (47%), Gaps = 13/116 (11%)

Query: 867  KNQAHLNAEVERLSGLAQ----QPS--DSTADLKELQTQLSRAK----KYKESNDERIVS 916
            K Q H NAE  R +   Q    Q S  + T   +EL  QL R +    +    NDE + +
Sbjct: 1057 KQQRH-NAETARRAAETQLREEQESCLEKTRKAEELTNQLMRKESELSQISIRNDEELAA 1115

Query: 917  FIRSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKELNIDN 972
              R + EREI+E+++ ++   +E       ++K +K R  +  +L S  +EL   N
Sbjct: 1116 --RQQLEREIREIRAQLDDAIEETNKEKAARQKAEKARRDMAEELESYKQELEESN 1169



 Score = 38.9 bits (89), Expect = 5.3,   Method: Composition-based stats.
 Identities = 102/516 (19%), Positives = 206/516 (39%), Gaps = 71/516 (13%)

Query: 92   KDLKEVGDTLKRLAETGEVILSDKSDRLLCRFMDMVETEDEHKINKQVR---DALESAGF 148
            ++LK   + L+R     EV +SD        +   +E  DE ++  + R   ++ E A  
Sbjct: 869  QELKVTAEKLRR----SEVFISD--------YKQQMEKMDEERLVLKTRLDAESSERAEI 916

Query: 149  DLESTQENIRKVESALINNNMKDAFRFLELAQKSKETADSHIIEAIDVGTKLKENTPPTT 208
              E ++   R+ E   +   +++  + LE+ ++  + ADS   +  ++   L+EN     
Sbjct: 917  FEERSRMAARRDE---LEGILEEVSKRLEIEEQKAKKADSESRKLTEMVRHLEENLEDEE 973

Query: 209  FTSISKVLLKSNNMQDVVFTKIKEVVKKHVNAELGHRKLRGLAFDHTYFNDKLNQFLKEI 268
              S  K+LL+ N+++    +++KE+  + +  E    KL       +     L +  +++
Sbjct: 974  -RSRQKLLLEKNSIE----SRLKELEAQGLELEDSGNKL-------SKEKKALEERCEDL 1021

Query: 269  KNHQKEYDESEKGS----SKARYHAAYAHIYWDLANDWVNGRVGDKSDEWARTS--TNIA 322
             +  +  DE E+      +KAR  A  A I  +L  +       + +   A T       
Sbjct: 1022 SS--RLIDEVERSKQLVKAKARLEATVAEINDELEKEKQQRHNAETARRAAETQLREEQE 1079

Query: 323  SWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVA 382
            S + +  + E L      +  +L  ++  ++ D   A  +   R   E R          
Sbjct: 1080 SCLEKTRKAEELTNQLMRKESELSQIS--IRNDEELAARQQLEREIREIRAQLDDAIEET 1137

Query: 383  NFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPI 442
            N     +Q    AR +  EE +  +QE +E  D+     + K K D E A    Q +  +
Sbjct: 1138 NKEKAARQKAEKARRDMAEELESYKQELEESNDKTVLHSQLKAKRDEEYAHLQKQLEETV 1197

Query: 443  KAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDIL 502
            K+                      EE +EE+K + +K  E    ET D+ + ++ + D  
Sbjct: 1198 KSS---------------------EEVVEEMKAQNQKKIEE-LNETIDQLKRQKISADKA 1235

Query: 503  DNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDK-KPQDQREKPLASDIGVGESDYAGI 561
             +S  +   + + E   I +A+    +  K  +     +D + + + S++     D    
Sbjct: 1236 KSSAESDNENFRAELSNIASARLEAEKKRKAAETSLMEKDHKMREMQSNL-----DDLMA 1290

Query: 562  KLTKKEKELQEQEENLRVAEIIQQSRMQ---SEDLQ 594
            KL+K   EL+  ++     E +  + ++   S D+Q
Sbjct: 1291 KLSKMNNELESIQKAKSADETLNSNLLKKNASLDMQ 1326


>gi|301093911|ref|XP_002997800.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gi|262109886|gb|EEY67938.1| conserved hypothetical protein [Phytophthora infestans T30-4]
          Length = 907

 Score = 39.7 bits (91), Expect = 3.2,   Method: Composition-based stats.
 Identities = 52/213 (24%), Positives = 95/213 (44%), Gaps = 20/213 (9%)

Query: 387 ELKQATVLARA-NAQEEKQRREQEAKEKADREKADKEAKEKADREKA--------DKDLQ 437
           EL++A    R  N+  E+Q+ +Q+     +R  AD EA+ ++  ++         D+   
Sbjct: 327 ELRKAQEETRTINSSFEQQKHQQQLATDRERITADAEAQAQSRIQRLQTQLNVQLDEQAG 386

Query: 438 EKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKK--------GKEPGTTETD 489
            KT +++E  +    L SV    VK  P E++ ++++ E  +         KE    + +
Sbjct: 387 AKTRLQSEVIELRGELASVQAQQVK--PLEKQRDQLQREVDRLAERVPTLEKELRIAKQE 444

Query: 490 DREETERKNQDILDNSLLAGKTHT-KNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLA 548
              +T+R NQ  L+  +L  +    K +T A+ TAK    +    +QD+    Q +K + 
Sbjct: 445 LSTQTDRTNQLELEVDVLVRREQQRKAQTDALTTAKHTVEKQLAALQDELLSAQHDKRVD 504

Query: 549 SDIGVGESDYAGIKLTKKEKELQEQEENLRVAE 581
           SD           ++T+K+ E    EE    AE
Sbjct: 505 SDKLSFRVRELESQVTQKDYEAARLEERFAKAE 537


>gi|123416643|ref|XP_001304938.1| hypothetical protein [Trichomonas vaginalis G3]
 gi|121886424|gb|EAX92008.1| hypothetical protein TVAG_398490 [Trichomonas vaginalis G3]
          Length = 2861

 Score = 39.7 bits (91), Expect = 3.2,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 59/122 (48%), Gaps = 7/122 (5%)

Query: 387  ELKQATVLARANAQEEKQRREQEAKEKADREKADKEAK----EKADREKADKDLQEKTPI 442
            E K+   +  A  QEE+  ++ +  E+AD++K+D+EAK    E   +   D    +K P 
Sbjct: 1665 EQKRKAAVEEAKKQEEEDGKKNKEVEEADKKKSDEEAKQNEAEDGMKNSEDSKQNQKEPE 1724

Query: 443  KAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGK-EPGTTET--DDREETERKNQ 499
              E  DF   +    +   +     +E +E KD+ K+ + +PG  E+   D +  E+K +
Sbjct: 1725 TVEQRDFASVIKEKLSQDKEPNNPVDESKETKDQSKESESKPGKEESKVSDSKSDEKKQE 1784

Query: 500  DI 501
             +
Sbjct: 1785 TV 1786


>gi|11467826|ref|NP_050877.1| hypothetical chloroplast RF2 [Nephroselmis olivacea]
 gi|5880755|gb|AAD54848.1|AF137379_71 hypothetical chloroplast RF2 [Nephroselmis olivacea]
          Length = 3742

 Score = 39.7 bits (91), Expect = 3.2,   Method: Composition-based stats.
 Identities = 31/143 (21%), Positives = 66/143 (46%), Gaps = 31/143 (21%)

Query: 401  EEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHS 460
            E K   ++E  E+ D++K + E +E  D+   D D + +  ++ +G              
Sbjct: 2299 EPKTEEQEENNEETDQQKDEVENQE--DQNVQDNDQENRPDVEDDGQS------------ 2344

Query: 461  VKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAI 520
                PK+ E ++ +D  ++ +EP T + D  ++TE+++Q+         KT  +++ P  
Sbjct: 2345 ----PKDAEKDQGQDTEQQDQEPKTEQQDQGQDTEQQDQE--------PKTEQQDQGP-- 2390

Query: 521  PTAKAPPAQAHKGIQDKKPQDQR 543
               K       + + + +P+DQR
Sbjct: 2391 ---KTEQQDQAEDLLNAEPEDQR 2410


>gi|169648447|gb|ACA62225.1| Mi-2 [Drosophila melanogaster]
          Length = 393

 Score = 39.7 bits (91), Expect = 3.3,   Method: Composition-based stats.
 Identities = 18/68 (26%), Positives = 37/68 (54%)

Query: 401 EEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHS 460
           E+K +  ++ K+K   EK++ + +++A+ +K   D++++ P++    D       V T  
Sbjct: 5   EDKDKDSEKEKDKTSAEKSEVKQEQEAEEDKKPGDVKQENPVEEAAGDTKPSDAEVKTEV 64

Query: 461 VKLPPKEE 468
            K  PKEE
Sbjct: 65  AKTEPKEE 72


>gi|268560050|ref|XP_002637954.1| Hypothetical protein CBG04771 [Caenorhabditis briggsae]
          Length = 1284

 Score = 39.7 bits (91), Expect = 3.3,   Method: Composition-based stats.
 Identities = 132/620 (21%), Positives = 246/620 (39%), Gaps = 87/620 (14%)

Query: 409 EAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEE 468
           E  E+  +   ++E   K  RE  D  LQ K   KA     GL   +V  HS+++  +E 
Sbjct: 43  ETTEELKKRLLEQEQLIKDIREDRDT-LQTKLIDKA-----GLNESAVVEHSIRVSTQET 96

Query: 469 ELE----EVKDEGKKGKEPGTTETDDR-EETERKNQDILDNSLLAGKTHTKNETPAIPTA 523
           ++     EV ++    K+    E  D+    E++NQ ++             ET    + 
Sbjct: 97  KIYSRDIEVLEKVLALKQKEIRELQDKCRSLEQENQRMV-------------ETIKTGSD 143

Query: 524 KAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEII 583
                +    +  K+  D  ++ +     + + +    K+  K + L E E N  +AE+ 
Sbjct: 144 DQKEIEEELNLLRKRVLDLEKENVFKSEEIYQKNDELQKMMDKLRNLSE-EYNRTMAEMA 202

Query: 584 QQSRMQSEDLQEKAWDSYKE--WKSLSPDEIKQRFQKYAKVFYRSYS------PVDGSYK 635
              RM  E L +K     KE   KSL   + K+  QK      +  S      PV    +
Sbjct: 203 SGKRMLEEKL-DKYRSRLKESDRKSLEDHKEKENTQKVLSEVKQLRSQIDFLTPVRKDSR 261

Query: 636 GTQESDKAINHFLDNDFGYYRIHNFLSQWSPLGLMYEKDELHGVEAVYQKLDVLFRHCIE 695
             +E+D+ +      +F    I   +S+        E+D     E        L +   E
Sbjct: 262 LKKENDEML------EFSAKLIKETMSELKSKNAKLEEDLAEKNE--------LVKRTKE 307

Query: 696 NLRANKNAVDAMSKAVEAGESSVRKHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKED 755
            L A K ++DA   A+   +++ +    E +    QK+ I       ++    R+L   D
Sbjct: 308 ELEALKKSMDA---AMGDSDTATKFLQEENMRLTRQKADIRC-----DLIDARRQLTTFD 359

Query: 756 PKRGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQ-PPLYTIISGSEKI-L 813
            K+ + E    D   E +++++    +  +L    I     ++Q   L T I+G E I  
Sbjct: 360 QKKAELEKQRDDALEEAKRISELKKRVEQELEELTILPTQREQQIEELQTRIAGLEVIKR 419

Query: 814 QGDYTFPPLSS-----------LDVQSKFDSSYSKLFEIFYGDWTNNAIKE--ERYWTIY 860
           + D     LS            L++  K  + +  L E   G     AI++  E    I 
Sbjct: 420 EHDSVKNELSKTNEKLNQMGRHLEMADKQCTHFKSLKETAEGS-RRRAIEQCNEMVVRIR 478

Query: 861 AFERSLKNQAHLNAEVERLSG-----------LAQQPSDSTADLKELQTQLSRAKKYKES 909
             E SL+NQ  +  E+E L             L ++  +   D ++  T LSR K  +  
Sbjct: 479 GLEASLENQRKVEQELETLRAENSRQVQKIEYLKEEIQEVHKDYRQELTTLSRQKSEERR 538

Query: 910 NDE--RIVSFIRSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKE 967
           N+E   ++    S+ E E++  +  IE    +N    +   ++++ ++K++ + + RL++
Sbjct: 539 NEEDVELLKLTLSKRESELRSARKTIEEVKADNLKVQQILDEVRRQQDKILEE-NVRLRQ 597

Query: 968 LNIDNAYGLWNEYKEDFKAS 987
             I  A     ++K++++ S
Sbjct: 598 -GITEALEKIQKHKQNWENS 616


>gi|302913178|ref|XP_003050861.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256731799|gb|EEU45148.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 4743

 Score = 39.7 bits (91), Expect = 3.3,   Method: Composition-based stats.
 Identities = 45/163 (27%), Positives = 64/163 (39%), Gaps = 24/163 (14%)

Query: 397  ANAQEEKQRREQEAKEKADRE---KADKEAKEKADREKAD--------KDLQEKTPIKAE 445
            +NA++EK     EA E  + +    A+KEA+  AD+  AD        +   E TP++A+
Sbjct: 1776 SNAEDEKTALAPEATEAPEEKPEPAAEKEAESVADKSDADDAGSEAPTEKPAEVTPVEAD 1835

Query: 446  --GDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILD 503
              GD      P  P    K    E+E +E  DE K        E     E E   Q    
Sbjct: 1836 AGGDAEKAAEPEAPKEIAK---DEDEAKEPADEAK--------EVASAAEPESAKQPDSS 1884

Query: 504  NSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKP 546
              +    +  K E  A    + P   A     DK+P+   EKP
Sbjct: 1885 PEVAPQASDEKPEDTATIVEEEPAPAAETTAVDKEPESPEEKP 1927


>gi|134075088|emb|CAK39099.1| unnamed protein product [Aspergillus niger]
          Length = 3820

 Score = 39.7 bits (91), Expect = 3.3,   Method: Composition-based stats.
 Identities = 57/236 (24%), Positives = 91/236 (38%), Gaps = 27/236 (11%)

Query: 316  RTSTNIASWIGRITRTEGLGGVTY--DQIKQLRDLASKVKADYHWAEIRHGNRFKAETRL 373
            + S  +A   G +T  EGL G+TY  D  +   +  S    D  W           +T  
Sbjct: 3017 QNSPTLAPAEGAVTADEGLVGLTYTLDTTRSPVEEPSNALHDKQW-----------DTPP 3065

Query: 374  AYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKAD 433
            A        N TS++++  V    +A+E  + RE    E+  +    ++  E A+ E+  
Sbjct: 3066 AQDDGDKEQNQTSQIEEEPV---RSAEEFDEHREVSTAER--QGVVVQQELESANAEQDT 3120

Query: 434  KDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREE 493
            K L EK  + A+ +D    +P  P  S +L  K       K E +K K+    E     E
Sbjct: 3121 KTLTEKHDL-AKTEDLSENIPDQPEASARLTKKLS-----KKERRKAKQRAEQEL---VE 3171

Query: 494  TERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLAS 549
            ++R  Q   D    A     + +   +P A A        +    P  + EK L S
Sbjct: 3172 SDRGQQPDFDAGASADPIPVQEQVTEVPDALAAEQAKMDDVSPGLPSGEEEKRLES 3227


>gi|126304315|ref|XP_001382110.1| PREDICTED: similar to ribosome binding protein 1 homolog 180kDa
           (dog) [Monodelphis domestica]
          Length = 785

 Score = 39.7 bits (91), Expect = 3.3,   Method: Composition-based stats.
 Identities = 46/218 (21%), Positives = 95/218 (43%), Gaps = 14/218 (6%)

Query: 394 LARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGL 453
           L +A +Q E ++  + AK + +  K  KE  EK++  + ++  ++   IKA   +  +  
Sbjct: 190 LNQATSQTESKQNTELAKLRQECSKLTKEVAEKSEAVQQEEQQKKSLEIKAATLEKQVQQ 249

Query: 454 PSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDI--LDNSLLAGKT 511
             V +   K    ++ L+EV  E +K +        D E+ +   Q+I  L   L + +T
Sbjct: 250 LQV-SQKEKEDSLQKRLDEVSGELRKSQSSNKNLLADLEKAKGDRQNIAELRTKLQSSET 308

Query: 512 HTKNETPAIPTAKAPPAQAH----------KGIQDKKPQDQREKPLASDIGVGESDYAGI 561
             K+++  +   K   +++           K I+      Q ++   +     E D    
Sbjct: 309 EVKSKSEELNKLKGKLSESSSENVQLTERIKSIEALLEAGQVKEAKDAQASQAEVDQLQA 368

Query: 562 KLTKKEKELQEQE-ENLRVAEIIQQSRMQSEDLQEKAW 598
           +L  +E  +   E E   + E ++Q ++++ DL+EK W
Sbjct: 369 RLKDREARVTSLEKEATELKEAVEQQKLKNNDLREKNW 406


>gi|71051089|gb|AAH98507.1| Filip1l protein [Mus musculus]
          Length = 909

 Score = 39.7 bits (91), Expect = 3.3,   Method: Composition-based stats.
 Identities = 35/160 (21%), Positives = 73/160 (45%), Gaps = 2/160 (1%)

Query: 342 IKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQE 401
           IK L++  +K+K+ +    +    R  A+  L    I  +     E +    LA A AQE
Sbjct: 1   IKTLKEELTKLKS-FALMVVDEQQRLTAQLALQRQKIQALTTSAKETQGKLALAEARAQE 59

Query: 402 EKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSV 461
           E+Q+  +  KE   +     + ++K   +  ++D Q +  ++ +       +  +   + 
Sbjct: 60  EEQKATRLEKELQTQTTEFHQNQDKIMAKLTNEDSQNRQ-LRQKLAALSRQIDELEETNR 118

Query: 462 KLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDI 501
            L   EEEL+++KD+  KG+   +   D+ +E  ++  D+
Sbjct: 119 SLRKAEEELQDIKDKINKGEYGNSGIMDEVDELRKRVLDM 158


>gi|50302543|ref|XP_451207.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49640338|emb|CAH02795.1| KLLA0A04730p [Kluyveromyces lactis]
          Length = 1021

 Score = 39.7 bits (91), Expect = 3.4,   Method: Composition-based stats.
 Identities = 36/146 (24%), Positives = 61/146 (41%), Gaps = 20/146 (13%)

Query: 418 KADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLP--------------SVPTHSVKL 463
           K    A E A  E+A  + QEKT  +A  +   L L               S  T  +K 
Sbjct: 272 KTGPTATESAKSEEAQSESQEKTKEEAPAEPKPLTLAEKLRLKRMEAAKQASAKTEELKT 331

Query: 464 ---PPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAI 520
               P+E + EE+K E  K   P  T+T++ +  E K++++      A ++  +   P  
Sbjct: 332 EESKPEETKTEELKTEESK---PEETKTEELKTEETKSEELKTEEPKAEESKAEEPKPEE 388

Query: 521 PTAKAPPAQAHKGIQDKKPQDQREKP 546
           P  + P  +  K  + K  + + E+P
Sbjct: 389 PKTEEPTTEQPKSDEPKSEESKTEEP 414


>gi|40556094|ref|NP_955179.1| CNPV156 hypothetical protein [Canarypox virus]
 gi|40233919|gb|AAR83502.1| CNPV156 hypothetical protein [Canarypox virus]
          Length = 832

 Score = 39.7 bits (91), Expect = 3.4,   Method: Composition-based stats.
 Identities = 46/204 (22%), Positives = 94/204 (46%), Gaps = 31/204 (15%)

Query: 398 NAQEEKQRREQEAKEKADR---EKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLP 454
           NA  E + +E E KE A+R   E A++E KE A +E  ++++QE            + + 
Sbjct: 485 NAIRESEMQESEMKENAERAMQEIAEREMKEIAMQEIVEREMQE------------IAIQ 532

Query: 455 SVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTK 514
            +   ++    +E  ++E+ +  +  +E    E + +E TER  Q+I + ++        
Sbjct: 533 EIAERAM----QEIAIQEIAE--RAMQESVMQEIEMQEITERTIQEITERAM-------- 578

Query: 515 NETPAIPTAK-APPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQ 573
            E     +AK A    A + +Q+   Q+   + +A +  + ES    I++ ++  + +  
Sbjct: 579 QEIAIQESAKRAMQESAERAMQESVMQEIEMQEIA-ERAMQESVMQEIEMQERAMQERAM 637

Query: 574 EENLRVAEIIQQSRMQSEDLQEKA 597
           +E       +Q+  MQ   +QE+A
Sbjct: 638 QERAMQERAMQEIEMQERAMQERA 661


>gi|300120508|emb|CBK20062.2| unnamed protein product [Blastocystis hominis]
          Length = 477

 Score = 39.7 bits (91), Expect = 3.5,   Method: Composition-based stats.
 Identities = 59/231 (25%), Positives = 95/231 (41%), Gaps = 36/231 (15%)

Query: 388 LKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGD 447
           L +  + AR   Q  ++  EQ  K   + EKA ++  EKA+ E A    + +TP K EG+
Sbjct: 159 LPEELLQAREARQRAEKVIEQLQKRAEEAEKAKQDQTEKAEGETAKS--EGETP-KTEGE 215

Query: 448 DFGLGLPSVPTHSVKLPPK--EEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNS 505
                 P     + K   +  + E E  K EG+  K  G T  D+  E+E        +S
Sbjct: 216 T-----PKSEGETAKAEGETAKTEGETAKTEGETAKTEGETPKDESGESE--------SS 262

Query: 506 LLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTK 565
                  T +ETP + +A A  + A   + ++  QD  E              A   L +
Sbjct: 263 PFKTTFTTMDETP-VSSAPADLSDAFSRLMERFDQDGEE--------------AASVLPE 307

Query: 566 KEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRF 616
           +E E+  +   +   E   Q  +  +D Q   +  Y+  + +SP EI Q F
Sbjct: 308 EESEVIGEGHIVDALEYSDQVYVHEKDRQ-MMYAMYQ--RGVSPREISQSF 355


>gi|239831762|ref|ZP_04680091.1| twin-arginine translocation protein TatB [Ochrobactrum intermedium
           LMG 3301]
 gi|239824029|gb|EEQ95597.1| twin-arginine translocation protein TatB [Ochrobactrum intermedium
           LMG 3301]
          Length = 202

 Score = 39.7 bits (91), Expect = 3.5,   Method: Composition-based stats.
 Identities = 29/88 (32%), Positives = 39/88 (44%), Gaps = 1/88 (1%)

Query: 390 QATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDF 449
           +AT   RA A E KQ+ ++  KE A+ E       E    +   K  Q   PI++ GDD 
Sbjct: 34  KATARMRATANEFKQQFDEALKE-AELEDVKNIIDETRKLDPRSKITQVFDPIRSAGDDL 92

Query: 450 GLGLPSVPTHSVKLPPKEEELEEVKDEG 477
             GL S  + S   P K  E+    D G
Sbjct: 93  RAGLQSTTSMSPATPEKVAEVTTPVDAG 120


>gi|68533107|dbj|BAE06108.1| MYH10 variant protein [Homo sapiens]
          Length = 2018

 Score = 39.7 bits (91), Expect = 3.5,   Method: Composition-based stats.
 Identities = 70/300 (23%), Positives = 122/300 (40%), Gaps = 71/300 (23%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   E+L  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 1018 AEAKIKKMEEEILLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 1072

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTII-------SGSEK 811
            K E  +SD+   L+K  KT  ++ + K +L G   D+  +   L   I       +  E+
Sbjct: 1073 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKLQLAKKEE 1132

Query: 812  ILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERS 865
             LQG      D T    ++L V  +  +  ++L E F                    E++
Sbjct: 1133 ELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFES------------------EKA 1174

Query: 866  LKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFERE 925
             +N+A             +Q  D + +L+ L+T+L        +  E     +R++ E+E
Sbjct: 1175 SRNKAE------------KQKRDLSEELEALKTELEDTLDTTAAQQE-----LRTKREQE 1217

Query: 926  IKELKSVIEADAKENPNPNKNQKKLQKTR-EKLVAQL--SSRLKELNIDNAYGLWNEYKE 982
            + ELK  +E + K +    ++ ++   T  E+L  QL  + R K     N  GL  + KE
Sbjct: 1218 VAELKKALEEETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKE 1277


>gi|293346337|ref|XP_001053669.2| PREDICTED: ribosome binding protein 1 isoform 3 [Rattus norvegicus]
          Length = 1453

 Score = 39.7 bits (91), Expect = 3.5,   Method: Composition-based stats.
 Identities = 44/218 (20%), Positives = 100/218 (45%), Gaps = 13/218 (5%)

Query: 394  LARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGL 453
            L +A +Q E ++  + AK + +  K +KE  EK+  E + ++ Q++  ++A+   F   +
Sbjct: 859  LNQATSQVESKQNTELAKLRQELSKVNKELVEKS--EASRQEEQQRKALEAKAATFEKQI 916

Query: 454  PSV-PTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDI--LDNSLLAGK 510
              +  +H       ++ LEEV  E  + +        D E+ + + Q +  L + L + +
Sbjct: 917  LQLQASHKESEEALQKRLEEVTRELCRAQTSHANLRADAEKAQEQQQRVAELHSKLQSSE 976

Query: 511  THTKNETPAIP-------TAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKL 563
               K++   +         A+A  +Q  + I+  +   +  +   S     E+D    +L
Sbjct: 977  VEVKSKCEELSDLHGQLKEARAENSQLTERIRSIEALLEAGQAQDSQASRAEADQQQTRL 1036

Query: 564  TKKEKELQ-EQEENLRVAEIIQQSRMQSEDLQEKAWDS 600
             + E ++   ++E   + E ++Q + ++ DL+EK W +
Sbjct: 1037 KELESQVSCLEKETSELKEAMEQQKGKNNDLREKNWKA 1074


>gi|123479892|ref|XP_001323102.1| viral A-type inclusion protein [Trichomonas vaginalis G3]
 gi|121905960|gb|EAY10879.1| viral A-type inclusion protein, putative [Trichomonas vaginalis G3]
          Length = 4057

 Score = 39.7 bits (91), Expect = 3.5,   Method: Composition-based stats.
 Identities = 191/1012 (18%), Positives = 388/1012 (38%), Gaps = 124/1012 (12%)

Query: 1    MNELATSIDYQTNNLDQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYI 60
            + +L T I  +++ L++ +  S+  ++ + + QD +K   E +      +   +++    
Sbjct: 1807 LEKLQTEIKSKSDQLNEIQNESKSQSEQIVTFQDEVKSKDEKLQTQEEQIKELENK---- 1862

Query: 61   VGPIEQRLKKVSERYERVVSRDLTLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLL 120
            +  +E  L+   +   ++  R      E  L +LK+V + L +  E  +V   ++SD+ L
Sbjct: 1863 LNELENSLRNKGDLQVQLNDR------EKELNNLKKVNENLVKQVEDLQVN-KEQSDKKL 1915

Query: 121  CRFMDMVETEDEHKINKQVRDALESAGFDLESTQENIRKVESALINNNMKDAFRFLELAQ 180
                      DE   N +  +A      DL+   E +R+       N  K+    + L  
Sbjct: 1916 -------SENDEELTNLRRNNA------DLKKQNEKLRE-------NKEKNESEIISLQN 1955

Query: 181  KSKETADSHIIEAIDVGTKLKENTPPTTFTSISKVLLKSNNM-QDVVFTKIKEVVKKHVN 239
            +  E  +SH  E   V  KL+EN       +    +LK   + Q+     +++++ +  N
Sbjct: 1956 RLSELTNSHNDELFTVKRKLEENNSIVKQQNAKIEMLKQQLIDQNKTIEDLQKIINESEN 2015

Query: 240  AEL-------GHRKLRGLAFDHTYFNDKLNQ-FLKEIKNHQKEYDESEKGS--SKARYHA 289
             +         +  L+ +  D+   N K N+  L +I + Q +  E+EK S   K++Y +
Sbjct: 2016 LQFLVSTLKTENNTLKKVTQDNDLQNKKTNEDLLSQINDLQNKLKETEKSSQIQKSKYES 2075

Query: 290  AYAHIYWDLANDWVNGRVGDKSDEWARTSTNIASWIGRITRTEGLGG---VTYDQIKQLR 346
                I   L     N  + D SD   +    + +   ++  ++         ++   +L 
Sbjct: 2076 QLNEIQSKL-----NQSIKDNSDLMDKHENELKNLDEKLQESQKQKNDLEKKFEMNSKLL 2130

Query: 347  DLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRR 406
            +  +K++ +     +      K+E       I ++    +E+       + N  E+ Q  
Sbjct: 2131 NENNKLRQEKFDKTLEELTNVKSENGKLKEQIDDLEKEKNEMTILLNTTQNNQNEDLQNL 2190

Query: 407  EQEAKEKADREKAD----KEAKEKADR--EKADKDLQEKTPIKAEGDDFGLGLPSVPTHS 460
            +++     D  K         KEK ++   K+D D    + +K E D     L      +
Sbjct: 2191 QKKLNATIDELKMTTNDYNSLKEKFEKLNGKSDNDNSLISSLKRENDKMKNDLQKTQEEN 2250

Query: 461  VKLPPKEEELEEVKDEGKKGKEPGT-----TETDDREETERKNQDILDNSLLAGKTHTKN 515
              L  K  E E+   + +K  +  +      ET++ E     N+  +D  +   +T++  
Sbjct: 2251 KSLVLKLNENEKTISKLQKTNDEISRKLTFVETENGELKLTVNE--MDEKVTTNETNSNE 2308

Query: 516  ETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEE 575
            +   I   +          +  K  +   K L S+I   ++D    +  K + + Q  + 
Sbjct: 2309 KERLISNLQ----------KQNKQLENENKTLQSEIKSLQTD----EFVKDQMKKQLNDY 2354

Query: 576  NLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSYK 635
              +V+++  + R    ++ +     YK+  S     +K+   K  K+  +  + V+   +
Sbjct: 2355 EQKVSKLEDEKRQLQNEMTK-----YKDDNS----TMKKVLTKQEKIIQKLNTKVEDLTE 2405

Query: 636  GTQESDKAINHFLDNDFGYYRIHNFLSQWSPLGLMYEKDELHGVEAVYQKLDVLF---RH 692
              Q   +  +  L +            +      + ++  L G+E   QK+       + 
Sbjct: 2406 TKQTMKQTQSEELSSLEEENEQKKEELKHLKEEFLEKEKRLKGLEKSIQKVTEKITSQKE 2465

Query: 693  CIENLRANKNAVDAMSKAVEAGESSVRKHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLV 752
             IENLR  K   D     +++  S   K    +  S   KS     + I+++   +  L 
Sbjct: 2466 EIENLRKQKLIDDNTISELKSSISENEKELENLRKSDSDKS-----DIIEQLKSESENLS 2520

Query: 753  KEDPKRGKSESYLSDIRSELQKVNKTVM----DIRIKLRLYGIFQDIPQEQPPLYTIISG 808
                 R   E+ L+ +++++QK+N  +     D++ K  L    Q   QE    ++    
Sbjct: 2521 MSLKSRSNYENELTKLQNKIQKLNDQISDKEDDLKSKEILLEKLQKKVQETEEKFSETQK 2580

Query: 809  SEKILQGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTN------------------NA 850
              K ++ +          +Q + +S  +K  E    D TN                  N 
Sbjct: 2581 LNKTMKDENANISNQLRALQMELNSK-TKQIEKLVKDNTNLKEKVTILEFKQSNFDDDNK 2639

Query: 851  IKEERYWTIYAFERSLKNQAHLNAEVER-LSGLAQQPSDSTADLKELQTQLS------RA 903
             KEE+   +     +LK Q  LN E ++ +  L  Q S    D KE  T+L       + 
Sbjct: 2640 EKEEKIENLENDNFNLKKQIILNEEYKKQIDELKFQISQLNYDNKEKVTRLQNENTLLKT 2699

Query: 904  KKYKESNDERIVSFIRSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTRE 955
            K  +  ++   V   R + + EI+ELK   + + KEN N  K  K+++   E
Sbjct: 2700 KSLQNKSELNTVKKEREDLQSEIEELKMKFDLEQKENENLKKQNKEIKNQFE 2751


>gi|325847168|ref|ZP_08169967.1| LPXTG-motif cell wall anchor domain protein [Anaerococcus
           hydrogenalis ACS-025-V-Sch4]
 gi|325480948|gb|EGC83994.1| LPXTG-motif cell wall anchor domain protein [Anaerococcus
           hydrogenalis ACS-025-V-Sch4]
          Length = 4824

 Score = 39.7 bits (91), Expect = 3.5,   Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 22/28 (78%)

Query: 395 ARANAQEEKQRREQEAKEKADREKADKE 422
           A   AQE+K +RE E KEK+D+EK+DK+
Sbjct: 284 AEKKAQEQKAKREAEQKEKSDQEKSDKK 311


>gi|270003748|gb|EFA00196.1| hypothetical protein TcasGA2_TC003021 [Tribolium castaneum]
          Length = 968

 Score = 39.7 bits (91), Expect = 3.5,   Method: Composition-based stats.
 Identities = 33/141 (23%), Positives = 62/141 (43%), Gaps = 7/141 (4%)

Query: 464 PPKEEELEEVKDEGKKGKEPGT----TETDDREETERKNQDILDNSLLAGKTHTKNETPA 519
           P   + L+E  +E  K + P T    T T+D + ++ KN  + + S +  K   K E   
Sbjct: 31  PALVKRLKEALEEELKQELPDTSIADTSTEDLDTSQTKNDSVTEESKVPDKEPEKTEACP 90

Query: 520 IPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRV 579
           +P  + PP +  +   ++K  D +E P A  +     +    K   +E E  EQ E   +
Sbjct: 91  LPPKEQPPVEQPEATTEEK-MDTQEAPPAEPVQQPAPEVEAPK--PEETEPSEQSEPKEL 147

Query: 580 AEIIQQSRMQSEDLQEKAWDS 600
              +++++   E  + K+  S
Sbjct: 148 NSNLEENKENGEQDEPKSRKS 168


>gi|189085363|ref|NP_001121150.1| inner centromere protein [Xenopus (Silurana) tropicalis]
 gi|123908633|sp|Q0IHP2|INCE_XENTR RecName: Full=Inner centromere protein
 gi|114107640|gb|AAI23051.1| incenp protein [Xenopus (Silurana) tropicalis]
          Length = 898

 Score = 39.7 bits (91), Expect = 3.5,   Method: Composition-based stats.
 Identities = 33/116 (28%), Positives = 56/116 (48%), Gaps = 12/116 (10%)

Query: 394 LARANAQEEKQRRE-QEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLG 452
           L RA  ++E+QRRE +E K++  +E+ ++E  E+  +E+  K LQE+   KA+       
Sbjct: 706 LERAAQEKEQQRREAEERKKREQQERLEQERLERLHKEQEAKRLQEEQQRKAKEQAAAAS 765

Query: 453 LP----------SVPTHSVKLPPKEEELEEVK-DEGKKGKEPGTTETDDREETERK 497
            P          S    S ++ PK  +   VK +E   G +  + ++ D E   RK
Sbjct: 766 APVMNVTVDMQNSPACESYEMTPKSYKAPSVKVNEENYGMDLNSDDSTDDESQPRK 821


>gi|189235221|ref|XP_967494.2| PREDICTED: similar to heterogeneous nuclear ribonucleoprotein
           U-like 1 [Tribolium castaneum]
          Length = 964

 Score = 39.7 bits (91), Expect = 3.6,   Method: Composition-based stats.
 Identities = 33/141 (23%), Positives = 62/141 (43%), Gaps = 7/141 (4%)

Query: 464 PPKEEELEEVKDEGKKGKEPGT----TETDDREETERKNQDILDNSLLAGKTHTKNETPA 519
           P   + L+E  +E  K + P T    T T+D + ++ KN  + + S +  K   K E   
Sbjct: 31  PALVKRLKEALEEELKQELPDTSIADTSTEDLDTSQTKNDSVTEESKVPDKEPEKTEACP 90

Query: 520 IPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRV 579
           +P  + PP +  +   ++K  D +E P A  +     +    K   +E E  EQ E   +
Sbjct: 91  LPPKEQPPVEQPEATTEEK-MDTQEAPPAEPVQQPAPEVEAPK--PEETEPSEQSEPKEL 147

Query: 580 AEIIQQSRMQSEDLQEKAWDS 600
              +++++   E  + K+  S
Sbjct: 148 NSNLEENKENGEQDEPKSRKS 168


>gi|326672292|ref|XP_003199630.1| PREDICTED: LOW QUALITY PROTEIN: hypothetical protein LOC100007502
           [Danio rerio]
          Length = 1500

 Score = 39.7 bits (91), Expect = 3.6,   Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 56/121 (46%), Gaps = 8/121 (6%)

Query: 400 QEEKQRREQEAKEKADR--------EKADKEAKEKADREKADKDLQEKTPIKAEGDDFGL 451
           +E  +RR +  K   +R        E A KEAK +      +    + T IK + +   L
Sbjct: 561 EERAERRLEILKNLVNRTIEEMTTDENAAKEAKMELLDTMIEAMRSDLTKIKGDAESVQL 620

Query: 452 GLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKT 511
            L +VP    KL     ELEE+K E  K ++  + ++ + EE+  + QD+ D  L A + 
Sbjct: 621 CLANVPESPGKLSHLRTELEEIKAELLKSQQQLSLKSKEFEESCIQMQDLNDQLLQATRN 680

Query: 512 H 512
           +
Sbjct: 681 Y 681


>gi|13928704|ref|NP_113708.1| myosin-10 [Rattus norvegicus]
 gi|13431672|sp|Q9JLT0|MYH10_RAT RecName: Full=Myosin-10; AltName: Full=Cellular myosin heavy chain,
            type B; AltName: Full=Myosin heavy chain 10; AltName:
            Full=Myosin heavy chain, non-muscle IIb; AltName:
            Full=Non-muscle myosin heavy chain B; Short=NMMHC-B;
            AltName: Full=Non-muscle myosin heavy chain IIb;
            Short=NMMHC II-b; Short=NMMHC-IIB
 gi|7381235|gb|AAF61445.1|AF139055_1 nonmuscle myosin heavy chain-B [Rattus norvegicus]
          Length = 1976

 Score = 39.7 bits (91), Expect = 3.6,   Method: Composition-based stats.
 Identities = 72/301 (23%), Positives = 124/301 (41%), Gaps = 73/301 (24%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   EVL  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 976  AEAKIKKMEEEVLLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 1030

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQ--------PPLYTIISGSE 810
            K E  +SD+   L+K  KT  ++ + K +L G   D+ Q+Q          L   ++  E
Sbjct: 1031 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDL-QDQIAELQAQVDELKVQLTKKE 1089

Query: 811  KILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFER 864
            + LQG      D T    ++L V  +  +  ++L E F                    E+
Sbjct: 1090 EELQGALARGDDETLHKNNALKVARELQAQIAELQEDFES------------------EK 1131

Query: 865  SLKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFER 924
            + +N+A             +Q  D + +L+ L+T+L        +  E     +R++ E+
Sbjct: 1132 ASRNKAE------------KQKRDLSEELEALKTELEDTLDTTAAQQE-----LRTKREQ 1174

Query: 925  EIKELKSVIEADAKENPNPNKNQKKLQKTR-EKLVAQL--SSRLKELNIDNAYGLWNEYK 981
            E+ ELK  +E + K +    ++ ++   T  E+L  QL  + R K     N  GL  + K
Sbjct: 1175 EVAELKKALEDETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNK 1234

Query: 982  E 982
            E
Sbjct: 1235 E 1235


>gi|149724305|ref|XP_001504875.1| PREDICTED: myosin, heavy chain 10, non-muscle isoform 1 [Equus
            caballus]
          Length = 1976

 Score = 39.7 bits (91), Expect = 3.6,   Method: Composition-based stats.
 Identities = 70/300 (23%), Positives = 122/300 (40%), Gaps = 71/300 (23%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   E+L  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 976  AEAKIKKMEEEILLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 1030

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTII-------SGSEK 811
            K E  +SD+   L+K  KT  ++ + K +L G   D+  +   L   I       +  E+
Sbjct: 1031 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKIQLAKKEE 1090

Query: 812  ILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERS 865
             LQG      D T    ++L V  +  +  ++L E F                    E++
Sbjct: 1091 ELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFES------------------EKA 1132

Query: 866  LKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFERE 925
             +N+A             +Q  D + +L+ L+T+L        +  E     +R++ E+E
Sbjct: 1133 SRNKAE------------KQKRDLSEELEALKTELEDTLDTTAAQQE-----LRTKREQE 1175

Query: 926  IKELKSVIEADAKENPNPNKNQKKLQKTR-EKLVAQL--SSRLKELNIDNAYGLWNEYKE 982
            + ELK  +E + K +    ++ ++   T  E+L  QL  + R K     N  GL  + KE
Sbjct: 1176 VAELKKALEEETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKE 1235


>gi|146329713|ref|YP_001208967.1| translation initiation factor IF-2 [Dichelobacter nodosus VCS1703A]
 gi|189028315|sp|A5EWY9|IF2_DICNV RecName: Full=Translation initiation factor IF-2
 gi|146233183|gb|ABQ14161.1| translation initiation factor IF-2 [Dichelobacter nodosus VCS1703A]
          Length = 879

 Score = 39.7 bits (91), Expect = 3.6,   Method: Composition-based stats.
 Identities = 38/167 (22%), Positives = 72/167 (43%), Gaps = 26/167 (15%)

Query: 365 NRFKAETRLAYSTIANVA--NFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKE 422
           NR K + R + S+   ++      +L +   L + NAQ E + RE +    A+ ++  +E
Sbjct: 81  NRRKTDARKSQSSEKKISPRELAQQLAEKKRLEQGNAQRENEEREYQEALAAEEKRQQQE 140

Query: 423 AKEKADREK--------ADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVK 474
              KA RE+         ++ LQ +  ++A+  +            ++   +E+E EE K
Sbjct: 141 EARKAKREQKEAEAIRAEEERLQMEAALQAQMQE---------QERIR---QEKEAEEAK 188

Query: 475 ----DEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNET 517
                E +K +E       ++ E ERK Q+ + +  L      + ET
Sbjct: 189 LNAEKELRKQQEREKRLAQEKAELERKRQEAIRDVELRESYEEEAET 235


>gi|42564102|ref|NP_187887.3| PIE1 (PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1); ATP binding / DNA
           binding / helicase/ nucleic acid binding [Arabidopsis
           thaliana]
 gi|30984019|gb|AAP40633.1| photoperiod independent early flowering1 [Arabidopsis thaliana]
 gi|332641727|gb|AEE75248.1| helicase SWR1 [Arabidopsis thaliana]
          Length = 2055

 Score = 39.7 bits (91), Expect = 3.7,   Method: Composition-based stats.
 Identities = 53/222 (23%), Positives = 97/222 (43%), Gaps = 25/222 (11%)

Query: 405 RREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLP 464
           +RE++ + +A + + D   +E   R  + +  +E +P+K E +D    L SV    V  P
Sbjct: 237 KRERQEELEALQNEVDLPVEELLRRYTSGRVSRETSPVKDENED---NLTSVS--RVTSP 291

Query: 465 PKEEELEEV----KDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAI 520
            K+E  + +    +D G+       +E  +   + R++ D   + L   +TH+ +  P +
Sbjct: 292 VKDENQDNLASVGQDHGEDKNNLAASEETEGNPSVRRSNDSYGH-LAISETHSHDLEPGM 350

Query: 521 PTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVA 580
            TA     +          Q+  +  LA+  G  + D A + +   E+EL + +    V 
Sbjct: 351 TTASVKSRKEDHTYDFNDEQEDVDFVLAN--GEEKDDEATLAV---EEELAKADNEDHVE 405

Query: 581 EII---QQSRMQSEDLQEKAWDSYKE---WKSLSPDEIKQRF 616
           EI    ++S M  E L  +    YKE    K +S DE +  F
Sbjct: 406 EIALLQKESEMPIEVLLAR----YKEDFGGKDISEDESESSF 443


>gi|294658594|ref|XP_460937.2| DEHA2F13178p [Debaryomyces hansenii CBS767]
 gi|202953245|emb|CAG89291.2| DEHA2F13178p [Debaryomyces hansenii]
          Length = 338

 Score = 39.7 bits (91), Expect = 3.7,   Method: Composition-based stats.
 Identities = 44/213 (20%), Positives = 93/213 (43%), Gaps = 10/213 (4%)

Query: 406 REQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFG--LGLPSVPTHSVKL 463
           R   A + + + +  K A  K      + + ++ TP+   G  F   LG+PS  T +   
Sbjct: 129 RGPRAYQTSAKNRQGKYATNKKVDHAEESEEEKSTPMSKAGASFAARLGVPSKKTENATT 188

Query: 464 PPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKT-HTKNETPAIPT 522
              +++ E   +E    ++ G  +T D  E+E + ++ L     AG++  ++    +I  
Sbjct: 189 NGHKDDFESTDEEITDEEDDGFEDTQDTPESEDEKEENLPPITSAGQSLASRLGMVSISN 248

Query: 523 AKAPPAQAHKGIQ--DKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVA 580
            K+ P +  + ++    KP+   + P  +    G   Y   K  ++E+  +EQ E  R+ 
Sbjct: 249 TKSDPPKPKQNVKQTQSKPRQSNDPPRQTKTPKGA--YQTPKQKREEQVRKEQAEKERLQ 306

Query: 581 EIIQQSRMQSE--DLQEKAWDSYKEWKSLSPDE 611
           +  + ++++ E  D+  K   S   W  L  ++
Sbjct: 307 K-QKDAKLKEEVRDMFSKLTSSSANWADLEDED 338


>gi|124009149|ref|ZP_01693831.1| hypothetical protein M23134_06770 [Microscilla marina ATCC 23134]
 gi|123985247|gb|EAY25174.1| hypothetical protein M23134_06770 [Microscilla marina ATCC 23134]
          Length = 738

 Score = 39.7 bits (91), Expect = 3.7,   Method: Composition-based stats.
 Identities = 65/271 (23%), Positives = 109/271 (40%), Gaps = 44/271 (16%)

Query: 367 FKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEK 426
           FK   R    T        ++ K A   ARA  Q+EK+R +QE KE    E+   + +++
Sbjct: 256 FKERERALKDTQQQQQRLDTQSK-ALEEARATLQQEKKRLKQE-KESVQAEQQRLKQQQQ 313

Query: 427 ADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEP--- 483
           A +   DK  QE+  +K    +    L  VPT ++     EE  +  KD       P   
Sbjct: 314 ALKVAKDKVAQEEALLKTASQE----LQQVPTKALT-TRNEENTQMAKDVVAPANTPIVH 368

Query: 484 ------GTTETDDR--EETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQ 535
                   T+  D+  EET     D+  N+L   +   +     +  AK    Q  +   
Sbjct: 369 RSINEKQETKVVDKHSEETLNSTTDLTPNALQMERDQLEQARQQLLKAKERFEQEREDFL 428

Query: 536 DKKPQDQREKPLASDIGVGESDYAGI---------KLTKKEKELQEQEENLRVAEIIQQS 586
           + + Q   E   A + G   +D A +         +L+K E+EL  ++ +L++ E     
Sbjct: 429 NNRDQLLMENTKAREKG---NDLAHLQKSVLATKAQLSKLEEELTHKQAHLKLIE----- 480

Query: 587 RMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQ 617
                 ++EKA    K   S  P++I++  Q
Sbjct: 481 ------MEEKA---AKRTNSAIPEKIQESLQ 502


>gi|157820543|ref|NP_001102857.1| mitotic spindle assembly checkpoint protein MAD1 [Rattus
           norvegicus]
 gi|149035020|gb|EDL89740.1| rCG42782, isoform CRA_a [Rattus norvegicus]
          Length = 717

 Score = 39.7 bits (91), Expect = 3.7,   Method: Composition-based stats.
 Identities = 29/100 (29%), Positives = 55/100 (55%), Gaps = 8/100 (8%)

Query: 401 EEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHS 460
           E +QR+ QEA +K    +A +E  E+ D+E+  KDL++K  ++ +       + S+ +  
Sbjct: 195 ELQQRKWQEANQKIQELQASQE--ERTDQEQKIKDLEQKLCLQEQDAAV---VKSMKSEL 249

Query: 461 VKLPPKEEELEEVKDEGKKGKEPGTTE---TDDREETERK 497
           ++LP  E EL+ +++E    +E   T    T++ E  +RK
Sbjct: 250 LRLPRMERELKRLREENTHLREMRETNGLLTEELEGLQRK 289


>gi|56964861|ref|YP_176592.1| beta-N-acetylglucosaminidase [Bacillus clausii KSM-K16]
 gi|56911104|dbj|BAD65631.1| beta-N-acetylglucosaminidase [Bacillus clausii KSM-K16]
          Length = 1398

 Score = 39.7 bits (91), Expect = 3.7,   Method: Composition-based stats.
 Identities = 29/114 (25%), Positives = 47/114 (41%), Gaps = 8/114 (7%)

Query: 391  ATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFG 450
            A +       EE      E  + AD E +  E ++  D  + ++D Q+ +P K    D  
Sbjct: 1009 APIAPEVETNEEANESVNEENDVADLENSPSEKQQPIDEVEKEEDKQDVSPDKERDTDEH 1068

Query: 451  LGLPSVPTHSVKLPPKE------EELEEVKDEGKKGKEPGTTETDDREETERKN 498
               PS+  +       E      EE + V DE ++  E  TT+T++  E E  N
Sbjct: 1069 AEEPSIDENDTVPHSDEANDQTVEEDDHVADENEQASE--TTDTENDAENEESN 1120


>gi|123499924|ref|XP_001327733.1| hypothetical protein [Trichomonas vaginalis G3]
 gi|121910666|gb|EAY15510.1| hypothetical protein TVAG_210400 [Trichomonas vaginalis G3]
          Length = 600

 Score = 39.7 bits (91), Expect = 3.7,   Method: Composition-based stats.
 Identities = 51/201 (25%), Positives = 83/201 (41%), Gaps = 13/201 (6%)

Query: 397 ANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSV 456
           A  QE KQ+ EQ+ +EK  R KA +    K  R+ +DKDL + T    E        PS 
Sbjct: 290 ARKQEVKQQ-EQKPEEKEPRRKARRIIHVKR-RDSSDKDLTKSTESVGEETK-----PSS 342

Query: 457 PTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDRE-ETERKNQDILDNSLLAGKTHTKN 515
           P    + P  + +    KDE            D  +  ++  ++DI  N L+      K 
Sbjct: 343 PKTVPEHPKPKPKPIPQKDENDDFFGDDDGNDDAMKLPSDHDDEDIKPNPLVQAVPQKKK 402

Query: 516 ETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEE 575
                P    PP Q  +  +++KP+   E         G ++   +KL     + +E + 
Sbjct: 403 A----PAPIQPPVQVQQPKKEEKPKVDDENDDFFGDDDGNNNDDDMKLPSDHSDEEEVKP 458

Query: 576 NLRVAEIIQQSRMQSEDLQEK 596
           NL V + + Q + Q + + EK
Sbjct: 459 NLLV-QAVPQKKTQKQVIPEK 478


>gi|114669115|ref|XP_001166384.1| PREDICTED: myosin, heavy polypeptide 10, non-muscle isoform 3 [Pan
            troglodytes]
          Length = 1997

 Score = 39.7 bits (91), Expect = 3.7,   Method: Composition-based stats.
 Identities = 70/300 (23%), Positives = 122/300 (40%), Gaps = 71/300 (23%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   E+L  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 997  AEAKIKKMEEEILLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 1051

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTII-------SGSEK 811
            K E  +SD+   L+K  KT  ++ + K +L G   D+  +   L   I       +  E+
Sbjct: 1052 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKLQLAKKEE 1111

Query: 812  ILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERS 865
             LQG      D T    ++L V  +  +  ++L E F                    E++
Sbjct: 1112 ELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFES------------------EKA 1153

Query: 866  LKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFERE 925
             +N+A             +Q  D + +L+ L+T+L        +  E     +R++ E+E
Sbjct: 1154 SRNKAE------------KQKRDLSEELEALKTELEDTLDTTAAQQE-----LRTKREQE 1196

Query: 926  IKELKSVIEADAKENPNPNKNQKKLQKTR-EKLVAQL--SSRLKELNIDNAYGLWNEYKE 982
            + ELK  +E + K +    ++ ++   T  E+L  QL  + R K     N  GL  + KE
Sbjct: 1197 VAELKKALEEETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKE 1256


>gi|268638121|ref|XP_002649177.1| type A von Willebrand factor  domain-containing protein
            [Dictyostelium discoideum AX4]
 gi|223635327|sp|Q869L3|MDN1_DICDI RecName: Full=Midasin; AltName: Full=MIDAS-containing protein
 gi|256013014|gb|EEU04125.1| type A von Willebrand factor  domain-containing protein
            [Dictyostelium discoideum AX4]
          Length = 5900

 Score = 39.7 bits (91), Expect = 3.8,   Method: Composition-based stats.
 Identities = 48/232 (20%), Positives = 96/232 (41%), Gaps = 21/232 (9%)

Query: 398  NAQEEKQRREQE--------AKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDF 449
            N Q+++  ++ E           K++    D+E K++++++ AD D     P  +E D  
Sbjct: 5292 NEQQDETPKDSEQPLGVKDKTGSKSNVSNTDEEMKDESNQDNADDDSGMTQPTPSENDTG 5351

Query: 450  GL-GLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETD-DREETERKN-QDILDNSL 506
             L  L S P      PP+    +  K + +    P  +  D ++E  +R N +   +   
Sbjct: 5352 ALKNLKSQP------PPQSSAQQPPKKQKQVDPNPYRSMGDANKEWKKRLNLKQEQEEEE 5405

Query: 507  LAGKTHTKNETPAI-PTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTK 565
                +  K + P   P AK    Q ++ I+D +  D+ E+   +     ++    I   K
Sbjct: 5406 EEQSSEPKEKAPKQDPNAKENENQDYEFIKDDEKLDKDEETDQALAAATDTQLQDIPQNK 5465

Query: 566  KEKELQEQEEN---LRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQ 614
             + +  EQEE+   +   + +     Q  + Q+ +     E K +S  ++KQ
Sbjct: 5466 AQDDQAEQEEDQMDIDEEDDMDVDHKQEVEHQDDSKQQLDENKKISMSKLKQ 5517


>gi|315194567|gb|EFU24956.1| immunoglobulin G binding protein A precursor [Staphylococcus aureus
           subsp. aureus CGS00]
          Length = 508

 Score = 39.7 bits (91), Expect = 3.8,   Method: Composition-based stats.
 Identities = 51/212 (24%), Positives = 78/212 (36%), Gaps = 29/212 (13%)

Query: 365 NRFKAETRLAYSTIANVANFTSE--------LKQATVLARANAQEEKQRREQEAKEKADR 416
           N+F  E + A+  I ++ N T E        LK    +++    E K+  + +A ++ D 
Sbjct: 272 NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDN 331

Query: 417 EKADKEAKEKADREKADKDLQE--KTPIKAEGDDFGLGLPSVP-THSVKLPPKEEELEEV 473
            K  KE   K  +E  +K  +E  K P K +G+  G      P       P KE+  +  
Sbjct: 332 NKPGKEDNNKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDGNKPG 391

Query: 474 KDEGKK-GKE-----------------PGTTETDDREETERKNQDILDNSLLAGKTHTKN 515
           K++G K GKE                 PG T  D  +        I  ++ LA K   K 
Sbjct: 392 KEDGNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIKP 451

Query: 516 ETPAIPTAKAPPAQAHKGIQDKKPQDQREKPL 547
               +   K P   A        P+   E P 
Sbjct: 452 GQELVVDKKQPANHADANKAQALPETGEENPF 483


>gi|16198344|gb|AAF89163.2|AF209068_1 Mud protein [Drosophila melanogaster]
          Length = 1871

 Score = 39.7 bits (91), Expect = 3.8,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 54/99 (54%), Gaps = 4/99 (4%)

Query: 895  ELQTQLSRAKKYKESNDERIVSFIRSEFEREIKEL---KSVIEADAKENPNPNKNQKKLQ 951
            E QT+LS   + ++ + +++V  ++ E ++E KEL   KSVIEA  K + +  + ++  Q
Sbjct: 1331 EAQTKLSDDLQRQKESAQQLVDNLKVELDKERKELAKVKSVIEAQTKLSDDLQRQKESAQ 1390

Query: 952  KTREKLVAQLSSRLKEL-NIDNAYGLWNEYKEDFKASFE 989
            +  + L  +L    KEL  +++A+    +  +D +   E
Sbjct: 1391 QLVDNLKVELDKERKELAQVNSAFEAQTKLSDDLQRQKE 1429



 Score = 38.9 bits (89), Expect = 5.2,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 53/97 (54%), Gaps = 4/97 (4%)

Query: 897  QTQLSRAKKYKESNDERIVSFIRSEFEREIKEL---KSVIEADAKENPNPNKNQKKLQKT 953
            QT+LS   + ++ + +++V  ++ E E+E KEL   KSVIEA  K + +  + ++  Q+ 
Sbjct: 1207 QTKLSDDLECQKESGQQLVDNLKVELEKERKELAQVKSVIEAQTKLSDDLQREKESAQQL 1266

Query: 954  REKLVAQLSSRLKEL-NIDNAYGLWNEYKEDFKASFE 989
             + L  +L    KEL  +++A+    +  +D +   E
Sbjct: 1267 VDNLKVELDKERKELAQVNSAFEAQTKLSDDLQREKE 1303


>gi|238880134|gb|EEQ43772.1| conserved hypothetical protein [Candida albicans WO-1]
          Length = 1040

 Score = 39.3 bits (90), Expect = 3.8,   Method: Composition-based stats.
 Identities = 33/114 (28%), Positives = 60/114 (52%), Gaps = 8/114 (7%)

Query: 859 IYAFERSLKNQAHLNAEVER-LSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSF 917
           +  F + L  ++    +VE  L  L    +  +A + EL+TQLS A K K  +D ++   
Sbjct: 466 VQQFTKELIAESESKQQVEEELENLKTIHAKDSARILELETQLSDAAKEKSESDYKL--- 522

Query: 918 IRSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKELNID 971
             ++    +K+LKS IE   K N N ++ ++++Q  +   V++L   LKEL ++
Sbjct: 523 --TDTSEIVKDLKSQIET-LKANLNKSEEEREIQNKKLDQVSEL-KELKELKVE 572


>gi|167390555|ref|XP_001739402.1| myosin-2 heavy chain, non muscle [Entamoeba dispar SAW760]
 gi|165896924|gb|EDR24218.1| myosin-2 heavy chain, non muscle, putative [Entamoeba dispar SAW760]
          Length = 2151

 Score = 39.3 bits (90), Expect = 3.9,   Method: Composition-based stats.
 Identities = 145/699 (20%), Positives = 277/699 (39%), Gaps = 94/699 (13%)

Query: 7    SIDYQTNNLDQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYIVGPIEQ 66
            ++  +  N++  K  +E   K    I+DN+K  ++ +     D+    ++       +E 
Sbjct: 1255 ALQEEKENVESSKNSTE---KDKKKIEDNLKDTQKKL----EDMTAENEKLKTKAKDLEA 1307

Query: 67   RLKKVSERYERVVSRDLTLVIEAGL--KDLKEVGDTLKRLAETGEVILSDKSDRLLCRFM 124
            +L +V + +E+ V+    L  +     K+L  +   L+ L +   V+ +   D    +  
Sbjct: 1308 QLNEVQDNHEKAVADAEVLNKKKAQSDKELNSLKAELEALTKAKSVVEAKNKDNENEKAA 1367

Query: 125  DMVETEDEHKINKQVRDALESAGFDLESTQENIRKVES---ALINNNMKDAFRFLELAQ- 180
               E +  ++  K V+  L  A  DL+   E   +VE+    L+ +N K      E+   
Sbjct: 1368 LSEEIDQANEKLKNVQAELRKANADLQEANEKKAEVEAQRDKLVADNKKMTKTLEEIKAR 1427

Query: 181  ---------------KSKETADSHIIEAIDVGTKLKENTPPTTFTSISKVLLKSNNMQDV 225
                           K KET      E +D+  K + N        + K+  +    +D 
Sbjct: 1428 DEENTYKVENYEKVLKRKETELEEANENLDIEKKDRMNKE----KQVKKLEGELKETKDK 1483

Query: 226  VFTKIKE-----VVKKHVNAELGHRKLRGLAFDHTYFNDKLN-QFLKEIKNHQKEYDESE 279
            +   I E       KK  +A+L   +L     +H     KLN Q  K  +++Q   +E  
Sbjct: 1484 LSAAIAEKDSIFTAKKQSDADL--EELNKTVEEHDEVVAKLNTQITKLTRDNQSAEEELN 1541

Query: 280  KGSSKARYHAAYAHIYWDLANDWVNGRVGDKSDEWARTSTNIASWIGRITRTEGLGGVTY 339
            +  SKA           +  N+  +  VG  + +        A  I  + +   + G   
Sbjct: 1542 ELRSKADKDKKKISELEEQVNELESRPVGTGNADENEIKIRDAQ-IADLNKALEMKGDQN 1600

Query: 340  DQI----KQLR----DLASKVK-ADYHWAEIRHG------NRFKAETRLAYSTIA----- 379
            +Q+    K+L+    DL SK++ A+    ++ +       ++ +A+  ++  TI      
Sbjct: 1601 NQLQATNKELKAKNNDLTSKIEIAENEMKKLENAKKRLEQDKDEADKAVSEQTIKRKGLE 1660

Query: 380  -NVANFTSELK----QATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADK 434
              V   T+E++    Q    +    +EEKQR E +  E   +E+ ++E    A+ E    
Sbjct: 1661 EEVKKLTTEIQALKFQINAPSSVAQEEEKQRLESDIAEL--KEQLEQERTTAANAEA--- 1715

Query: 435  DLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPK----EEELEEVKDEGKKGKEPGTTETDD 490
               E+  I+AE D+    L  V     KL  K    + E++ +K+E K  ++     TDD
Sbjct: 1716 ---ERKKIQAELDEVKFNLEDVTNQREKLVAKNSENDAEIDSLKEEKKALEDEIEKITDD 1772

Query: 491  R-------EETERKNQDILD--NSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQD 541
                    +  +RK   +LD  +S ++ K   ++E      A     + H      K + 
Sbjct: 1773 NNKLNEEIDSLDRKYNALLDSKDSDVSMKEKFQDELKVTKDALETEKKNHAETMRLKGRL 1832

Query: 542  QREKPLASDIGVG-ESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDS 600
            ++E   A+++ V  E+    + L ++EK   +  ++ R A+   +S M   D  +   D 
Sbjct: 1833 EKE---AAEVQVRLEALQKNLDLAQQEK--AKATKDYRAADGELKSLMNELDDVKDQLDK 1887

Query: 601  YKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQE 639
             ++  +   DE+    QKY K   +  S  D   +  QE
Sbjct: 1888 AQDDLADKEDELATLDQKY-KTLVKQKSVFDSRMQEMQE 1925


>gi|167534356|ref|XP_001748856.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163772818|gb|EDQ86466.1| predicted protein [Monosiga brevicollis MX1]
          Length = 1405

 Score = 39.3 bits (90), Expect = 3.9,   Method: Composition-based stats.
 Identities = 46/214 (21%), Positives = 80/214 (37%), Gaps = 16/214 (7%)

Query: 400  QEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTH 459
            QE     E +  + A+ E     A+E+     A +   +KTP + E        P V   
Sbjct: 1134 QETPAEEELQESDTAESEPQKTPAEEELQESDAAESEPQKTPAETE--------PQVEPQ 1185

Query: 460  SVKLPPKEEELEEVKD-EGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTH-TKNET 517
                 P EEEL+E    E +  K P  TE     +     +++ ++     +   T  ET
Sbjct: 1186 ET---PAEEELQESDAAESEPQKTPAETEPQVEPQKTPAEEELQESDAAESEPQKTPAET 1242

Query: 518  PAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENL 577
                  +  PA+      D    + ++ P  ++    E++    + T  E ELQ + +  
Sbjct: 1243 EPQVEPQETPAEEELQESDAAESEPQKTPAETEPQAAETE---PQETPTEPELQVEPQET 1299

Query: 578  RVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDE 611
               E +Q+S     + QE   +S  +     P E
Sbjct: 1300 PAEEELQESDAAQVEPQETPAESELQAAETEPQE 1333



 Score = 38.5 bits (88), Expect = 7.5,   Method: Composition-based stats.
 Identities = 51/214 (23%), Positives = 86/214 (40%), Gaps = 24/214 (11%)

Query: 401  EEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHS 460
            EE+ +    A+ +  +  A+ E + +     A+++LQE     AE +       + P   
Sbjct: 1158 EEELQESDAAESEPQKTPAETEPQVEPQETPAEEELQESD--AAESEPQKTPAETEPQVE 1215

Query: 461  VKLPPKEEELEEVK-DEGKKGKEPGTTE-----TDDREETERKNQDILDNSLLAGKTHTK 514
             +  P EEEL+E    E +  K P  TE      +   E E +  D  ++        T+
Sbjct: 1216 PQKTPAEEELQESDAAESEPQKTPAETEPQVEPQETPAEEELQESDAAESEPQKTPAETE 1275

Query: 515  --------NETPAIPTAKAPPAQ--AHKGIQ--DKKPQDQREKPLASDIGVGESDYAGIK 562
                     ETP  P  +  P +  A + +Q  D    + +E P  S++   E++    +
Sbjct: 1276 PQAAETEPQETPTEPELQVEPQETPAEEELQESDAAQVEPQETPAESELQAAETE---PQ 1332

Query: 563  LTKKEKELQEQE-ENLRVAEIIQQSRMQSEDLQE 595
             T  E ELQE +       E + +S  Q E  QE
Sbjct: 1333 ETPAEPELQESDAAEAEPQETLAESEPQDEPRQE 1366


>gi|293366801|ref|ZP_06613477.1| SMC family domain protein [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|291319102|gb|EFE59472.1| SMC family domain protein [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|329736623|gb|EGG72889.1| chromosome segregation protein SMC [Staphylococcus epidermidis
           VCU045]
          Length = 1189

 Score = 39.3 bits (90), Expect = 3.9,   Method: Composition-based stats.
 Identities = 86/397 (21%), Positives = 168/397 (42%), Gaps = 60/397 (15%)

Query: 559 AGIKLTKKEK-----ELQEQEENL-RVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEI 612
           AG+   KK K     +L   E+NL RV +I+     + E L+E+A  + KE+K LS    
Sbjct: 166 AGVLKYKKRKAESIQKLDHTEDNLNRVEDILYDLEGRVEPLKEEAAIA-KEYKQLS---- 220

Query: 613 KQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSPLGLMYE 672
           K+  Q    V   + S +D   +  Q  D+ +NH                      L  +
Sbjct: 221 KEMEQSDVIV---TVSDIDHYTEDNQRLDERLNH----------------------LKSQ 255

Query: 673 KDELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMS----KAVEAGESSVRKHSFEVLSS 728
           + E  G +A   +++ L +      + N   ++ ++    KA E  E    K    VL  
Sbjct: 256 QAEKEGQQA---QINQLLQKYKGKRQQNDYDIEKLNYELVKATENYEQLSGK--LNVLEE 310

Query: 729 KHQKSVIAVNNFIKEITHHTRRLVKEDPKRGKSESYLSDIRSELQKVNKTVMDIRIKLRL 788
           + +        + +E+ +   ++     ++ ++E  L+D++++ +++NK V ++   L +
Sbjct: 311 RKKNQSETNARYEEELDNLESQIDSIKNEKAQNEKLLADLKNKQKQLNKEVQELESLLYI 370

Query: 789 YGIFQDIPQEQ--PPLYTIISGSEKILQGDYTFPPLSSLDVQSKFDSSYSKLFEIF--YG 844
                D   E+     YT++S  + ++  D  F   +  + ++K     S+L E F    
Sbjct: 371 SDEQHDEKLEEIKNSYYTLMS-EQSVVNNDIRFLEHTINENEAKKSRLDSRLVEAFNQLK 429

Query: 845 DWTNNAIKEERYWTIYAFERSLKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAK 904
           D   N  + ++      ++ S K+   +   +++L    QQ +DS   L E + +L +A 
Sbjct: 430 DIQQNITQTQK-----EYQSSKKSMEKVEQNIQQLE---QQLTDSKRLLSEYENKLYQAY 481

Query: 905 KYKESNDERIVSFIRSE--FEREIKELKSVIEADAKE 939
           +Y E    RI S    E  +      +K +++A  KE
Sbjct: 482 RYNEKLKSRIDSLATQEEDYTYFFNGVKHILKAKDKE 518


>gi|198471785|ref|XP_002133841.1| GA23104 [Drosophila pseudoobscura pseudoobscura]
 gi|198146078|gb|EDY72468.1| GA23104 [Drosophila pseudoobscura pseudoobscura]
          Length = 845

 Score = 39.3 bits (90), Expect = 3.9,   Method: Composition-based stats.
 Identities = 49/220 (22%), Positives = 94/220 (42%), Gaps = 15/220 (6%)

Query: 386 SELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAE 445
           S+ KQ     +   Q+ K RR++  KE+   E   +E +E+  +EK  ++ Q++ P    
Sbjct: 254 SQKKQPQGAGQKKGQKNK-RRKKSQKEEPQEEGQKEEPQEEGQKEKPQEENQKEDP---- 308

Query: 446 GDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNS 505
            ++     P       K   K + +E  ++ G+K K  G  + +DR+E  +K++    N 
Sbjct: 309 QEEIQKHKPQNKNQKAKPQAKTQNVEP-QEGGQKEKPRGENQKEDRQEESQKHKPQNKNQ 367

Query: 506 LLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTK 565
               +  T+ ET      + P  +  K  +D + + Q+ KP          +       K
Sbjct: 368 KAKPQAKTQKETQEEGQKEKPRGENQK--EDPQEESQKHKP-------QNKNQKAKPQAK 418

Query: 566 KEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWK 605
            +KE QE+ +  +  E  Q+   Q E  + K  +  ++ K
Sbjct: 419 TQKEPQEEGQKEKAQEENQKEDPQEESQKHKPQNKNQKAK 458


>gi|119574312|gb|EAW53927.1| myosin, heavy polypeptide 11, smooth muscle, isoform CRA_c [Homo
            sapiens]
          Length = 1954

 Score = 39.3 bits (90), Expect = 3.9,   Method: Composition-based stats.
 Identities = 61/272 (22%), Positives = 118/272 (43%), Gaps = 31/272 (11%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE--ITHHTRRLVKEDPK-------RGKSESY 764
             E+ ++K   E+L    Q + ++    + E  I+  T  L +E+ K       + K ES 
Sbjct: 976  AEAKIKKLEDEILVMDDQNNKLSKERKLLEERISDLTTNLAEEEEKAKNLTKLKNKHESM 1035

Query: 765  LSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTIIS-------GSEKILQGD 816
            +S++   L+K  K+  ++ ++K +L G   D  ++   L   I+         E+ LQ  
Sbjct: 1036 ISELEVRLKKEEKSRQELEKLKRKLEGDASDFHEQIADLQAQIAELKMQLAKKEEELQA- 1094

Query: 817  YTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAEV 876
                 L+ LD +    ++  K      G  ++  ++E+      A  ++ K +  L  E+
Sbjct: 1095 ----ALARLDDEIAQKNNALKKIRELEGHISD--LQEDLDSERAARNKAEKQKRDLGEEL 1148

Query: 877  ERLSGLAQQPSDSTADLKELQ-------TQLSRAKKYKESNDERIVSFIRSEFEREIKEL 929
            E L    +   DSTA  +EL+       T L +A   +  + E  V  +R +  + ++EL
Sbjct: 1149 EALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEEL 1208

Query: 930  KSVIEADAKENPNPNKNQKKLQKTREKLVAQL 961
               +E   +   N +KN++ L+K    L  +L
Sbjct: 1209 TEQLEQFKRAKANLDKNKQTLEKENADLAGEL 1240


>gi|118082511|ref|XP_416146.2| PREDICTED: similar to NY-REN-58 antigen [Gallus gallus]
          Length = 770

 Score = 39.3 bits (90), Expect = 3.9,   Method: Composition-based stats.
 Identities = 100/427 (23%), Positives = 174/427 (40%), Gaps = 75/427 (17%)

Query: 250 LAFDHTYFNDKLNQFLKEIKNHQKEYDESEKGSSKARYHAAYAHIYWD---LANDWV--- 303
           L ++HT        FLK    HQKE  E      K +Y A  A +  D   L N  V   
Sbjct: 195 LRYEHT--------FLKSEFEHQKEEHEHVLEEEKIKYEAEIARLEKDKEELHNQLVSVD 246

Query: 304 ----NGRVGDKSDEWARTSTNIASWIGRIT-----------RTEGLGGVTYDQIKQLRDL 348
               + RV   S E A+    +      +            + E +  V   Q+ +L+ L
Sbjct: 247 PTRDSKRVEVLSREKAQLCQKLKGLEAEVAELRAERDNCGVQAENVQRVQVRQLAELQSL 306

Query: 349 ASKVKADYHWAEIRHGNRFKAETRL--------------AYSTIANVANFTSELKQATVL 394
           A  ++A+   AE +H  R + E ++              +   + ++A    ELKQ+  L
Sbjct: 307 ARSLEAEKKSAE-QHIGRIEEELQMCREQNFLLTSKLHKSEQEVNSLAAKVKELKQSHKL 365

Query: 395 ARANAQEEKQRREQEAKEKADREK-------ADKEA-KEKADREK---ADKDLQEKTPIK 443
              N + E  R + E + + ++ +       +DKE  KE  +R K    +KD +    ++
Sbjct: 366 EVTNVKLEAARTKNEVERERNKIQSEMDGLLSDKEVLKEAVERHKVLLVEKDQELVRKVQ 425

Query: 444 AEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILD 503
           A  ++    + ++    ++L  +   LE+VK E    ++   TE D  EE  R  Q   +
Sbjct: 426 AAKEEVFGKIAALQDEKLELESRLAHLEKVKLEQDAWRQ---TEKDQYEEKLRVVQLAEE 482

Query: 504 NSLLAGKT-HTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIK 562
           +S    +    K +  AI T +    +  +   D K Q Q  +   + +   E+D     
Sbjct: 483 SSKRELQCLRLKIQQQAIQTEELEEKKRER--DDLKQQIQDMQLQVASLSQSEND----- 535

Query: 563 LTKKEKELQEQEENLRVAEIIQQSRMQSEDLQ---EKAWDSYK-EW---KSLSPDEIKQR 615
           L +  ++L+E  E LR  +  Q +R Q+E  Q   EK  +  + EW   K +    I ++
Sbjct: 536 LLEYNQKLKETVERLR--QECQNARTQAEKAQLETEKTLEYKRIEWLEEKHMLTQRITEK 593

Query: 616 FQKYAKV 622
            +KY +V
Sbjct: 594 EEKYNEV 600


>gi|83682377|emb|CAJ28178.1| immunoglobulin G binding protein A precursor [Staphylococcus
           aureus]
          Length = 483

 Score = 39.3 bits (90), Expect = 3.9,   Method: Composition-based stats.
 Identities = 38/132 (28%), Positives = 61/132 (46%), Gaps = 12/132 (9%)

Query: 365 NRFKAETRLAYSTIANVANFTSE--------LKQATVLARANAQEEKQRREQEAKEKADR 416
           N+F  E + A+  I ++ N T E        LK    +++    E K+  + +A ++ D 
Sbjct: 245 NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDN 304

Query: 417 EKADKEAKEKADREKADKDLQE--KTPIKAEGDDFGLGLPSVP-THSVKLPPKEEELEEV 473
            K  KE   K  +E  +K  +E  K P K +G+  G    + P     K P KE+  +  
Sbjct: 305 NKPGKEDGNKPGKEDGNKPGKEDNKKPSKEDGNKPGKEDGNKPGKEDNKKPSKEDGNKPG 364

Query: 474 KDEGKK-GKEPG 484
           K++G K GKE G
Sbjct: 365 KEDGNKPGKEDG 376


>gi|120865143|emb|CAL51230.1| immunoglobulin G binding protein A [Staphylococcus aureus]
          Length = 474

 Score = 39.3 bits (90), Expect = 3.9,   Method: Composition-based stats.
 Identities = 38/132 (28%), Positives = 61/132 (46%), Gaps = 12/132 (9%)

Query: 365 NRFKAETRLAYSTIANVANFTSE--------LKQATVLARANAQEEKQRREQEAKEKADR 416
           N+F  E + A+  I ++ N T E        LK    +++    E K+  + +A ++ D 
Sbjct: 245 NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDN 304

Query: 417 EKADKEAKEKADREKADKDLQE--KTPIKAEGDDFGLGLPSVP-THSVKLPPKEEELEEV 473
            K  KE   K  +E  +K  +E  K P K +G+  G    + P     K P KE+  +  
Sbjct: 305 NKPGKEDGNKPGKEDGNKPGKEDNKKPSKEDGNKPGKEDGNKPGKEDNKKPSKEDGNKPG 364

Query: 474 KDEGKK-GKEPG 484
           K++G K GKE G
Sbjct: 365 KEDGNKPGKEDG 376


>gi|170026940|gb|ACB05996.1| myosin heavy chain 11 smooth muscle isoform [Homo sapiens]
          Length = 2029

 Score = 39.3 bits (90), Expect = 4.1,   Method: Composition-based stats.
 Identities = 61/272 (22%), Positives = 118/272 (43%), Gaps = 31/272 (11%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE--ITHHTRRLVKEDPK-------RGKSESY 764
             E+ ++K   E+L    Q + ++    + E  I+  T  L +E+ K       + K ES 
Sbjct: 983  AEAKIKKLEDEILVMDDQNNKLSKERKLLEERISDLTTNLAEEEEKAKNLTKLKNKHESM 1042

Query: 765  LSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTIIS-------GSEKILQGD 816
            +S++   L+K  K+  ++ ++K +L G   D  ++   L   I+         E+ LQ  
Sbjct: 1043 ISELEVRLKKEEKSRQELEKLKRKLEGDASDFHEQIADLQAQIAELKMQLAKKEEELQA- 1101

Query: 817  YTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAEV 876
                 L+ LD +    ++  K      G  ++  ++E+      A  ++ K +  L  E+
Sbjct: 1102 ----ALARLDDEIAQKNNALKKIRELEGHISD--LQEDLDSERAARNKAEKQKRDLGEEL 1155

Query: 877  ERLSGLAQQPSDSTADLKELQ-------TQLSRAKKYKESNDERIVSFIRSEFEREIKEL 929
            E L    +   DSTA  +EL+       T L +A   +  + E  V  +R +  + ++EL
Sbjct: 1156 EALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEEL 1215

Query: 930  KSVIEADAKENPNPNKNQKKLQKTREKLVAQL 961
               +E   +   N +KN++ L+K    L  +L
Sbjct: 1216 TEQLEQFKRAKANLDKNKQTLEKENADLAGEL 1247


>gi|312214683|emb|CBX94637.1| hypothetical protein [Leptosphaeria maculans]
          Length = 1125

 Score = 39.3 bits (90), Expect = 4.1,   Method: Composition-based stats.
 Identities = 50/220 (22%), Positives = 95/220 (43%), Gaps = 12/220 (5%)

Query: 381 VANFTSELKQATVLARANAQEEKQRREQEAKEKAD--REKADKEAKEKADREKADKDLQE 438
           +  +  EL + TV A    QE     EQ  +E A   +    + A E+  RE A+ D  +
Sbjct: 563 IEKYRMELDEVTVAAAKFEQEHHDMIEQIEREHAIAIQNLETERAAEQEGREAAEADAMQ 622

Query: 439 KTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKN 498
           K  +    DD    +  + T    +      L E      +G+E   TE D++ +   ++
Sbjct: 623 KQDVI---DDLEASIERMETEVDAITQDMNTLRERLAAESEGREIAETERDEQTDLAYQH 679

Query: 499 QDILDNSLLAGKTHTKNE--TPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGES 556
            + ++N  L  + H   E  T    +  A  AQ  K   +    +++ + L + +   +S
Sbjct: 680 ANTIEN--LNEQIHELKEQLTEFRTSLNAERAQREKTEAEIDGANEKIEDLTTRLH--DS 735

Query: 557 DYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEK 596
                +L  K  +LQ+++E   +A + +++R + EDL E+
Sbjct: 736 GLQANELRSKLFQLQQEKEE-TIATLQEEAREREEDLTEQ 774


>gi|126306039|ref|XP_001381116.1| PREDICTED: similar to hook1 protein [Monodelphis domestica]
          Length = 730

 Score = 39.3 bits (90), Expect = 4.1,   Method: Composition-based stats.
 Identities = 31/100 (31%), Positives = 53/100 (53%), Gaps = 8/100 (8%)

Query: 64  IEQRLKKVS------ERYERVVSRDLTLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSD 117
           +E+ LKK +      E Y+R V +DL L +    K    +   +KRL E  E +L +K D
Sbjct: 359 LEEELKKANAARTQLEMYKRQV-QDLHLKLSDESKRADTLAFEMKRLEEKHEALLKEK-D 416

Query: 118 RLLCRFMDMVETEDEHKINKQVRDALESAGFDLESTQENI 157
           RL+ +   + ET +E + ++  +D L  AG  + ++ EN+
Sbjct: 417 RLIVQRDALKETNEELRCSQVQQDHLSQAGGSVSTSYENL 456


>gi|238880625|gb|EEQ44263.1| conserved hypothetical protein [Candida albicans WO-1]
          Length = 1332

 Score = 39.3 bits (90), Expect = 4.2,   Method: Composition-based stats.
 Identities = 88/452 (19%), Positives = 174/452 (38%), Gaps = 70/452 (15%)

Query: 101 LKRLAETG---EVILSDKSDRLLCRFMDMVETEDEHKINK------QVRDALESAGFDLE 151
           LKR  E G   E+ L +K + L      + E +D +++ K      +    +    F+L+
Sbjct: 485 LKRKVEVGSNNEIELEEKRNDLELTMKLLQEKKDLNEVRKLDAKIMECNSEISKLEFELD 544

Query: 152 STQENIRKVESALINNNMKDAFRFLELAQKSKETADSHIIEAID------VGTKLKENTP 205
              E  +K+ ++   ++++    FLE + KSK+   S I   ID      +G+KL  +  
Sbjct: 545 ---ELAKKLSTSNKQSDLRSKVLFLEESAKSKKAELSKIFATIDSSYFDVLGSKLDVDVG 601

Query: 206 PTTFTS-ISKVLLKSNNMQDVVFTKIKEVVKKHVNAELGHRKLRGLAFDHTYFNDKLNQF 264
            +  +  IS + +KS   Q                     +K+  L  +     + +   
Sbjct: 602 ESLLSQKISNLEIKSEEQQ---------------------KKVGSLESELQINKNSIESI 640

Query: 265 LKEIKNHQKEYDESEKGSSKARYHAA---YAHIYWDLANDWVNGRVGDKSDEWARTSTNI 321
           LK I+ +  + D  +   +K         Y ++  DL + + N      S E  R   N 
Sbjct: 641 LKTIEENNSKIDSLKSNITKVIGEDEINDYENVVNDLEDSYRNVSEDVNSAEVTRDFKNS 700

Query: 322 ASWIG----------RITRTEGLGGVTYD--------QIKQLRDLASKVKADYHWAEIRH 363
           A              R+    GLG    D        +I+++R+ + ++K      E+  
Sbjct: 701 AISFAEENKCCLLCKRLFEQGGLGSFIQDLKQSVDEHKIQEIREQSLEIKK-----ELED 755

Query: 364 GNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEA 423
                 E       +ANV NF  +LK+   L   ++Q E +  +Q  +++  +   D   
Sbjct: 756 VKSINLEVVNYRECLANVQNFECKLKE---LVDKSSQIENELEQQRKEQQTIKHSLDNAL 812

Query: 424 KEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEP 483
             K     A +   E + I+ + D+    L       V +   +++ +++  + KK ++ 
Sbjct: 813 SLKKPLSDATRIHLEVSEIEFQLDELNEDLSGFGGSVVSVDELQKQQQDINLKIKKTRQD 872

Query: 484 GTTETDDREETERKNQDILDNSLLAGKTHTKN 515
               T+ + + +R+ Q  L+N +   K    N
Sbjct: 873 LNDYTESKYKAQRELQK-LENRVKDTKLQISN 903


>gi|47222635|emb|CAG03000.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 1357

 Score = 39.3 bits (90), Expect = 4.2,   Method: Composition-based stats.
 Identities = 50/257 (19%), Positives = 111/257 (43%), Gaps = 18/257 (7%)

Query: 368 KAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKA 427
           + E R+ Y+      +FT +  Q          E+K   EQ+ K   +R+ AD +A  + 
Sbjct: 296 RGEWRVKYNRAIREMDFTKKKLQQEF-------EDKLETEQQNKRHLERKLADVQADSED 348

Query: 428 DREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTE 487
            +    +  ++   + AE  D  L    + + +  L  K+ + +  +++ +   +    E
Sbjct: 349 MQRSVQQLKKKCKKLTAELQDTKLHFEGLHSRNHDLEKKQRKFDLEQNQAQAEVQ---RE 405

Query: 488 TDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPL 547
              RE   R+ +D+L + +L  +   + +   + +      Q    +QD   Q+ +++  
Sbjct: 406 RSQRERLARE-KDLLTSEMLNLRQQLQEKDNELCSVNMKVQQLELELQDLSSQESKDEAS 464

Query: 548 ASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSE---DLQEKAWDSYKEW 604
            + +     D    K+  +E+EL EQ  ++   ++++Q++++ E   + Q +A     E 
Sbjct: 465 LAKVKKQLRDLEA-KVKDQEEELDEQAGSI---QMLEQAKLRLEMEMERQRQAHSKEIES 520

Query: 605 KSLSPDEIKQRFQKYAK 621
           K    DEI++   K  K
Sbjct: 521 KDEEVDEIRRSCSKKLK 537


>gi|27807325|ref|NP_777259.1| myosin-10 [Bos taurus]
 gi|13431706|sp|Q27991|MYH10_BOVIN RecName: Full=Myosin-10; AltName: Full=Cellular myosin heavy chain,
            type B; AltName: Full=Myosin heavy chain 10; AltName:
            Full=Myosin heavy chain, non-muscle IIb; AltName:
            Full=Non-muscle myosin heavy chain B; Short=NMMHC-B;
            AltName: Full=Non-muscle myosin heavy chain IIb;
            Short=NMMHC II-b; Short=NMMHC-IIB
 gi|4115748|dbj|BAA36494.1| nonmuscle myosin heavy chain B [Bos taurus]
 gi|296476696|gb|DAA18811.1| myosin-10 [Bos taurus]
          Length = 1976

 Score = 39.3 bits (90), Expect = 4.2,   Method: Composition-based stats.
 Identities = 70/300 (23%), Positives = 122/300 (40%), Gaps = 71/300 (23%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   E+L  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 976  AEAKIKKMEEEILLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 1030

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTII-------SGSEK 811
            K E  +SD+   L+K  KT  ++ + K +L G   D+  +   L   I       +  E+
Sbjct: 1031 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKIQVAKKEE 1090

Query: 812  ILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERS 865
             LQG      D T    ++L V  +  +  ++L E F                    E++
Sbjct: 1091 ELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFES------------------EKA 1132

Query: 866  LKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFERE 925
             +N+A             +Q  D + +L+ L+T+L        +  E     +R++ E+E
Sbjct: 1133 SRNKAE------------KQKRDLSEELEALKTELEDTLDTTAAQQE-----LRTKREQE 1175

Query: 926  IKELKSVIEADAKENPNPNKNQKKLQKTR-EKLVAQL--SSRLKELNIDNAYGLWNEYKE 982
            + ELK  +E + K +    ++ ++   T  E+L  QL  + R K     N  GL  + KE
Sbjct: 1176 VAELKKALEEETKSHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKE 1235


>gi|323495469|ref|ZP_08100544.1| translation initiation factor IF-2 [Vibrio sinaloensis DSM 21326]
 gi|323319466|gb|EGA72402.1| translation initiation factor IF-2 [Vibrio sinaloensis DSM 21326]
          Length = 895

 Score = 39.3 bits (90), Expect = 4.2,   Method: Composition-based stats.
 Identities = 25/63 (39%), Positives = 34/63 (53%), Gaps = 12/63 (19%)

Query: 394 LARANAQEEKQRREQEAKEKADRE---------KADKEAKEKADREKADKDLQEKTPIKA 444
           LA+  A+E+ +R   EA EKA RE          A +EA+EKA R +ADK  +E     A
Sbjct: 122 LAKREAEEQAKR---EAAEKAQREAEEKAKQEADAKREAEEKAKRAQADKAKKEMNAKNA 178

Query: 445 EGD 447
           E +
Sbjct: 179 EAN 181


>gi|284164775|ref|YP_003403054.1| SMC domain protein [Haloterrigena turkmenica DSM 5511]
 gi|284014430|gb|ADB60381.1| SMC domain protein [Haloterrigena turkmenica DSM 5511]
          Length = 895

 Score = 39.3 bits (90), Expect = 4.2,   Method: Composition-based stats.
 Identities = 28/112 (25%), Positives = 55/112 (49%), Gaps = 5/112 (4%)

Query: 877 ERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSF--IRSEFER---EIKELKS 931
           ERL+GL  + +D    +   + Q  +A++  E+ ++ +      R E +R   EI+EL+S
Sbjct: 207 ERLNGLESRRADVREKIDRFEEQREQARQTLETAEDVLERHEETREEIDRLDEEIEELRS 266

Query: 932 VIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKELNIDNAYGLWNEYKED 983
            I    ++  N     + L+  RE L  +    L E+++++  G  ++  ED
Sbjct: 267 KITETERKRENAKDEIRDLESRRETLADEREELLAEVDLEDTDGASDKAVED 318


>gi|194219197|ref|XP_001916791.1| PREDICTED: myosin, heavy chain 11, smooth muscle [Equus caballus]
          Length = 1979

 Score = 39.3 bits (90), Expect = 4.2,   Method: Composition-based stats.
 Identities = 61/272 (22%), Positives = 120/272 (44%), Gaps = 31/272 (11%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE--ITHHTRRLVKEDPK-------RGKSESY 764
             E+ ++K   ++L    Q + ++    + E  I+  T  L +E+ K       + K ES 
Sbjct: 983  AEAKIKKLEDDILVMDDQNNKLSKERKLLEERISDLTTNLAEEEEKAKNLTKLKNKHESM 1042

Query: 765  LSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTIIS-------GSEKILQGD 816
            +S++   L+K  K+  ++ ++K +L G   D+ ++   L   I+         E+ LQ  
Sbjct: 1043 ISELEVRLKKEEKSRQELEKLKRKLDGEASDLHEQIADLQAQIAELKMQLAKKEEELQA- 1101

Query: 817  YTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAEV 876
                 LS LD +    ++  K      G  ++  ++E+      A  ++ K +  L  E+
Sbjct: 1102 ----ALSRLDDEIAQKNNALKKIRELEGHISD--LQEDLDSERAARNKAEKQKRDLGEEL 1155

Query: 877  ERLSGLAQQPSDSTADLKELQ-------TQLSRAKKYKESNDERIVSFIRSEFEREIKEL 929
            E L    +   DSTA  +EL+       T L +A   +  + E  V  +R +  + ++EL
Sbjct: 1156 EALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHTQVVEEL 1215

Query: 930  KSVIEADAKENPNPNKNQKKLQKTREKLVAQL 961
               +E   +   N +KN++ L+K    L ++L
Sbjct: 1216 TEQLEQFKRAKANLDKNKQTLEKENADLTSEL 1247


>gi|125974659|ref|YP_001038569.1| transcription termination factor Rho [Clostridium thermocellum ATCC
           27405]
 gi|125714884|gb|ABN53376.1| transcription termination factor Rho [Clostridium thermocellum ATCC
           27405]
          Length = 653

 Score = 39.3 bits (90), Expect = 4.3,   Method: Composition-based stats.
 Identities = 35/152 (23%), Positives = 65/152 (42%), Gaps = 12/152 (7%)

Query: 400 QEEKQRREQEAKEKADREKADKEAK--EKADREKADKDLQEKTPIKAEGDDFGLGLPSVP 457
           Q++++   + A  KA+  K++ E+K   K++ EKA+   + K P          G P   
Sbjct: 120 QQQEEANVESAPVKAEENKSEAESKIESKSESEKAESKSESKEPESKSESKTKRG-PKSK 178

Query: 458 THS--VKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSL---LAGKTH 512
           T S   +     ++  E  D  K   E    +  ++ + +   QD +        A  + 
Sbjct: 179 TESKEAEAAQNNQDAAESADASKADSEEALAQQKEQSDDKASEQDAVKQEQAVSTAEGSM 238

Query: 513 TKNETPAIPTAKAPPAQAHKGIQDKKPQDQRE 544
            K ET  +P A A  A+A +    K+P+ ++E
Sbjct: 239 AKAETETVPDADAEKAKAER----KQPEQKKE 266


>gi|312222248|emb|CBY02188.1| hypothetical protein [Leptosphaeria maculans]
          Length = 519

 Score = 39.3 bits (90), Expect = 4.3,   Method: Composition-based stats.
 Identities = 58/210 (27%), Positives = 97/210 (46%), Gaps = 38/210 (18%)

Query: 395 ARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLP 454
           AR  A+  +QRR++EA+ KA ++ + +EAKE   R+KA++ L      +  G   G G P
Sbjct: 297 ARNRAELIEQRRKKEAERKAAKKASRQEAKEDEARQKAEEQLA-----RIRG---GSGSP 348

Query: 455 SVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTK 514
           SV       P +  E E   + GK           D ++ E      L++    GK+  K
Sbjct: 349 SV------FPARSPESERNFNFGKVAW--------DGQQLEANLSGFLESRKKKGKSDAK 394

Query: 515 NETPAIPTAKAPPAQAHKGIQDKKPQDQREKPL---ASDIGVGES--DYAGI-------K 562
               A+  A+   A+ + G+ ++K +D +EK L   A     GE   D  G+       +
Sbjct: 395 T---ALEAAQKKQARLN-GLDEEKRKDIQEKVLWLAAKKRAQGEKVLDDVGLLKKSLKRQ 450

Query: 563 LTKKEKELQEQEENLRVAEIIQQSRMQSED 592
           L +KEK  QE +E L   E  ++++ +  +
Sbjct: 451 LKQKEKSKQEWKERLTNVEHGKEAKQKKRE 480


>gi|297700004|ref|XP_002827056.1| PREDICTED: myosin-10 isoform 1 [Pongo abelii]
          Length = 2007

 Score = 39.3 bits (90), Expect = 4.3,   Method: Composition-based stats.
 Identities = 70/300 (23%), Positives = 122/300 (40%), Gaps = 71/300 (23%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   E+L  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 1007 AEAKIKKMEEEILLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 1061

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTII-------SGSEK 811
            K E  +SD+   L+K  KT  ++ + K +L G   D+  +   L   I       +  E+
Sbjct: 1062 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKLQLAKKEE 1121

Query: 812  ILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERS 865
             LQG      D T    ++L V  +  +  ++L E F                    E++
Sbjct: 1122 ELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFES------------------EKA 1163

Query: 866  LKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFERE 925
             +N+A             +Q  D + +L+ L+T+L        +  E     +R++ E+E
Sbjct: 1164 SRNKAE------------KQKRDLSEELEALKTELEDTLDTTAAQQE-----LRTKREQE 1206

Query: 926  IKELKSVIEADAKENPNPNKNQKKLQKTR-EKLVAQL--SSRLKELNIDNAYGLWNEYKE 982
            + ELK  +E + K +    ++ ++   T  E+L  QL  + R K     N  GL  + KE
Sbjct: 1207 VAELKKALEEETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKE 1266


>gi|297271897|ref|XP_001118181.2| PREDICTED: myosin-10 [Macaca mulatta]
          Length = 1999

 Score = 39.3 bits (90), Expect = 4.3,   Method: Composition-based stats.
 Identities = 70/300 (23%), Positives = 122/300 (40%), Gaps = 71/300 (23%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   E+L  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 999  AEAKIKKMEEEILLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 1053

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTII-------SGSEK 811
            K E  +SD+   L+K  KT  ++ + K +L G   D+  +   L   I       +  E+
Sbjct: 1054 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKLQLAKKEE 1113

Query: 812  ILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERS 865
             LQG      D T    ++L V  +  +  ++L E F                    E++
Sbjct: 1114 ELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFES------------------EKA 1155

Query: 866  LKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFERE 925
             +N+A             +Q  D + +L+ L+T+L        +  E     +R++ E+E
Sbjct: 1156 SRNKAE------------KQKRDLSEELEALKTELEDTLDTTAAQQE-----LRTKREQE 1198

Query: 926  IKELKSVIEADAKENPNPNKNQKKLQKTR-EKLVAQL--SSRLKELNIDNAYGLWNEYKE 982
            + ELK  +E + K +    ++ ++   T  E+L  QL  + R K     N  GL  + KE
Sbjct: 1199 VAELKKALEEETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKE 1258


>gi|119610456|gb|EAW90050.1| myosin, heavy polypeptide 10, non-muscle, isoform CRA_c [Homo
            sapiens]
          Length = 1976

 Score = 39.3 bits (90), Expect = 4.3,   Method: Composition-based stats.
 Identities = 70/300 (23%), Positives = 122/300 (40%), Gaps = 71/300 (23%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   E+L  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 976  AEAKIKKMEEEILLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 1030

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTII-------SGSEK 811
            K E  +SD+   L+K  KT  ++ + K +L G   D+  +   L   I       +  E+
Sbjct: 1031 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKLQLAKKEE 1090

Query: 812  ILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERS 865
             LQG      D T    ++L V  +  +  ++L E F                    E++
Sbjct: 1091 ELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFES------------------EKA 1132

Query: 866  LKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFERE 925
             +N+A             +Q  D + +L+ L+T+L        +  E     +R++ E+E
Sbjct: 1133 SRNKAE------------KQKRDLSEELEALKTELEDTLDTTAAQQE-----LRTKREQE 1175

Query: 926  IKELKSVIEADAKENPNPNKNQKKLQKTR-EKLVAQL--SSRLKELNIDNAYGLWNEYKE 982
            + ELK  +E + K +    ++ ++   T  E+L  QL  + R K     N  GL  + KE
Sbjct: 1176 VAELKKALEEETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKE 1235


>gi|114669111|ref|XP_511852.2| PREDICTED: myosin, heavy polypeptide 10, non-muscle isoform 8 [Pan
            troglodytes]
 gi|208965262|dbj|BAG72645.1| myosin, heavy chain 10, non-muscle [synthetic construct]
          Length = 2007

 Score = 39.3 bits (90), Expect = 4.3,   Method: Composition-based stats.
 Identities = 70/300 (23%), Positives = 122/300 (40%), Gaps = 71/300 (23%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   E+L  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 1007 AEAKIKKMEEEILLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 1061

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTII-------SGSEK 811
            K E  +SD+   L+K  KT  ++ + K +L G   D+  +   L   I       +  E+
Sbjct: 1062 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKLQLAKKEE 1121

Query: 812  ILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERS 865
             LQG      D T    ++L V  +  +  ++L E F                    E++
Sbjct: 1122 ELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFES------------------EKA 1163

Query: 866  LKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFERE 925
             +N+A             +Q  D + +L+ L+T+L        +  E     +R++ E+E
Sbjct: 1164 SRNKAE------------KQKRDLSEELEALKTELEDTLDTTAAQQE-----LRTKREQE 1206

Query: 926  IKELKSVIEADAKENPNPNKNQKKLQKTR-EKLVAQL--SSRLKELNIDNAYGLWNEYKE 982
            + ELK  +E + K +    ++ ++   T  E+L  QL  + R K     N  GL  + KE
Sbjct: 1207 VAELKKALEEETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKE 1266


>gi|114669121|ref|XP_001166431.1| PREDICTED: myosin, heavy polypeptide 10, non-muscle isoform 4 [Pan
            troglodytes]
          Length = 1970

 Score = 39.3 bits (90), Expect = 4.3,   Method: Composition-based stats.
 Identities = 70/300 (23%), Positives = 122/300 (40%), Gaps = 71/300 (23%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   E+L  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 970  AEAKIKKMEEEILLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 1024

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTII-------SGSEK 811
            K E  +SD+   L+K  KT  ++ + K +L G   D+  +   L   I       +  E+
Sbjct: 1025 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKLQLAKKEE 1084

Query: 812  ILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERS 865
             LQG      D T    ++L V  +  +  ++L E F                    E++
Sbjct: 1085 ELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFES------------------EKA 1126

Query: 866  LKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFERE 925
             +N+A             +Q  D + +L+ L+T+L        +  E     +R++ E+E
Sbjct: 1127 SRNKAE------------KQKRDLSEELEALKTELEDTLDTTAAQQE-----LRTKREQE 1169

Query: 926  IKELKSVIEADAKENPNPNKNQKKLQKTR-EKLVAQL--SSRLKELNIDNAYGLWNEYKE 982
            + ELK  +E + K +    ++ ++   T  E+L  QL  + R K     N  GL  + KE
Sbjct: 1170 VAELKKALEEETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKE 1229


>gi|114669113|ref|XP_001166470.1| PREDICTED: myosin, heavy polypeptide 10, non-muscle isoform 5 [Pan
            troglodytes]
          Length = 1992

 Score = 39.3 bits (90), Expect = 4.3,   Method: Composition-based stats.
 Identities = 70/300 (23%), Positives = 122/300 (40%), Gaps = 71/300 (23%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   E+L  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 992  AEAKIKKMEEEILLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 1046

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTII-------SGSEK 811
            K E  +SD+   L+K  KT  ++ + K +L G   D+  +   L   I       +  E+
Sbjct: 1047 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKLQLAKKEE 1106

Query: 812  ILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERS 865
             LQG      D T    ++L V  +  +  ++L E F                    E++
Sbjct: 1107 ELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFES------------------EKA 1148

Query: 866  LKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFERE 925
             +N+A             +Q  D + +L+ L+T+L        +  E     +R++ E+E
Sbjct: 1149 SRNKAE------------KQKRDLSEELEALKTELEDTLDTTAAQQE-----LRTKREQE 1191

Query: 926  IKELKSVIEADAKENPNPNKNQKKLQKTR-EKLVAQL--SSRLKELNIDNAYGLWNEYKE 982
            + ELK  +E + K +    ++ ++   T  E+L  QL  + R K     N  GL  + KE
Sbjct: 1192 VAELKKALEEETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKE 1251


>gi|641958|gb|AAA99177.1| non-muscle myosin B [Homo sapiens]
          Length = 1976

 Score = 39.3 bits (90), Expect = 4.3,   Method: Composition-based stats.
 Identities = 70/300 (23%), Positives = 122/300 (40%), Gaps = 71/300 (23%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   E+L  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 976  AEAKIKKMEEEILLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 1030

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTII-------SGSEK 811
            K E  +SD+   L+K  KT  ++ + K +L G   D+  +   L   I       +  E+
Sbjct: 1031 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKLQLAKKEE 1090

Query: 812  ILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERS 865
             LQG      D T    ++L V  +  +  ++L E F                    E++
Sbjct: 1091 ELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFES------------------EKA 1132

Query: 866  LKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFERE 925
             +N+A             +Q  D + +L+ L+T+L        +  E     +R++ E+E
Sbjct: 1133 SRNKAE------------KQKRDLSEELEALKTELEDTLDTTAAQQE-----LRTKREQE 1175

Query: 926  IKELKSVIEADAKENPNPNKNQKKLQKTR-EKLVAQL--SSRLKELNIDNAYGLWNEYKE 982
            + ELK  +E + K +    ++ ++   T  E+L  QL  + R K     N  GL  + KE
Sbjct: 1176 VAELKKALEEETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKE 1235


>gi|322487917|emb|CBZ23161.1| hypothetical protein LMXM_03_0270 [Leishmania mexicana
           MHOM/GT/2001/U1103]
          Length = 1372

 Score = 39.3 bits (90), Expect = 4.4,   Method: Composition-based stats.
 Identities = 53/243 (21%), Positives = 93/243 (38%), Gaps = 24/243 (9%)

Query: 366 RFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKE 425
           R  A T+      A VA   ++  +A     ANA + +QR     +++A+ E   + A+ 
Sbjct: 441 RVHAATQQRAELEAQVARLAADRDEARQELAANADDLQQRLHAATQQRAELEA--QVARL 498

Query: 426 KADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGT 485
            ADR++A ++L       A  DD    L +      +L  +   L   +DE ++      
Sbjct: 499 AADRDEARQEL------AANADDLQQRLHAATQQRAELEAQVARLAADRDEARQELAANA 552

Query: 486 TETDDREETERKNQDILDNS---LLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQ 542
            E   R     + +  L+     L A +   + E  A   A     + H   Q +   + 
Sbjct: 553 DELQQRLHAATQQRAELEAQVARLAADRDEARQELAA--NADDLQQRLHAATQQRAELEA 610

Query: 543 REKPLASDIGVGESDYAGI---------KLTKKEKELQEQEENLRV--AEIIQQSRMQSE 591
           +   LA+D      + A             T++  EL+ Q   L     E ++Q  M +E
Sbjct: 611 QVARLAADRDEARQELAANADELQQRLHAATQQRAELEAQVARLAADRDEAVEQKTMDAE 670

Query: 592 DLQ 594
           +LQ
Sbjct: 671 ELQ 673


>gi|320038771|gb|EFW20706.1| spindle assembly checkpoint component mad1 [Coccidioides posadasii
           str. Silveira]
          Length = 727

 Score = 39.3 bits (90), Expect = 4.4,   Method: Composition-based stats.
 Identities = 39/171 (22%), Positives = 80/171 (46%), Gaps = 22/171 (12%)

Query: 343 KQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARAN-AQE 401
           K+LR+L ++  AD+  A+    +  KA+ +        + + T ELKQ    + A  A  
Sbjct: 78  KELRELQARADADFRKAQAAESSSAKAQRK--------IESLTVELKQVQETSEAERASC 129

Query: 402 EKQRREQEAKEKADREKADKEAKEKADREKADKD-LQEKTPIKAE--------GDDFGLG 452
           E++ R  + + +A +E+ D    + AD+E+  K+ ++E   I++          ++    
Sbjct: 130 ERKIRALQEESRALQEECDDSRSQLADQERQYKNQVRELETIRSSLQQTLDELRNELQET 189

Query: 453 LPSVPTHSVKLPPKEEELEEVKDEG----KKGKEPGTTETDDREETERKNQ 499
              + T   +L  +E E+++++ E      +G EP       RE +E+ +Q
Sbjct: 190 KACLQTTQKRLSQREAEVDQLEAENIQLKSEGSEPEALTVLKRELSEQLSQ 240


>gi|27529744|dbj|BAA74889.2| KIAA0866 protein [Homo sapiens]
          Length = 1984

 Score = 39.3 bits (90), Expect = 4.4,   Method: Composition-based stats.
 Identities = 61/272 (22%), Positives = 118/272 (43%), Gaps = 31/272 (11%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE--ITHHTRRLVKEDPK-------RGKSESY 764
             E+ ++K   E+L    Q + ++    + E  I+  T  L +E+ K       + K ES 
Sbjct: 988  AEAKIKKLEDEILVMDDQNNKLSKERKLLEERISDLTTNLAEEEEKAKNLTKLKNKHESM 1047

Query: 765  LSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTIIS-------GSEKILQGD 816
            +S++   L+K  K+  ++ ++K +L G   D  ++   L   I+         E+ LQ  
Sbjct: 1048 ISELEVRLKKEEKSRQELEKLKRKLEGDASDFHEQIADLQAQIAELKMQLAKKEEELQA- 1106

Query: 817  YTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAEV 876
                 L+ LD +    ++  K      G  ++  ++E+      A  ++ K +  L  E+
Sbjct: 1107 ----ALARLDDEIAQKNNALKKIRELEGHISD--LQEDLDSERAARNKAEKQKRDLGEEL 1160

Query: 877  ERLSGLAQQPSDSTADLKELQ-------TQLSRAKKYKESNDERIVSFIRSEFEREIKEL 929
            E L    +   DSTA  +EL+       T L +A   +  + E  V  +R +  + ++EL
Sbjct: 1161 EALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEEL 1220

Query: 930  KSVIEADAKENPNPNKNQKKLQKTREKLVAQL 961
               +E   +   N +KN++ L+K    L  +L
Sbjct: 1221 TEQLEQFKRAKANLDKNKQTLEKENADLAGEL 1252


>gi|307703068|ref|ZP_07640015.1| surface exclusion protein PrgA [Streptococcus oralis ATCC 35037]
 gi|307623461|gb|EFO02451.1| surface exclusion protein PrgA [Streptococcus oralis ATCC 35037]
          Length = 839

 Score = 39.3 bits (90), Expect = 4.4,   Method: Composition-based stats.
 Identities = 51/211 (24%), Positives = 87/211 (41%), Gaps = 12/211 (5%)

Query: 411 KEKADREKAD-KEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEE 469
           K   D +KA  KEA+ K D  KAD   +E T    E +            +       E+
Sbjct: 64  KPALDAQKAVVKEAEAKIDTAKADVKAKEATVASTEKEVATATQAVKDAEATAYQATPEK 123

Query: 470 LEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQ 529
           + EVKD   K  E    +T +++ TE  N+ I   S    K     E   + TA+A   Q
Sbjct: 124 VAEVKDAQAKNVE---AQTANQKATETTNEQIKAESNALAK-----EQSDVATAQANADQ 175

Query: 530 AHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQ 589
           A K +Q  +      +      G+     A   LT+ + E++E  +++  A+  +++  +
Sbjct: 176 ATKDVQTAEQAVASTQSALDGTGLAS---AQKDLTQAQAEVKEATQSVADAKTAKENASK 232

Query: 590 SEDLQEKAWDSYKEWKSLSPDEIKQRFQKYA 620
            +  +E+A  S +   +   D +K    K A
Sbjct: 233 EDANREQAIKSAQTDVNTKNDAVKLAKDKLA 263


>gi|221485913|gb|EEE24183.1| conserved hypothetical protein [Toxoplasma gondii GT1]
          Length = 3900

 Score = 39.3 bits (90), Expect = 4.4,   Method: Composition-based stats.
 Identities = 33/132 (25%), Positives = 59/132 (44%), Gaps = 4/132 (3%)

Query: 382  ANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKT- 440
            A   ++ ++   LARA  +  +Q+   E + +  R++A+K  +++    +A   LQE+  
Sbjct: 3423 AESEAQRQELEALARAKTELSRQKTALELEAERLRQEAEKLRRDQETHAEARNKLQEEAR 3482

Query: 441  PIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQD 500
             I  E      GL  +     +L  KEE LEE + E     E       + + +ER+ + 
Sbjct: 3483 QIHEEAKQLDEGLARLRMAQQQLEGKEEALEETRIE---LAERAAALKREEQMSERRKES 3539

Query: 501  ILDNSLLAGKTH 512
            +L  S  A K  
Sbjct: 3540 VLHPSWAAPKAQ 3551


>gi|154344302|ref|XP_001568095.1| hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
 gi|134065429|emb|CAM40861.1| conserved hypothetical protein [Leishmania braziliensis
           MHOM/BR/75/M2904]
          Length = 1103

 Score = 39.3 bits (90), Expect = 4.4,   Method: Composition-based stats.
 Identities = 42/210 (20%), Positives = 82/210 (39%), Gaps = 24/210 (11%)

Query: 370 ETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADR 429
           E R    T+A +       + A + AR    EE++RR ++ K   D ++A + A   A+R
Sbjct: 486 EARKRKDTLAKMDEAQKRERDAAISARGRQHEEEKRRFEDMKRAEDEKEASRAAALIAER 545

Query: 430 E---KADKDLQE----------KTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDE 476
           +   +A K+ Q+          + P           +P  P   V    K+  ++E   +
Sbjct: 546 QSHSEAQKEAQKPARSASRQSSRRPNSRPASRLRGAIPEQPPDLVAGQMKDTLVDEALGK 605

Query: 477 G----KKGKEPGTTETDDREETERKNQDILDNSLLA-GKTHTKNETPAIPTAKAPPAQAH 531
                 +G++   ++      T RK + + +   ++     TK   P  P  +   A   
Sbjct: 606 PMHPYNEGRDSHASQAQHPAHTSRKAEPLAERRCVSVSPGDTKRAPPTPPRIRTEDAARS 665

Query: 532 KGIQDK------KPQDQREKPLASDIGVGE 555
           +  Q         P+  +++  A+D+ VGE
Sbjct: 666 QRSQSPPPNVALHPEQPQKQSTAADVVVGE 695


>gi|41406064|ref|NP_005955.1| myosin-10 [Homo sapiens]
 gi|114669119|ref|XP_001166541.1| PREDICTED: myosin-10 isoform 7 [Pan troglodytes]
 gi|215274129|sp|P35580|MYH10_HUMAN RecName: Full=Myosin-10; AltName: Full=Cellular myosin heavy chain,
            type B; AltName: Full=Myosin heavy chain 10; AltName:
            Full=Myosin heavy chain, non-muscle IIb; AltName:
            Full=Non-muscle myosin heavy chain B; Short=NMMHC-B;
            AltName: Full=Non-muscle myosin heavy chain IIb;
            Short=NMMHC II-b; Short=NMMHC-IIB
 gi|109734615|gb|AAI17692.1| Myosin, heavy chain 10, non-muscle [Homo sapiens]
 gi|119610455|gb|EAW90049.1| myosin, heavy polypeptide 10, non-muscle, isoform CRA_b [Homo
            sapiens]
          Length = 1976

 Score = 39.3 bits (90), Expect = 4.4,   Method: Composition-based stats.
 Identities = 70/300 (23%), Positives = 122/300 (40%), Gaps = 71/300 (23%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   E+L  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 976  AEAKIKKMEEEILLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 1030

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTII-------SGSEK 811
            K E  +SD+   L+K  KT  ++ + K +L G   D+  +   L   I       +  E+
Sbjct: 1031 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKLQLAKKEE 1090

Query: 812  ILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERS 865
             LQG      D T    ++L V  +  +  ++L E F                    E++
Sbjct: 1091 ELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFES------------------EKA 1132

Query: 866  LKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFERE 925
             +N+A             +Q  D + +L+ L+T+L        +  E     +R++ E+E
Sbjct: 1133 SRNKAE------------KQKRDLSEELEALKTELEDTLDTTAAQQE-----LRTKREQE 1175

Query: 926  IKELKSVIEADAKENPNPNKNQKKLQKTR-EKLVAQL--SSRLKELNIDNAYGLWNEYKE 982
            + ELK  +E + K +    ++ ++   T  E+L  QL  + R K     N  GL  + KE
Sbjct: 1176 VAELKKALEEETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKE 1235


>gi|301613270|ref|XP_002936130.1| PREDICTED: hypothetical protein LOC100127552 [Xenopus (Silurana)
           tropicalis]
          Length = 647

 Score = 39.3 bits (90), Expect = 4.5,   Method: Composition-based stats.
 Identities = 37/161 (22%), Positives = 66/161 (40%), Gaps = 17/161 (10%)

Query: 395 ARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLP 454
           +++ + +EK   + E     +  K  KEA E +D EK ++D    +  + +  +      
Sbjct: 433 SKSPSDDEKDDLDHEG----ESNKPSKEATETSDSEKDERDGHSDSEYEEDKQERKHSTG 488

Query: 455 SVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNS--LLAGKTH 512
           SV +HS       E+          G E G  +T   E  +++N+  L+NS  +    TH
Sbjct: 489 SVSSHSTIYTSSSED--------GSGDEEGEAKTSSSEHPKKRNKKTLENSENIQDSVTH 540

Query: 513 TKNETPAIPTAKAPPAQAHKG-IQDKK--PQDQREKPLASD 550
              +T +   A   P     G  +D +  P  + + PL  D
Sbjct: 541 LGEDTHSEEQANEEPKLEETGETEDIETCPSSKEDNPLPED 581


>gi|190346555|gb|EDK38666.2| hypothetical protein PGUG_02764 [Meyerozyma guilliermondii ATCC 6260]
          Length = 1070

 Score = 39.3 bits (90), Expect = 4.5,   Method: Composition-based stats.
 Identities = 45/199 (22%), Positives = 80/199 (40%), Gaps = 27/199 (13%)

Query: 865  SLKNQAHLNAEVERLSGLAQQPSDSTADLKELQT---------QLSRAKKYKES-----N 910
            S+      + EV +  G+ ++  D    LK L           QL++ KKY E       
Sbjct: 786  SIDENIDADPEVAKFIGINEETGDKNDILKNLYNYDTSIMKLLQLNK-KKYTEKYQTQGK 844

Query: 911  DERIVSFIRSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-- 968
             +++   I   +  + K L +  ++DA E+  P  N K+L      ++ + S  L  L  
Sbjct: 845  QKQLADSILKIYSNDPKHLSNTYKSDASESYKPRINPKRLPPNLLIIIFEYSPDLGNLRD 904

Query: 969  ----NIDNAYGLWNEYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGG 1024
                + ++   L  E   + + +F + L T  P  +G     D+   + S   + Q    
Sbjct: 905  VLSFHFEDLQRLNYEQDNEKQQAFIHDLRTQLPRWIGHPILYDKFPAVNSSKVSFQL--- 961

Query: 1025 DPSLMMDYEKVEPSDVMAG 1043
               L MDY K+EP  ++ G
Sbjct: 962  ---LEMDYSKLEPHQLIGG 977


>gi|146418138|ref|XP_001485035.1| hypothetical protein PGUG_02764 [Meyerozyma guilliermondii ATCC 6260]
          Length = 1070

 Score = 39.3 bits (90), Expect = 4.5,   Method: Composition-based stats.
 Identities = 45/199 (22%), Positives = 80/199 (40%), Gaps = 27/199 (13%)

Query: 865  SLKNQAHLNAEVERLSGLAQQPSDSTADLKELQT---------QLSRAKKYKES-----N 910
            S+      + EV +  G+ ++  D    LK L           QL++ KKY E       
Sbjct: 786  SIDENIDADPEVAKFIGINEETGDKNDILKNLYNYDTSIMKLLQLNK-KKYTEKYQTQGK 844

Query: 911  DERIVSFIRSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKEL-- 968
             +++   I   +  + K L +  ++DA E+  P  N K+L      ++ + S  L  L  
Sbjct: 845  QKQLADSILKIYSNDPKHLSNTYKSDASESYKPRINPKRLPPNLLIIIFEYSPDLGNLRD 904

Query: 969  ----NIDNAYGLWNEYKEDFKASFEYPLGTYEPAILGAMKDMDRLHPIYSVSKTIQKAGG 1024
                + ++   L  E   + + +F + L T  P  +G     D+   + S   + Q    
Sbjct: 905  VLSFHFEDLQRLNYEQDNEKQQAFIHDLRTQLPRWIGHPILYDKFPAVNSSKVSFQL--- 961

Query: 1025 DPSLMMDYEKVEPSDVMAG 1043
               L MDY K+EP  ++ G
Sbjct: 962  ---LEMDYSKLEPHQLIGG 977


>gi|260814095|ref|XP_002601751.1| hypothetical protein BRAFLDRAFT_121183 [Branchiostoma floridae]
 gi|229287053|gb|EEN57763.1| hypothetical protein BRAFLDRAFT_121183 [Branchiostoma floridae]
          Length = 1098

 Score = 39.3 bits (90), Expect = 4.5,   Method: Composition-based stats.
 Identities = 48/230 (20%), Positives = 87/230 (37%), Gaps = 20/230 (8%)

Query: 380 NVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEK 439
           NV +   +     +L+    +EE +R   EA++   R + +++  EK  RE+  +D    
Sbjct: 190 NVHSTKHQPSYGGLLSTIGKEEEDKRTAAEARKAQLRRELEEQIAEKKRREQQARDRSAV 249

Query: 440 TPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQ 499
              +   D    G P         P + +        GK   E G T    ++ + R   
Sbjct: 250 ERARPAEDYVPWGRPGAGA-----PLRSQ-------SGKVMAEYGDTRRSQQKASPRGGS 297

Query: 500 DILDNSLLAGKTHTKNETPAIPTAK-APPAQAHKGIQDKKPQDQREKPLA-SDIGVGESD 557
           D   +     +    N+T +   A+ A  +Q H+ +    P        A      G+  
Sbjct: 298 DTAVHQTAPRQQAQPNQTQSPGQAEPAATSQHHRAVSTVPPPHAMRSSFAIGGAAPGDDQ 357

Query: 558 YAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSE------DLQEKAWDSY 601
           YA     +K+K LQE E+    A + +Q   Q +      D+  + +D+Y
Sbjct: 358 YATTDQDEKKKWLQELEKQREEARLRKQREKQRDKEGGGMDVWTRHFDTY 407


>gi|92091586|ref|NP_001035203.1| myosin-11 isoform SM1B [Homo sapiens]
 gi|46486992|gb|AAS98910.1| smooth muscle myosin heavy chain isoform SM1 [Homo sapiens]
          Length = 1979

 Score = 39.3 bits (90), Expect = 4.5,   Method: Composition-based stats.
 Identities = 61/272 (22%), Positives = 118/272 (43%), Gaps = 31/272 (11%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE--ITHHTRRLVKEDPK-------RGKSESY 764
             E+ ++K   E+L    Q + ++    + E  I+  T  L +E+ K       + K ES 
Sbjct: 983  AEAKIKKLEDEILVMDDQNNKLSKERKLLEERISDLTTNLAEEEEKAKNLTKLKNKHESM 1042

Query: 765  LSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTIIS-------GSEKILQGD 816
            +S++   L+K  K+  ++ ++K +L G   D  ++   L   I+         E+ LQ  
Sbjct: 1043 ISELEVRLKKEEKSRQELEKLKRKLEGDASDFHEQIADLQAQIAELKMQLAKKEEELQA- 1101

Query: 817  YTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAEV 876
                 L+ LD +    ++  K      G  ++  ++E+      A  ++ K +  L  E+
Sbjct: 1102 ----ALARLDDEIAQKNNALKKIRELEGHISD--LQEDLDSERAARNKAEKQKRDLGEEL 1155

Query: 877  ERLSGLAQQPSDSTADLKELQ-------TQLSRAKKYKESNDERIVSFIRSEFEREIKEL 929
            E L    +   DSTA  +EL+       T L +A   +  + E  V  +R +  + ++EL
Sbjct: 1156 EALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEEL 1215

Query: 930  KSVIEADAKENPNPNKNQKKLQKTREKLVAQL 961
               +E   +   N +KN++ L+K    L  +L
Sbjct: 1216 TEQLEQFKRAKANLDKNKQTLEKENADLAGEL 1247


>gi|281422866|ref|ZP_06253865.1| putative transposase IS66 [Prevotella copri DSM 18205]
 gi|281403080|gb|EFB33760.1| putative transposase IS66 [Prevotella copri DSM 18205]
          Length = 641

 Score = 39.3 bits (90), Expect = 4.5,   Method: Composition-based stats.
 Identities = 45/189 (23%), Positives = 74/189 (39%), Gaps = 13/189 (6%)

Query: 340 DQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANA 399
           +Q K L   AS   A    A  +H +  +A  +   S  + +       K+     +  A
Sbjct: 13  NQYKNLYLQASNENAHLKHAVSKHEDELEANRKTIESMDSRILELEENQKE---WDKEKA 69

Query: 400 QEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTH 459
           Q + QR   + +   +RE   +  KE A  ++    LQE    K   +       +V  H
Sbjct: 70  QLQSQRDCYKKERDEERESHSQTKKELAKAKEEITKLQESKEAKELSEQ-----ANVDLH 124

Query: 460 SVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILD--NSLLAGKTHTKNET 517
           SV L  +    +   D     K  G  E D+R   + +  D++D  N L +G     ++T
Sbjct: 125 SVVLVLQRRLFKTNSDASSYMK--GEVEFDERRMNDMEFTDVVDEANKLASGIIEEVDQT 182

Query: 518 PAIPTAKAP 526
           P + T K P
Sbjct: 183 P-VDTGKEP 190


>gi|194018594|ref|NP_001123384.1| kinectin 1 (kinesin receptor) [Xenopus (Silurana) tropicalis]
 gi|189441583|gb|AAI67328.1| ktn1 protein [Xenopus (Silurana) tropicalis]
          Length = 1375

 Score = 39.3 bits (90), Expect = 4.5,   Method: Composition-based stats.
 Identities = 61/287 (21%), Positives = 126/287 (43%), Gaps = 41/287 (14%)

Query: 342  IKQLRDL--ASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANA 399
            IK ++DL  A + KA+ H A +   N+   E +     + N     S+L++A  +++   
Sbjct: 852  IKSVQDLLQAEQRKANSHEANVTALNQ---EIKSLKEALGN-----SQLEKAEQISKGAQ 903

Query: 400  QEEKQR--REQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVP 457
             +E Q   R +E   K    +  +  K+ ADRE+  +DL ++  +             + 
Sbjct: 904  VQELQNELRSKEESLKNIEMRFKEREKDIADRERQIQDLDKECKV-------------LK 950

Query: 458  THSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNET 517
             H+      EE  ++++       +    ++   E+ E+     ++  LL  +    +++
Sbjct: 951  AHT------EEVRKQLQQRESASSQAANLQSRLAEQQEKVRN--IEAILLEKEKSVNDKS 1002

Query: 518  PAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEK---ELQEQE 574
              + T +A        +Q  + Q + E+ +        S+     L +K++   ELQ + 
Sbjct: 1003 QELQTLRAENNVLR--VQACELQQKHEQQMEQASSATHSEEVLKTLAEKDRHIRELQSEL 1060

Query: 575  ENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAK 621
            E+LR A  ++Q R ++ DL+EK W + +   S +   +++R  K AK
Sbjct: 1061 ESLRSA--VEQQRKKNNDLREKNWKAMEALAS-TEKMLQERMNKTAK 1104


>gi|119571561|gb|EAW51176.1| hCG27198, isoform CRA_b [Homo sapiens]
          Length = 1300

 Score = 39.3 bits (90), Expect = 4.6,   Method: Composition-based stats.
 Identities = 115/645 (17%), Positives = 261/645 (40%), Gaps = 84/645 (13%)

Query: 369  AETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKAD 428
             E RL Y       +FT +  Q          E+K   EQ+ K + +R   D +A +  +
Sbjct: 615  GEWRLKYERAVREVDFTKKRLQQEF-------EDKLEVEQQNKRQLERRLGDLQA-DSEE 666

Query: 429  REKADKDLQEKTP-IKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTE 487
             ++A + L++K   + AE  D  L L      + +L  K+   +    E  +  E    E
Sbjct: 667  SQRALQQLKKKCQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDS---ELSQAHEEAQRE 723

Query: 488  TDDREETERKNQDILDNSL-LAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKP 546
               RE+ +R+   +L  +  L  +   K+   A  T K    +A   +QD   Q+ +++ 
Sbjct: 724  KLQREKLQREKDMLLAEAFSLKQQLEEKDMDIAGFTQKVVSLEAE--LQDISSQESKDEA 781

Query: 547  LASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKS 606
              + +     D    K+  +E+EL EQ   +   ++++Q++++ E   E+   ++ +   
Sbjct: 782  SLAKVKKQLRDLEA-KVKDQEEELDEQAGTI---QMLEQAKLRLEMEMERMRQTHSKEME 837

Query: 607  LSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSP 666
               +E+++  Q   K   +    ++  Y+  Q+  +             ++     Q + 
Sbjct: 838  SRDEEVEEARQSCQKKLKQMEVQLEEEYEDKQKVLREKRELEG------KLATLSDQVNR 891

Query: 667  LGLMYEK---DELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGE----SSVR 719
                 EK    +L   +A+     ++  H ++N   +K  +  +   +E  E    ++V+
Sbjct: 892  RDFESEKRLRKDLKRTKALLADAQLMLDH-LKNSAPSKREIAQLKNQLEESEFTCAAAVK 950

Query: 720  ----------------------KHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKED-- 755
                                  K + E   S+ Q+    + N ++E       L+K+   
Sbjct: 951  ARKAMEVEIEDLHLQIDDIAKAKTALEEQLSRLQREKNEIQNRLEEDQEDMNELMKKHKA 1010

Query: 756  --PKRGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLYTIISGSEKIL 813
               +  +  + ++D++++L++ NK   +++ KL+      +  ++     +++S  E  +
Sbjct: 1011 AVAQASRDLAQINDLQAQLEEANKEKQELQEKLQALQSQVEFLEQSMVDKSLVSRQEAKI 1070

Query: 814  QGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIK--EERYWTIYAFERSLKNQAH 871
            +          L+ + +F+ +  K  E        N  K  EER   I A  R  +    
Sbjct: 1071 R---------ELETRLEFERTQVKRLESLASRLKENMEKLTEERDQRIAAENREKEQNKR 1121

Query: 872  LNAEV----ERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIK 927
            L  ++    E +  LA++ ++++    EL+  L       E+ ++ + + ++  F+R I 
Sbjct: 1122 LQRQLRDTKEEMGELARKEAEASRKKHELEMDLESL----EAANQSLQADLKLAFKR-IG 1176

Query: 928  ELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKELNIDN 972
            +L++ IE + + + N +     L  + + +V +   R  +L  D+
Sbjct: 1177 DLQAAIEDEMESDENED-----LINSLQDMVTKYQKRKNKLEGDS 1216


>gi|297700006|ref|XP_002827057.1| PREDICTED: myosin-10 isoform 2 [Pongo abelii]
          Length = 1985

 Score = 39.3 bits (90), Expect = 4.6,   Method: Composition-based stats.
 Identities = 70/300 (23%), Positives = 122/300 (40%), Gaps = 71/300 (23%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   E+L  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 985  AEAKIKKMEEEILLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 1039

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTII-------SGSEK 811
            K E  +SD+   L+K  KT  ++ + K +L G   D+  +   L   I       +  E+
Sbjct: 1040 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKLQLAKKEE 1099

Query: 812  ILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERS 865
             LQG      D T    ++L V  +  +  ++L E F                    E++
Sbjct: 1100 ELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFES------------------EKA 1141

Query: 866  LKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFERE 925
             +N+A             +Q  D + +L+ L+T+L        +  E     +R++ E+E
Sbjct: 1142 SRNKAE------------KQKRDLSEELEALKTELEDTLDTTAAQQE-----LRTKREQE 1184

Query: 926  IKELKSVIEADAKENPNPNKNQKKLQKTR-EKLVAQL--SSRLKELNIDNAYGLWNEYKE 982
            + ELK  +E + K +    ++ ++   T  E+L  QL  + R K     N  GL  + KE
Sbjct: 1185 VAELKKALEEETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKE 1244


>gi|114669117|ref|XP_001166502.1| PREDICTED: myosin, heavy polypeptide 10, non-muscle isoform 6 [Pan
            troglodytes]
          Length = 1986

 Score = 39.3 bits (90), Expect = 4.6,   Method: Composition-based stats.
 Identities = 70/300 (23%), Positives = 122/300 (40%), Gaps = 71/300 (23%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   E+L  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 986  AEAKIKKMEEEILLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 1040

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTII-------SGSEK 811
            K E  +SD+   L+K  KT  ++ + K +L G   D+  +   L   I       +  E+
Sbjct: 1041 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKLQLAKKEE 1100

Query: 812  ILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERS 865
             LQG      D T    ++L V  +  +  ++L E F                    E++
Sbjct: 1101 ELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFES------------------EKA 1142

Query: 866  LKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFERE 925
             +N+A             +Q  D + +L+ L+T+L        +  E     +R++ E+E
Sbjct: 1143 SRNKAE------------KQKRDLSEELEALKTELEDTLDTTAAQQE-----LRTKREQE 1185

Query: 926  IKELKSVIEADAKENPNPNKNQKKLQKTR-EKLVAQL--SSRLKELNIDNAYGLWNEYKE 982
            + ELK  +E + K +    ++ ++   T  E+L  QL  + R K     N  GL  + KE
Sbjct: 1186 VAELKKALEEETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKE 1245


>gi|212656558|ref|NP_497536.2| Initiation Factor Five B (eIF5B) family member (iffb-1)
           [Caenorhabditis elegans]
 gi|187357215|gb|AAK68893.2|AC026301_6 Initiation factor five b (eif5b) protein 1, partially confirmed by
           transcript evidence [Caenorhabditis elegans]
 gi|113952709|gb|ABI49097.1| eukaryotic translation initiation factor eIF5B [Caenorhabditis
           elegans]
          Length = 1074

 Score = 39.3 bits (90), Expect = 4.6,   Method: Composition-based stats.
 Identities = 38/111 (34%), Positives = 51/111 (45%), Gaps = 16/111 (14%)

Query: 398 NAQEEKQRREQEAKEKADREKADKEAKE-KADREKADKDLQEKTPIKAEGDDFGLGLPSV 456
           +AQEEK+R E+E  EK +R++A KEAK  + +R+KA    Q  T  +       L     
Sbjct: 244 DAQEEKERLEREHAEK-ERKEAAKEAKRLEVERQKAAGTYQ--TAAQKRQQALALEKLRA 300

Query: 457 PTHSVKLP--PKEEELEEVK------DEGKKGKEPGTTETDDREETERKNQ 499
             HSV  P    E+E   VK      DE  K K+    E   R   E+  Q
Sbjct: 301 AGHSVPAPRDSTEDEAAGVKKSFVYVDEKTKAKQ----EEKKRRRLEKLGQ 347


>gi|109734611|gb|AAI17691.1| Myosin, heavy chain 10, non-muscle [Homo sapiens]
          Length = 1976

 Score = 39.3 bits (90), Expect = 4.6,   Method: Composition-based stats.
 Identities = 70/300 (23%), Positives = 122/300 (40%), Gaps = 71/300 (23%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   E+L  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 976  AEAKIKKMEEEILLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 1030

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTII-------SGSEK 811
            K E  +SD+   L+K  KT  ++ + K +L G   D+  +   L   I       +  E+
Sbjct: 1031 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKLQLAKKEE 1090

Query: 812  ILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERS 865
             LQG      D T    ++L V  +  +  ++L E F                    E++
Sbjct: 1091 ELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFES------------------EKA 1132

Query: 866  LKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFERE 925
             +N+A             +Q  D + +L+ L+T+L        +  E     +R++ E+E
Sbjct: 1133 SRNKAE------------KQKRDLSEELEALKTELEDTLDTTAAQQE-----LRTKREQE 1175

Query: 926  IKELKSVIEADAKENPNPNKNQKKLQKTR-EKLVAQL--SSRLKELNIDNAYGLWNEYKE 982
            + ELK  +E + K +    ++ ++   T  E+L  QL  + R K     N  GL  + KE
Sbjct: 1176 VAELKKALEEETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKE 1235


>gi|92091583|ref|NP_001035202.1| myosin-11 isoform SM2B [Homo sapiens]
 gi|46486994|gb|AAS98911.1| smooth muscle myosin heavy chain isoform SM2 [Homo sapiens]
 gi|219521495|gb|AAI43365.1| Myosin, heavy chain 11, smooth muscle [Homo sapiens]
 gi|270048018|gb|ACZ58374.1| myosin, heavy chain 11, smooth muscle isoform 2 [Homo sapiens]
          Length = 1945

 Score = 39.3 bits (90), Expect = 4.6,   Method: Composition-based stats.
 Identities = 61/272 (22%), Positives = 118/272 (43%), Gaps = 31/272 (11%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE--ITHHTRRLVKEDPK-------RGKSESY 764
             E+ ++K   E+L    Q + ++    + E  I+  T  L +E+ K       + K ES 
Sbjct: 983  AEAKIKKLEDEILVMDDQNNKLSKERKLLEERISDLTTNLAEEEEKAKNLTKLKNKHESM 1042

Query: 765  LSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTIIS-------GSEKILQGD 816
            +S++   L+K  K+  ++ ++K +L G   D  ++   L   I+         E+ LQ  
Sbjct: 1043 ISELEVRLKKEEKSRQELEKLKRKLEGDASDFHEQIADLQAQIAELKMQLAKKEEELQA- 1101

Query: 817  YTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAEV 876
                 L+ LD +    ++  K      G  ++  ++E+      A  ++ K +  L  E+
Sbjct: 1102 ----ALARLDDEIAQKNNALKKIRELEGHISD--LQEDLDSERAARNKAEKQKRDLGEEL 1155

Query: 877  ERLSGLAQQPSDSTADLKELQ-------TQLSRAKKYKESNDERIVSFIRSEFEREIKEL 929
            E L    +   DSTA  +EL+       T L +A   +  + E  V  +R +  + ++EL
Sbjct: 1156 EALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEEL 1215

Query: 930  KSVIEADAKENPNPNKNQKKLQKTREKLVAQL 961
               +E   +   N +KN++ L+K    L  +L
Sbjct: 1216 TEQLEQFKRAKANLDKNKQTLEKENADLAGEL 1247


>gi|293364819|ref|ZP_06611536.1| hypothetical protein HMPREF8579_0665 [Streptococcus oralis ATCC
           35037]
 gi|291316269|gb|EFE56705.1| hypothetical protein HMPREF8579_0665 [Streptococcus oralis ATCC
           35037]
          Length = 840

 Score = 39.3 bits (90), Expect = 4.7,   Method: Composition-based stats.
 Identities = 51/211 (24%), Positives = 87/211 (41%), Gaps = 12/211 (5%)

Query: 411 KEKADREKAD-KEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEE 469
           K   D +KA  KEA+ K D  KAD   +E T    E +            +       E+
Sbjct: 65  KPALDAQKAVVKEAEAKIDTAKADVKAKEATVASTEKEVATATQAVKDAEATAYQATPEK 124

Query: 470 LEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQ 529
           + EVKD   K  E    +T +++ TE  N+ I   S    K     E   + TA+A   Q
Sbjct: 125 VAEVKDAQAKNVE---AQTANQKATETTNEQIKAESNALAK-----EQSDVATAQANADQ 176

Query: 530 AHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQ 589
           A K +Q  +      +      G+     A   LT+ + E++E  +++  A+  +++  +
Sbjct: 177 ATKDVQTAEQAVASTQSALDGTGLAS---AQKDLTQAQAEVKEATQSVADAKTAKENASK 233

Query: 590 SEDLQEKAWDSYKEWKSLSPDEIKQRFQKYA 620
            +  +E+A  S +   +   D +K    K A
Sbjct: 234 EDANREQAIKSAQTDVNTKNDAVKLAKDKLA 264


>gi|237837729|ref|XP_002368162.1| myosin-A docking protein, putative [Toxoplasma gondii ME49]
 gi|211965826|gb|EEB01022.1| myosin-A docking protein, putative [Toxoplasma gondii ME49]
          Length = 353

 Score = 39.3 bits (90), Expect = 4.7,   Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 38/62 (61%), Gaps = 8/62 (12%)

Query: 395 ARANAQE--EKQRREQEAKEKADREKADKEAKEKADREKADKDLQEK------TPIKAEG 446
            R  AQE  E+QRREQEA  + +R+K ++ A+++   EK D  L+E+      +P +AE 
Sbjct: 14  GRKKAQELAERQRREQEAIAEDERKKMEEAAEQRRQLEKEDSRLREEEEASLASPQRAEA 73

Query: 447 DD 448
           ++
Sbjct: 74  EE 75


>gi|195355068|ref|XP_002044015.1| GM21550 [Drosophila sechellia]
 gi|194129268|gb|EDW51311.1| GM21550 [Drosophila sechellia]
          Length = 1302

 Score = 39.3 bits (90), Expect = 4.7,   Method: Composition-based stats.
 Identities = 47/238 (19%), Positives = 92/238 (38%), Gaps = 37/238 (15%)

Query: 426 KADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGT 485
           + DR+  ++DL  + P++A+ D            S  LPP    +   +   + GK+   
Sbjct: 20  QVDRDLRNEDLIPEHPVEADEDS------DKENQSPNLPPTPRPIGNCEQGTEVGKDEAD 73

Query: 486 TETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREK 545
             +D  EE E+   +  DN     +   +N    +  + +   Q H+      P+++  +
Sbjct: 74  QFSD--EEVEKNETNSSDNE---SERDARNYRDRLSASNSEEEQLHQEYS-TSPRERTTE 127

Query: 546 PLASDIGVGESDYA----GIKLTKKEKELQEQEENLRVAEI-------------IQQSRM 588
              SD+  G  +Y       +   +E +L  +E  L + E               Q S  
Sbjct: 128 YAESDLNHGNREYQDSNHAYQDLNREYQLLIREYQLLIREYQYLNGECHDLHYEFQVSNQ 187

Query: 589 QSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINH 646
           + +DL  ++++S +EW +         F      F R Y  ++  Y+      +A+NH
Sbjct: 188 ECQDLNPESYESNQEWLT--------DFNLEYDYFSRKYQALNCEYQDIDREYQALNH 237


>gi|332016887|gb|EGI57696.1| Transcription elongation regulator 1 [Acromyrmex echinatior]
          Length = 1208

 Score = 39.3 bits (90), Expect = 4.7,   Method: Composition-based stats.
 Identities = 36/157 (22%), Positives = 70/157 (44%), Gaps = 20/157 (12%)

Query: 357 HWAEIRHGNRFKAETRLAYSTIANVA-------NFTSELKQATVLARANAQEEKQRREQE 409
           HW++ +     K ET   Y  + + +       ++   LK      +   ++ + R +  
Sbjct: 819 HWSDCKK----KLETDWRYRVVESASTREDWFRDYVRLLKDERKKEKEKDKDHRHREKDH 874

Query: 410 AKEKADREK--ADKEAKEKADREKADKD-LQEKTPIKAEGDDFGLGLPSVPTHSVKLPPK 466
             +K DR++  +DK  + K+ ++KADKD  +EK   K   +D  L         + +  +
Sbjct: 875 KTDKKDRDRKDSDKGKETKSSKDKADKDNTREK---KQRKNDVPLEENEKEKKEMVIEKE 931

Query: 467 EEELEEVKDEGKK---GKEPGTTETDDREETERKNQD 500
             E+EE  D+  K    KE G   +D  E+ E++ ++
Sbjct: 932 SGEIEESDDKNIKKENDKEEGDDHSDSEEDREKQKRE 968


>gi|187956363|gb|AAI50635.1| MYH10 protein [Homo sapiens]
 gi|219841954|gb|AAI44669.1| MYH10 protein [Homo sapiens]
          Length = 1985

 Score = 39.3 bits (90), Expect = 4.7,   Method: Composition-based stats.
 Identities = 70/300 (23%), Positives = 122/300 (40%), Gaps = 71/300 (23%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   E+L  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 985  AEAKIKKMEEEILLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 1039

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTII-------SGSEK 811
            K E  +SD+   L+K  KT  ++ + K +L G   D+  +   L   I       +  E+
Sbjct: 1040 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKLQLAKKEE 1099

Query: 812  ILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERS 865
             LQG      D T    ++L V  +  +  ++L E F                    E++
Sbjct: 1100 ELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFES------------------EKA 1141

Query: 866  LKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFERE 925
             +N+A             +Q  D + +L+ L+T+L        +  E     +R++ E+E
Sbjct: 1142 SRNKAE------------KQKRDLSEELEALKTELEDTLDTTAAQQE-----LRTKREQE 1184

Query: 926  IKELKSVIEADAKENPNPNKNQKKLQKTR-EKLVAQL--SSRLKELNIDNAYGLWNEYKE 982
            + ELK  +E + K +    ++ ++   T  E+L  QL  + R K     N  GL  + KE
Sbjct: 1185 VAELKKALEEETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKE 1244


>gi|298503944|gb|ADI86224.1| gliding associated protein 70 [Toxoplasma gondii]
          Length = 313

 Score = 39.3 bits (90), Expect = 4.8,   Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 38/62 (61%), Gaps = 8/62 (12%)

Query: 395 ARANAQE--EKQRREQEAKEKADREKADKEAKEKADREKADKDLQEK------TPIKAEG 446
            R  AQE  E+QRREQEA  + +R+K ++ A+++   EK D  L+E+      +P +AE 
Sbjct: 14  GRKKAQELAERQRREQEAIAEDERKKMEEAAEQRRQLEKEDSRLREEEEASLASPQRAEA 73

Query: 447 DD 448
           ++
Sbjct: 74  EE 75


>gi|296876170|ref|ZP_06900224.1| septation ring formation regulator EzrA [Streptococcus
           parasanguinis ATCC 15912]
 gi|296432881|gb|EFH18674.1| septation ring formation regulator EzrA [Streptococcus
           parasanguinis ATCC 15912]
          Length = 574

 Score = 39.3 bits (90), Expect = 4.8,   Method: Composition-based stats.
 Identities = 49/217 (22%), Positives = 87/217 (40%), Gaps = 42/217 (19%)

Query: 807 SGSEKILQGDYTFPPLSSLDVQSKFDSSYSKL---------FEIFYGDWTNNAIKEERYW 857
           SG  K+L+  Y F   +  D++S+F   ++ L          E+    + N  I+EE   
Sbjct: 240 SGYRKLLESGYHF---TETDIESRFQQLHASLKNNMSNVSALELDNAIYENEQIQEEIDA 296

Query: 858 TIYAFERSLKNQ---------------------AHLNAEVERLSGLAQQPSDSTADLKEL 896
             + F R +++Q                     ++L AEVERL          +  LKEL
Sbjct: 297 LYHIFTREIESQKVVKKLVKQLPGYLKHAKDNNSNLAAEVERLGKTFVLNESFSQQLKEL 356

Query: 897 QTQLSRAKKYKE------SNDERIVSFIRSEFEREIKELKSVIEADAKENPNPNKNQKKL 950
           + +LS  +   E      S  ++  S ++ E E     LK + +     N + +K +K  
Sbjct: 357 EAELSSQEDVVEDALKDSSETQKAYSILKEELEAIEARLKEIEDEQINLNDSLSKIEKDD 416

Query: 951 QKTREK---LVAQLSSRLKELNIDNAYGLWNEYKEDF 984
              R+K      +L +  + ++  N  G+  E+ E F
Sbjct: 417 ANARQKANIYANRLHAIKRYMDKRNLPGIPQEFLELF 453


>gi|223993027|ref|XP_002286197.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220977512|gb|EED95838.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 1069

 Score = 39.3 bits (90), Expect = 4.8,   Method: Composition-based stats.
 Identities = 49/237 (20%), Positives = 108/237 (45%), Gaps = 30/237 (12%)

Query: 750 RLVKEDPKRGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQD-IPQEQPPLYTIISG 808
           RL  E  +R +S+S +  +R +L++  +       +L  YG  +D + + Q  L  ++S 
Sbjct: 622 RLQSEMNRRAESDSEVRKLRVKLKQYEE-------RLATYGTMEDDLEKAQANLVMVVSE 674

Query: 809 SEKI---------LQGDYTFPPL---SSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERY 856
             ++         ++ D     +   + L+   K +++ S        D  N  +KE+  
Sbjct: 675 KSRLEMEIEKLREVKDDAERKEVLLSNRLNEAKKKEANKSTTAGRLEAD--NEKLKEDLE 732

Query: 857 WTIYAFERSLKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVS 916
            TI   +   K +A L A +E+L   A +       +K+ +T L+  ++  E   +++  
Sbjct: 733 RTIGELDAMTKARAKLEATMEKLKAKAVE------RVKQAETALAEERELNEERKKKMKV 786

Query: 917 FIRSEFE--REIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKELNID 971
           F+ ++ E  RE KE    ++++ +E     ++ ++ ++T +K + Q   + +EL  D
Sbjct: 787 FVETKAEELREAKESAGDMQSELQETRASLRSSREREETFQKELDQSRIKYRELQRD 843


>gi|330842423|ref|XP_003293178.1| hypothetical protein DICPUDRAFT_157979 [Dictyostelium purpureum]
 gi|325076520|gb|EGC30299.1| hypothetical protein DICPUDRAFT_157979 [Dictyostelium purpureum]
          Length = 381

 Score = 39.3 bits (90), Expect = 4.9,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 48/96 (50%), Gaps = 8/96 (8%)

Query: 402 EKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSV 461
           EK+ +E+E  EK  RE+ +KE  E+ ++E+ +K+ QEK  ++         L        
Sbjct: 101 EKENQEKERIEKLKREQQEKEHMEQLEKERQEKEQQEKEHMEQ--------LEKERQEKE 152

Query: 462 KLPPKEEELEEVKDEGKKGKEPGTTETDDREETERK 497
           ++   E+E +E +      +E    E  +RE+ ER+
Sbjct: 153 RIEALEKERQENERRQALERERLIKEQQEREQKERE 188


>gi|123448346|ref|XP_001312904.1| viral A-type inclusion protein [Trichomonas vaginalis G3]
 gi|121894768|gb|EAX99974.1| viral A-type inclusion protein, putative [Trichomonas vaginalis G3]
          Length = 3748

 Score = 39.3 bits (90), Expect = 4.9,   Method: Composition-based stats.
 Identities = 131/634 (20%), Positives = 250/634 (39%), Gaps = 103/634 (16%)

Query: 387  ELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADRE-----------KADKD 435
            EL  + ++ +   Q+EK  +++ ++EK  R+K   + K K   E           + D+ 
Sbjct: 612  ELNSSIIMLKDEIQKEKANKDKISEEKNKRDKELNDEKSKLQDELDSLQLDEIENENDQL 671

Query: 436  LQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEE-VKDEGKKGKEPGTTETDDREET 494
             +E   +K++ DD  +    +      L  +  ++E+  KD  K+ KE    ++D+ E+ 
Sbjct: 672  FEEVEDLKSKVDDAKILYNDMVDKIDDLKQQRSKVEQKYKDLEKQNKE----KSDEIEKV 727

Query: 495  ERKNQDILDNSLLAGKTHTKNETPAI-PTAKAPPAQAHKGIQDKKPQDQREKPLASDIGV 553
             ++  ++ +   L      K+ TP +     A   Q  K  Q+ +   +    L  ++  
Sbjct: 728  SKEISELKEK--LDNLNQFKDNTPELHQKVDAMNEQIVKKSQENEKIQEEMNKLNEELQH 785

Query: 554  GESDYAGIKLTKKEKE-LQEQEENLRVAEIIQQSRMQSEDLQ-------EKAWDSYKEWK 605
             E++   I++   E+E +QE+ +N++  + I++ +  +E++Q       E   D+ KE  
Sbjct: 786  LENEMEEIEVVNDERETIQEKIDNIK--QQIEEKKKSNEEIQDIMNLLIEAENDAQKELD 843

Query: 606  SL-----SPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNF 660
             +       +EI+QR Q               + +   +  K +N+ L          N 
Sbjct: 844  DIEIVEAQSEEIRQRIQ---------------TLQDNLQDRKKLNNELTE-------QNN 881

Query: 661  LSQWSPLGLMYEKDELHGV----EAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGES 716
              Q     L  E D+   V    E++ +KLD +     E    N+N  +   K +E  E 
Sbjct: 882  KLQKELKDLQNELDQTELVNDDSESLNKKLDEIKEQINERKSQNENNTEQNEKLIEEIEK 941

Query: 717  SVRK-HSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKEDPKRGKSESYL---------- 765
              ++    E++  K  K    ++   K+I    +   + D      E  L          
Sbjct: 942  FAKELDEIEIIEDKSDKLQAQISELQKQIDEKQKNNEQTDKSNNDLEHELQITKQKLDSM 1001

Query: 766  ------SD-IRSELQKVNKTVMDIR-IKLRLYGIFQDIPQEQPPLYTIISGSEKILQGDY 817
                  SD ++SE++ VNK +  IR    +L    QD  +E   +  I   SE++     
Sbjct: 1002 SSVKNNSDYLKSEIENVNKEIEKIRDTNNKLKQELQDKNKELEEMTDIADNSEEL----- 1056

Query: 818  TFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAEVE 877
                      + K DS   ++ +    + T + +    +  +   E  L++  H++   +
Sbjct: 1057 ----------KEKIDSVNEEITKRVANNTTIDELIRHLHEDLKNAEAKLQSIPHVDDNTD 1106

Query: 878  RLSG----LAQQPSDSTADLKELQTQLSR-----AKKYKESNDERIVSFIRSEFEREIKE 928
             L      +  Q S    +  EL  ++SR      +K  E N+   +   R E   EI+ 
Sbjct: 1107 SLQKSLDEVLAQISQKQRENDELNDEISRLIQEKEEKTDELNNMETIPDKREEISSEIET 1166

Query: 929  LKSVIEADAKENPNPNKNQKKLQKTREKLVAQLS 962
            +KS IE   K N    +  KKL +  E L   LS
Sbjct: 1167 VKSQIEEKKKNNEKIAEENKKLAEELENLRQTLS 1200


>gi|13124875|ref|NP_074035.1| myosin-11 isoform SM2A [Homo sapiens]
 gi|75517817|gb|AAI01678.1| Myosin, heavy chain 11, smooth muscle [Homo sapiens]
 gi|85397409|gb|AAI04907.1| Myosin, heavy chain 11, smooth muscle [Homo sapiens]
 gi|119574311|gb|EAW53926.1| myosin, heavy polypeptide 11, smooth muscle, isoform CRA_b [Homo
            sapiens]
 gi|119574315|gb|EAW53930.1| myosin, heavy polypeptide 11, smooth muscle, isoform CRA_b [Homo
            sapiens]
          Length = 1938

 Score = 39.3 bits (90), Expect = 4.9,   Method: Composition-based stats.
 Identities = 61/272 (22%), Positives = 118/272 (43%), Gaps = 31/272 (11%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE--ITHHTRRLVKEDPK-------RGKSESY 764
             E+ ++K   E+L    Q + ++    + E  I+  T  L +E+ K       + K ES 
Sbjct: 976  AEAKIKKLEDEILVMDDQNNKLSKERKLLEERISDLTTNLAEEEEKAKNLTKLKNKHESM 1035

Query: 765  LSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTIIS-------GSEKILQGD 816
            +S++   L+K  K+  ++ ++K +L G   D  ++   L   I+         E+ LQ  
Sbjct: 1036 ISELEVRLKKEEKSRQELEKLKRKLEGDASDFHEQIADLQAQIAELKMQLAKKEEELQA- 1094

Query: 817  YTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAEV 876
                 L+ LD +    ++  K      G  ++  ++E+      A  ++ K +  L  E+
Sbjct: 1095 ----ALARLDDEIAQKNNALKKIRELEGHISD--LQEDLDSERAARNKAEKQKRDLGEEL 1148

Query: 877  ERLSGLAQQPSDSTADLKELQ-------TQLSRAKKYKESNDERIVSFIRSEFEREIKEL 929
            E L    +   DSTA  +EL+       T L +A   +  + E  V  +R +  + ++EL
Sbjct: 1149 EALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEEL 1208

Query: 930  KSVIEADAKENPNPNKNQKKLQKTREKLVAQL 961
               +E   +   N +KN++ L+K    L  +L
Sbjct: 1209 TEQLEQFKRAKANLDKNKQTLEKENADLAGEL 1240


>gi|21231078|ref|NP_636995.1| unknown acidic aa rich protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66768913|ref|YP_243675.1| unknown acidic aa rich protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|21112708|gb|AAM40919.1| unknown acidic aa rich protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66574245|gb|AAY49655.1| unknown acidic aa rich protein [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 1338

 Score = 39.3 bits (90), Expect = 4.9,   Method: Composition-based stats.
 Identities = 56/257 (21%), Positives = 106/257 (41%), Gaps = 40/257 (15%)

Query: 390 QATVLARANAQEEKQRR-EQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDD 448
           QA+V A+A  + E+Q R  QE      RE   +   E+ D+ ++++ +Q    +  EG  
Sbjct: 729 QASVAAQARQEREQQDRLAQEQHAAQVREHLHQAQPEREDQSQSEQAVQAHAML--EGQR 786

Query: 449 FGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLA 508
                     H      +++E +   ++ ++ +E    E   R+  ER+++D   N    
Sbjct: 787 QAEQQREQEDH------QQQERQAHTNQQRELQEREGREVQQRQAQERQSED---NQQRE 837

Query: 509 GKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEK 568
            +     ET  +   +A   Q H   Q  +  + R+     D      D A ++ T +  
Sbjct: 838 QQDRQAQETRQVEVQEAQAQQTHDQQQQTQGLEPRQASPQLDTQPHAPDAALVQQTPRP- 896

Query: 569 ELQEQEENLRVAEIIQQSRMQSEDLQEK-AWDSYKEWKSLSPDEIKQRFQKYAKVFYRSY 627
             + Q+E+ R     QQ +M+++   E  A D        +PD +KQ           ++
Sbjct: 897 --ESQQEDAR-----QQPQMRNQQAHEHLAPD--------APDPLKQ-----------TH 930

Query: 628 SPVDGSYKGTQESDKAI 644
           SP D      QE+++A+
Sbjct: 931 SPGDARPHQAQEAERAL 947


>gi|194222994|ref|XP_001916548.1| PREDICTED: desmoplakin [Equus caballus]
          Length = 2810

 Score = 39.3 bits (90), Expect = 4.9,   Method: Composition-based stats.
 Identities = 69/312 (22%), Positives = 128/312 (41%), Gaps = 47/312 (15%)

Query: 695  ENLRANKNAVDAMSKAVEAGESSVRKHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKE 754
            EN++      +   KA+E    S+ +   E+   +     +   + + E      RL  +
Sbjct: 1687 ENVKQAHLRNEHFQKAIEDKSRSLNESKIEIERLQSLTESLTKEHLMLEEELRNLRLEYD 1746

Query: 755  DPKRGKSE------SYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLYTIISG 808
            D +RG+SE      + +S++RS+LQ  N         L L G+  D+ +E+  L   I  
Sbjct: 1747 DLRRGRSEADNDKMATISELRSQLQISNNRT------LELQGLINDLQRERENLRQEIEK 1800

Query: 809  SEKILQGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWT---NNAIKEERYWTIYAFERS 865
             +K            +L+  ++   S ++  ++     T      + E+    +   E  
Sbjct: 1801 FQK-----------QALEASNRIQESKNQCTQVVQERETLLMKIKVLEQDKTRLQRLEDE 1849

Query: 866  LKNQAHLNAEVE-----RLSGLAQQPSDSTADLKELQTQLSRAKK------YKESNDERI 914
            L N+A    E E     RL    QQ  +   DL + +TQ SR ++       +    ER 
Sbjct: 1850 L-NRAKTTLEAESRVKQRLESEKQQIQN---DLNQWKTQYSRKEEAIRKIESEREKSERE 1905

Query: 915  VSFIRSEFEREIKELKSVIEA-DAKENPNPNKNQKKLQKTREKLVAQLSSRLKELNIDNA 973
             + +RSE ER   E+K + E    K   +  + Q +L+  R +L  ++  +LK+      
Sbjct: 1906 KNSLRSEIERLQAEIKRIEERYRRKLEDSTRETQSQLETERSRLQREI-DKLKQ----RP 1960

Query: 974  YGLWNEYKEDFK 985
            YG   E + +++
Sbjct: 1961 YGSHRETQTEYE 1972


>gi|119571566|gb|EAW51181.1| hCG27198, isoform CRA_f [Homo sapiens]
          Length = 1285

 Score = 39.3 bits (90), Expect = 4.9,   Method: Composition-based stats.
 Identities = 110/617 (17%), Positives = 250/617 (40%), Gaps = 79/617 (12%)

Query: 369  AETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKAD 428
             E RL Y       +FT +  Q          E+K   EQ+ K + +R   D +A +  +
Sbjct: 615  GEWRLKYERAVREVDFTKKRLQQEF-------EDKLEVEQQNKRQLERRLGDLQA-DSEE 666

Query: 429  REKADKDLQEKTP-IKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTE 487
             ++A + L++K   + AE  D  L L      + +L  K+   +    E  +  E    E
Sbjct: 667  SQRALQQLKKKCQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDS---ELSQAHEEAQRE 723

Query: 488  TDDREETERKNQDILDNSL-LAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKP 546
               RE+ +R+   +L  +  L  +   K+   A  T K    +A   +QD   Q+ +++ 
Sbjct: 724  KLQREKLQREKDMLLAEAFSLKQQLEEKDMDIAGFTQKVVSLEAE--LQDISSQESKDEA 781

Query: 547  LASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKS 606
              + +     D    K+  +E+EL EQ   +   ++++Q++++ E   E+   ++ +   
Sbjct: 782  SLAKVKKQLRDLEA-KVKDQEEELDEQAGTI---QMLEQAKLRLEMEMERMRQTHSKEME 837

Query: 607  LSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFLSQWSP 666
               +E+++  Q   K   +    ++  Y+  Q+  +             ++     Q + 
Sbjct: 838  SRDEEVEEARQSCQKKLKQMEVQLEEEYEDKQKVLREKRELEG------KLATLSDQVNR 891

Query: 667  LGLMYEK---DELHGVEAVYQKLDVLFRHCIENLRANKNAVDAMSKAVEAGE----SSVR 719
                 EK    +L   +A+     ++  H ++N   +K  +  +   +E  E    ++V+
Sbjct: 892  RDFESEKRLRKDLKRTKALLADAQLMLDH-LKNSAPSKREIAQLKNQLEESEFTCAAAVK 950

Query: 720  ----------------------KHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKED-- 755
                                  K + E   S+ Q+    + N ++E       L+K+   
Sbjct: 951  ARKAMEVEIEDLHLQIDDIAKAKTALEEQLSRLQREKNEIQNRLEEDQEDMNELMKKHKA 1010

Query: 756  --PKRGKSESYLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLYTIISGSEKIL 813
               +  +  + ++D++++L++ NK   +++ KL+      +  ++     +++S  E  +
Sbjct: 1011 AVAQASRDLAQINDLQAQLEEANKEKQELQEKLQALQSQVEFLEQSMVDKSLVSRQEAKI 1070

Query: 814  QGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIK--EERYWTIYAFERSLKNQAH 871
            +          L+ + +F+ +  K  E        N  K  EER   I A  R  +    
Sbjct: 1071 R---------ELETRLEFERTQVKRLESLASRLKENMEKLTEERDQRIAAENREKEQNKR 1121

Query: 872  LNAEV----ERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIK 927
            L  ++    E +  LA++ ++++    EL+  L       E+ ++ + + ++  F+R I 
Sbjct: 1122 LQRQLRDTKEEMGELARKEAEASRKKHELEMDLESL----EAANQSLQADLKLAFKR-IG 1176

Query: 928  ELKSVIEADAKENPNPN 944
            +L++ IE + + + N +
Sbjct: 1177 DLQAAIEDEMESDENED 1193


>gi|50554961|ref|XP_504889.1| YALI0F02079p [Yarrowia lipolytica]
 gi|49650759|emb|CAG77691.1| YALI0F02079p [Yarrowia lipolytica]
          Length = 704

 Score = 39.3 bits (90), Expect = 4.9,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 10/80 (12%)

Query: 366 RFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKE 425
           R KAE  L +           E K+     R    EE+  +E+   E+ ++EKA+KE  E
Sbjct: 296 RIKAEKALKHK----------EEKEKRDAERFKLAEERMEKERIEAERLEKEKAEKEQVE 345

Query: 426 KADREKADKDLQEKTPIKAE 445
           KA++E+ +K L      KAE
Sbjct: 346 KAEKERYEKSLLAMKKEKAE 365


>gi|302632528|ref|NP_001180603.1| retinoblastoma-binding protein 6 isoform 1 [Danio rerio]
          Length = 1766

 Score = 39.3 bits (90), Expect = 4.9,   Method: Composition-based stats.
 Identities = 31/113 (27%), Positives = 45/113 (39%), Gaps = 10/113 (8%)

Query: 425  EKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEE--------ELEEVKDE 476
            EK D E  D D   K   +    D  +  PSV   +VKL  KE          L+E   +
Sbjct: 1339 EKEDYESEDDD--SKVLNRTSSADTSVAAPSVENSAVKLSDKESPHSDKAQSTLKEADVK 1396

Query: 477  GKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQ 529
              K    G  E D  ++ ER+     D S    +  T  + P++P  ++  AQ
Sbjct: 1397 PAKDSTSGDKEKDTDKDRERERTKEKDRSSTTDRESTDKKKPSVPNQESAHAQ 1449


>gi|134078134|emb|CAK40215.1| unnamed protein product [Aspergillus niger]
          Length = 1078

 Score = 39.3 bits (90), Expect = 4.9,   Method: Composition-based stats.
 Identities = 70/298 (23%), Positives = 115/298 (38%), Gaps = 32/298 (10%)

Query: 309 DKSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKA--DYHWAEI-RHGN 365
           D ++  A  S  I+   GRI +      +   QI+Q R+L SK  A  D H AE+     
Sbjct: 499 DAAEHLAYLSAGISGLEGRIDKLLEQKSILTTQIQQQRELNSKSDAERDAHIAELAEQLT 558

Query: 366 RFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKA-DKEAK 424
             + +  L+ S          EL QA    +   QE + R+E+   E      A +KEA+
Sbjct: 559 HVRKDLELSES---EGQRSREELDQAWEQLKIMQQELENRKEEHKMEDVSGAMASEKEAR 615

Query: 425 EKADRE-----KADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKK 479
            +A+ E        +DL+ +    AE  D      +      +L   E  +EE++ +   
Sbjct: 616 ARAEAEVERLQSIIQDLEREKESHAEAHD------ARARAENELSRLEAHVEELRSQHST 669

Query: 480 GKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKP 539
             E  T      +    + Q +LD         T+ ET A   A       H   Q    
Sbjct: 670 HTEELTAAHSQAQAEITRLQSVLD--------QTQGETDAKIAAAEAARLEHLRSQ---- 717

Query: 540 QDQREKPLASDIGVGESDYAGIK--LTKKEKELQEQEENLRVAEIIQQSRMQSEDLQE 595
            D   + LAS     +S+ A +K  +++ + E+  + E     E   Q  +Q E+  +
Sbjct: 718 ADTHAEELASARAQADSEIAELKETISQLQSEVTLKAEASEAHERTTQQILQLEETMQ 775


>gi|289622617|emb|CBI50886.1| unnamed protein product [Sordaria macrospora]
          Length = 771

 Score = 38.9 bits (89), Expect = 5.0,   Method: Composition-based stats.
 Identities = 30/140 (21%), Positives = 59/140 (42%), Gaps = 8/140 (5%)

Query: 397 ANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSV 456
           A  +E  ++   + +E+  +E+A+++ +EK   E+  + + E  P +        GL  +
Sbjct: 349 AKMRESLRKWRVKTRERKKKERAERKEREKMQMEQEARQMAEAKPQELAASTTAAGLTGI 408

Query: 457 PTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQD---ILDNSLLAGKTHT 513
            +H     PK+ +++ V D   K KE  T   +  E+++    +   IL    L  +   
Sbjct: 409 ESHR---QPKKTDVQAVPD--VKDKESPTVPAESAEQSKASPGETPVILQAKELKPEPEP 463

Query: 514 KNETPAIPTAKAPPAQAHKG 533
               P      AP A   +G
Sbjct: 464 AEVQPQEEPTPAPTAPKKRG 483


>gi|156379760|ref|XP_001631624.1| predicted protein [Nematostella vectensis]
 gi|156218667|gb|EDO39561.1| predicted protein [Nematostella vectensis]
          Length = 1438

 Score = 38.9 bits (89), Expect = 5.0,   Method: Composition-based stats.
 Identities = 43/173 (24%), Positives = 80/173 (46%), Gaps = 20/173 (11%)

Query: 390 QATVLARANAQEEKQRREQEAK---EKADREKADKEAKEKADREKADKDLQEKTPIKAEG 446
           +A  +AR    ++K + EQEAK   EK +REKA +EA ++  RE+  +   +   ++   
Sbjct: 767 EAERMARLEEMQQK-KLEQEAKYKREKMEREKAREEAAKERAREREMRIAAKNEALRTAV 825

Query: 447 DDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKG--------KEPGTTETDDREETERKN 498
           +   L +    T S +    E++LE+VK++   G        + P  T  D ++     N
Sbjct: 826 EQLQLKIQQKQTDSTR--RHEQQLEQVKEKAAAGVSRHPTLEEVPNVTPYDTKKICTICN 883

Query: 499 QDILDN----SLLAGKTHTKN--ETPAIPTAKAPPAQAHKGIQDKKPQDQREK 545
            +I+      S L GK H ++  +    PT +     + + I+D   ++  +K
Sbjct: 884 VEIVSEVYLLSHLRGKKHQQSLLDKNIKPTPEDKDTVSLQYIKDMSTENTEQK 936


>gi|13124879|ref|NP_002465.1| myosin-11 isoform SM1A [Homo sapiens]
 gi|13432177|sp|P35749|MYH11_HUMAN RecName: Full=Myosin-11; AltName: Full=Myosin heavy chain 11;
            AltName: Full=Myosin heavy chain, smooth muscle isoform;
            AltName: Full=SMMHC
 gi|119574309|gb|EAW53924.1| myosin, heavy polypeptide 11, smooth muscle, isoform CRA_a [Homo
            sapiens]
 gi|119574310|gb|EAW53925.1| myosin, heavy polypeptide 11, smooth muscle, isoform CRA_a [Homo
            sapiens]
 gi|168273110|dbj|BAG10394.1| myosin-11 [synthetic construct]
 gi|270048016|gb|ACZ58373.1| myosin, heavy chain 11, smooth muscle isoform 1 [Homo sapiens]
          Length = 1972

 Score = 38.9 bits (89), Expect = 5.0,   Method: Composition-based stats.
 Identities = 61/272 (22%), Positives = 118/272 (43%), Gaps = 31/272 (11%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE--ITHHTRRLVKEDPK-------RGKSESY 764
             E+ ++K   E+L    Q + ++    + E  I+  T  L +E+ K       + K ES 
Sbjct: 976  AEAKIKKLEDEILVMDDQNNKLSKERKLLEERISDLTTNLAEEEEKAKNLTKLKNKHESM 1035

Query: 765  LSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTIIS-------GSEKILQGD 816
            +S++   L+K  K+  ++ ++K +L G   D  ++   L   I+         E+ LQ  
Sbjct: 1036 ISELEVRLKKEEKSRQELEKLKRKLEGDASDFHEQIADLQAQIAELKMQLAKKEEELQA- 1094

Query: 817  YTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAEV 876
                 L+ LD +    ++  K      G  ++  ++E+      A  ++ K +  L  E+
Sbjct: 1095 ----ALARLDDEIAQKNNALKKIRELEGHISD--LQEDLDSERAARNKAEKQKRDLGEEL 1148

Query: 877  ERLSGLAQQPSDSTADLKELQ-------TQLSRAKKYKESNDERIVSFIRSEFEREIKEL 929
            E L    +   DSTA  +EL+       T L +A   +  + E  V  +R +  + ++EL
Sbjct: 1149 EALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEEL 1208

Query: 930  KSVIEADAKENPNPNKNQKKLQKTREKLVAQL 961
               +E   +   N +KN++ L+K    L  +L
Sbjct: 1209 TEQLEQFKRAKANLDKNKQTLEKENADLAGEL 1240


>gi|149038931|gb|EDL93151.1| centrosomal protein 1 (predicted) [Rattus norvegicus]
          Length = 1874

 Score = 38.9 bits (89), Expect = 5.1,   Method: Composition-based stats.
 Identities = 52/213 (24%), Positives = 94/213 (44%), Gaps = 45/213 (21%)

Query: 862  FERSLKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQL-------SRAKKYKESNDERI 914
             E +L+ Q  +NA +++  G      D +A   EL+TQL       S+ K+  E+   R 
Sbjct: 680  LENALQEQHEVNASLQQAQG------DLSAYETELETQLKLKDAETSQLKQELENLVRRT 733

Query: 915  V---SFIRSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKELNID 971
                S +++E E+E + L+  +           K Q   +K +E   ++L ++LK+L  D
Sbjct: 734  QLEQSVLQTELEKERQSLRDAL----------GKAQSSEEKQQEN--SELRAQLKQLQDD 781

Query: 972  NAYGLWNEYKEDFKASFEYPL-GTYEPAILGAMKDMDRLHPIYSVSKTIQKAGGDPSLMM 1030
            N+  L  +  +DF++   + + G   P  + A  D  R        K ++   G+  +  
Sbjct: 782  NS--LLKKQLKDFQSHLNHVVDGLIHPEEVAARVDELR--------KRLKLGAGEMRIH- 830

Query: 1031 DYEKVEPSDVMAGLPDDLAKRFKALLSWKGWHQ 1063
                  PSDV+     DL K+F  +L+   W +
Sbjct: 831  -----SPSDVLGKSLADLQKQFSEILARSQWEK 858


>gi|73965999|ref|XP_863005.1| PREDICTED: similar to SWI/SNF-related matrix-associated
           actin-dependent regulator of chromatin e1 isoform 8
           [Canis familiaris]
          Length = 376

 Score = 38.9 bits (89), Expect = 5.1,   Method: Composition-based stats.
 Identities = 45/209 (21%), Positives = 87/209 (41%), Gaps = 31/209 (14%)

Query: 341 QIKQLRDLASKVKADYHWAEIRH---GNRFKAETRLAYSTIANVANFTSELKQATVLARA 397
           Q++ L     K++A+    E RH     +F   T    + +  +     E+    + A  
Sbjct: 195 QVQSLMVHQRKLEAELLQIEERHQEKKRKFLESTDSFNNELKRLCGLKVEVDMEKIAAEI 254

Query: 398 NAQEEKQRREQEAKEKADREKADK-EAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSV 456
              EE+ R+ QE +EK   E+A++ ++    + E A    QEK       DD        
Sbjct: 255 AQAEEQARKRQEEREKEAAEQAERSQSSMVPEEEPAASKTQEKK------DD-------- 300

Query: 457 PTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNE 516
              S+ +  +E  LEE  +  + G+E GT+  +D+E  +     + +       T +++ 
Sbjct: 301 --ESIPMETEETHLEEATESQQNGEE-GTSTPEDKESGQEGVDSMAEEGTSDSNTGSESN 357

Query: 517 TPAIPTAKAPPAQAHKGIQDKKPQDQREK 545
           +    T + PP        D  P+D++++
Sbjct: 358 S---ATVEEPPT-------DPTPEDEKKE 376


>gi|8163653|gb|AAF73784.1|AF154016_1 surface protein PspC [Streptococcus pneumoniae]
          Length = 680

 Score = 38.9 bits (89), Expect = 5.2,   Method: Composition-based stats.
 Identities = 56/225 (24%), Positives = 98/225 (43%), Gaps = 55/225 (24%)

Query: 387 ELKQATVLARANAQEEKQRREQEAKE--KADREKADKEAKEKADREKADKDLQEKTPIKA 444
           E +    + +A A+ E ++ E    E  K DR+KA++EAK KAD +  + ++      K 
Sbjct: 210 ESRDEEKIKQAEAEVESKQAEATRLENIKTDRKKAEEEAKRKADAKLKEANVATSDQGKP 269

Query: 445 EGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQD---- 500
           +G                               K+G  PG   T D++E + K+ D    
Sbjct: 270 KG-----------------------------RAKRGV-PGELATPDKKENDAKSSDSSVG 299

Query: 501 ---ILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLAS----DIGV 553
              +  +SL +GK   + E            +A K  +D+K +D+R  P  +    ++ +
Sbjct: 300 EETLPSSSLKSGKKVAEAEKKV--------EEAEKKAKDQKEEDRRNYPTNTYKTLELEI 351

Query: 554 GESDYAGIKLTKKEKEL-QEQEENLRVAEIIQQSRMQSEDLQEKA 597
            ESD   +K+ K E EL +E+ +  R  E I+Q++ + E  Q +A
Sbjct: 352 AESD---VKVKKAELELVKEEAKEPRDEEKIKQAKAEVESKQAEA 393


>gi|168210926|ref|ZP_02636551.1| LexA repressor [Clostridium perfringens B str. ATCC 3626]
 gi|209947633|ref|YP_002291140.1| putative LexA repressor [Clostridium perfringens]
 gi|170711066|gb|EDT23248.1| LexA repressor [Clostridium perfringens B str. ATCC 3626]
 gi|209910424|dbj|BAG75513.1| putative LexA repressor [Clostridium perfringens]
          Length = 379

 Score = 38.9 bits (89), Expect = 5.2,   Method: Composition-based stats.
 Identities = 48/196 (24%), Positives = 83/196 (42%), Gaps = 20/196 (10%)

Query: 797 QEQPPLYTIISGSEKI-LQGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEER 855
           + +PP+YT++  SE +    D       ++   ++   SY++L E  Y  + N  I + R
Sbjct: 46  KSEPPIYTLVKMSEVMNCSIDELLGTTKAISNSAEEKFSYNELIEKIY--YLNELIDKNR 103

Query: 856 YWTIYAFERSLKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESN-DERI 914
                      KN   L    +R   +  + S S    + +  +LS +KK  E   DE +
Sbjct: 104 -----------KNYEDLIMSKKRTERMLDELSMSKKRTERMFDELSMSKKRTERMFDELL 152

Query: 915 VSFIRSEFEREIKELKSVI---EADAKENPNPNKNQKKLQKTREKLVAQLSSRLKELNID 971
           +S  R+E  R   EL  +    E+D       +K    L    + +  + S  +KE+N D
Sbjct: 153 MSKKRTE--RMFIELNRITNRSESDILTFQKLSKEFASLLDKNKSIENEYSKSIKEVNED 210

Query: 972 NAYGLWNEYKEDFKAS 987
           N +      KE+F +S
Sbjct: 211 NIFNYSITEKENFLSS 226


>gi|149755324|ref|XP_001490532.1| PREDICTED: similar to MAD1-like 1 protein [Equus caballus]
          Length = 717

 Score = 38.9 bits (89), Expect = 5.2,   Method: Composition-based stats.
 Identities = 26/93 (27%), Positives = 52/93 (55%), Gaps = 5/93 (5%)

Query: 403 KQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVK 462
           + ++ QEA +K    +A +E +  AD+E+  KDL++K  ++ +     + + ++ +  V+
Sbjct: 197 QHKKWQEANQKIQELQASQEVR--ADQEQRIKDLEQKLSLQEQD---AVIVKNMKSELVR 251

Query: 463 LPPKEEELEEVKDEGKKGKEPGTTETDDREETE 495
           LP  E EL+++++E    +E   T    REE E
Sbjct: 252 LPKMERELKQLREENVHLREMRETNGLLREELE 284


>gi|261377529|ref|ZP_05982102.1| M23 peptidase domain protein [Neisseria cinerea ATCC 14685]
 gi|269146266|gb|EEZ72684.1| M23 peptidase domain protein [Neisseria cinerea ATCC 14685]
          Length = 618

 Score = 38.9 bits (89), Expect = 5.2,   Method: Composition-based stats.
 Identities = 74/322 (22%), Positives = 124/322 (38%), Gaps = 59/322 (18%)

Query: 373 LAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKA---DR 429
           L +S     A+ T+  + A V  +   ++E  R E+  KEK      DK++  K    D 
Sbjct: 12  LVFSAPVIAADNTANSRSAEVKKQEKNKKEHARAEEGKKEKGKNAVKDKKSDGKEAVRDG 71

Query: 430 EKADKDLQEKTPIKAEGDDFG---------LGLPSVPTHSVKLPPKEEELE--------- 471
           +++ K L+     + E D            +  P   +    + P  E  E         
Sbjct: 72  KESKKPLKNSKGAEKEADASKHSQREGRNRVKEPEAESKKTHVKPVAESKEKSIKVQTES 131

Query: 472 -----EVKDEG----KKGKEPGTTETDDREETE---RKNQDILDNSLLAGKTHTKNETPA 519
                E KDEG    K GK+P   +    ++T+   R N+          K HT  E   
Sbjct: 132 KQVKKEGKDEGVRLHKGGKKPVKDDKAADKDTDDTVRANK----------KNHTAKEGKT 181

Query: 520 IPTAKAPPAQAHKGIQDK-KPQDQREKPLASDIGVGESDYAGIKLTKKEKE--------- 569
           +   K  P Q   G  DK K ++     L + +    +D    K   K+ E         
Sbjct: 182 VRQDKK-PVQEKNGKSDKQKAENTDSDELKAAVATATNDVGNKKALLKQSEGLLIHVSTS 240

Query: 570 -LQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAKVFYRSYS 628
             Q QEE +R  E I+Q+R     +  K  +++ +++ L+ D + +   + A    +   
Sbjct: 241 LKQLQEERIR-QERIRQARGSLASVNRKQREAWDDFQKLNAD-LNRLKTEVAGTKAQISR 298

Query: 629 PVDGSYKGTQESDKAINHFLDN 650
            V G+YK +Q +  A+  FL N
Sbjct: 299 FVSGNYKNSQPN--AVALFLKN 318


>gi|188532504|ref|YP_001906301.1| translation initiation factor IF-2 [Erwinia tasmaniensis Et1/99]
 gi|188027546|emb|CAO95393.1| Translation initiation factor IF-2 [Erwinia tasmaniensis Et1/99]
          Length = 896

 Score = 38.9 bits (89), Expect = 5.2,   Method: Composition-based stats.
 Identities = 39/164 (23%), Positives = 70/164 (42%), Gaps = 22/164 (13%)

Query: 405 RREQEAKEKADRE---KADKEAKEKADREKADKD--LQEKTPIKAEGDDFGLGLPSVPTH 459
           + ++EA++KA RE   +A +EA +KA RE A+KD    + T                   
Sbjct: 125 KAQREAQDKAKREAEEQAKREAADKAKREAAEKDKVSNQHTDETTRATQSDRARREAEAA 184

Query: 460 SVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNS--LLAGKTHTK--- 514
            +K   +EE   ++++E K+  E      +++ E     +++ D S   +   TH +   
Sbjct: 185 ELKRKAEEEAHRKIEEEAKRVAEEARKMAEEKGEEWAVAKEVEDTSDYHVTTSTHARAAE 244

Query: 515 ----------NETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLA 548
                       T A+  AKAP  +  KG +  + +  RE+  A
Sbjct: 245 DENDAQVEGDRRTRAVRPAKAPVRK--KGNKHSEAKTDREEARA 286


>gi|62857439|ref|NP_001016846.1| RING1 and YY1 binding protein [Xenopus (Silurana) tropicalis]
          Length = 338

 Score = 38.9 bits (89), Expect = 5.2,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 394 LARANAQEEKQRREQEAKEKADREKADKEA--KEKADREKADKDLQEKTPIKAEGDD 448
           L R     EK  RE+  +EK DREK DKE   ++K DREK D++  ++  ++ E  D
Sbjct: 112 LDREKLDREKLDREKLDREKLDREKLDKEKLDRDKIDREKLDREKNDREKLEREKLD 168


>gi|293358103|ref|XP_230637.5| PREDICTED: ribosome binding protein 1, partial [Rattus norvegicus]
          Length = 1336

 Score = 38.9 bits (89), Expect = 5.3,   Method: Composition-based stats.
 Identities = 44/218 (20%), Positives = 100/218 (45%), Gaps = 13/218 (5%)

Query: 394 LARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGL 453
           L +A +Q E ++  + AK + +  K +KE  EK+  E + ++ Q++  ++A+   F   +
Sbjct: 742 LNQATSQVESKQNTELAKLRQELSKVNKELVEKS--EASRQEEQQRKALEAKAATFEKQI 799

Query: 454 PSV-PTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDI--LDNSLLAGK 510
             +  +H       ++ LEEV  E  + +        D E+ + + Q +  L + L + +
Sbjct: 800 LQLQASHKESEEALQKRLEEVTRELCRAQTSHANLRADAEKAQEQQQRVAELHSKLQSSE 859

Query: 511 THTKNETPAIP-------TAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKL 563
              K++   +         A+A  +Q  + I+  +   +  +   S     E+D    +L
Sbjct: 860 VEVKSKCEELSDLHGQLKEARAENSQLTERIRSIEALLEAGQAQDSQASRAEADQQQTRL 919

Query: 564 TKKEKELQ-EQEENLRVAEIIQQSRMQSEDLQEKAWDS 600
            + E ++   ++E   + E ++Q + ++ DL+EK W +
Sbjct: 920 KELESQVSCLEKETSELKEAMEQQKGKNNDLREKNWKA 957


>gi|311222927|gb|ADC36323.2| Protein A, von Willebrand factor binding protein Spa;
           Immunoglobulin G binding protein A precursor
           [Staphylococcus aureus 04-02981]
          Length = 492

 Score = 38.9 bits (89), Expect = 5.4,   Method: Composition-based stats.
 Identities = 56/226 (24%), Positives = 86/226 (38%), Gaps = 35/226 (15%)

Query: 341 QIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSE--------LKQAT 392
           + K+L D A   KAD         N+F  E + A+  I ++ N T E        LK   
Sbjct: 258 EAKKLND-AQAPKAD---------NKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDP 307

Query: 393 VLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLG 452
            +++    E K+  + +A ++ D +K  KE   K  +E  +K      P K +G+  G  
Sbjct: 308 SVSKEILAEAKKLNDAQAPKEEDNKKPGKEDGNKPGKEDNNK------PGKEDGNKPGKE 361

Query: 453 LPSVP-THSVKLPPKEEELEEVKDEGKK-GKE---------PGTTETDDREETERKNQDI 501
             + P       P KE+  +  K++G K GKE         PG T  D  +        I
Sbjct: 362 DNNKPGKEDGNKPGKEDGNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADKI 421

Query: 502 LDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPL 547
             ++ LA K   K     +   K P   A        P+   E P 
Sbjct: 422 AADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEENPF 467


>gi|221482410|gb|EEE20758.1| conserved hypothetical protein [Toxoplasma gondii GT1]
          Length = 814

 Score = 38.9 bits (89), Expect = 5.4,   Method: Composition-based stats.
 Identities = 46/213 (21%), Positives = 90/213 (42%), Gaps = 28/213 (13%)

Query: 385 TSELKQATVLARANAQE-EKQRREQEAKEKADREKADKEA-KEKADREKADKDLQEKTPI 442
           +S+ ++A+V   +N  E +K+R E+E+ E++   K+D E  KE++  E+AD D    T +
Sbjct: 78  SSDRREASVKTLSNENESDKERAEKESDEESVSAKSDSETEKEESQDERADSDASSDTDV 137

Query: 443 KAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDIL 502
                                  +  E E +K   K+  +   ++   RE   R +  + 
Sbjct: 138 -----------------------ERREPEAMKAVKKRESKRAESKATLREVVSRSDTSVS 174

Query: 503 DNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIK 562
             S  + K+ +     A  T+++  A +H+  Q     D  E     ++   E D A   
Sbjct: 175 AASYASQKSKSSTLQEAGTTSES--ALSHRSAQASVHADPNELKQRIEVLTKERDEAVQL 232

Query: 563 LTKKEKEL-QEQEENLRVAEIIQQSRMQSEDLQ 594
                 EL Q ++ N  + + + Q + + +DL+
Sbjct: 233 HQSVSAELEQARKTNASLVQELDQEKQKVQDLE 265


>gi|123414550|ref|XP_001304511.1| hypothetical protein [Trichomonas vaginalis G3]
 gi|121885968|gb|EAX91581.1| hypothetical protein TVAG_004210 [Trichomonas vaginalis G3]
          Length = 1504

 Score = 38.9 bits (89), Expect = 5.5,   Method: Composition-based stats.
 Identities = 72/303 (23%), Positives = 127/303 (41%), Gaps = 47/303 (15%)

Query: 380  NVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEK 439
            N+ N  +++K      RAN  + K   E   K K+D  +  KEA E  +++K DK  ++ 
Sbjct: 1026 NMENKNTQMKGDFEKIRANYDKLKSDYE---KLKSDNNQLQKEADE--NKQKLDKKEEKI 1080

Query: 440  TPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQ 499
              +K +  +      S+ +  ++    + ELE++K   K  KE    +  + E+ + KN+
Sbjct: 1081 QNLKLQIQNLQKDQSSMKSSEIQ--RLQNELEQMKANNKSLKENIEAKNKEIEQNKEKNK 1138

Query: 500  DILDNSLLAGKTHTKNETPAIPTAKAPPAQ------AHKGIQDKKPQDQREKPLASDIGV 553
             +  N  L    +  NE     T K    Q      A+K  + +K +D  EK   SD   
Sbjct: 1139 ALKSN--LTNLQNKINEIQNALTGKDKENQLLQNELANKNKEIQKLKDDLEKA-KSDKNK 1195

Query: 554  GESDYAGIKLTKKEKELQEQE------------------ENLRVAEIIQQSR-------M 588
             +++      +K EK + E+E                  EN ++  I+++          
Sbjct: 1196 SQNEITDKLNSKLEKVMAEKEDLLKQNANLQAEMQKLKAENEKLKGILKKKTAYINDYYA 1255

Query: 589  QSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFL 648
            Q+  L++K++   KE  SL  D +K++F K     Y S   +D  +K      K  N  +
Sbjct: 1256 QTVKLEQKSFGLQKEVDSL--DVVKKKFDK----LYTSREEIDNLFKEYGILQKLYNDHV 1309

Query: 649  DND 651
            D D
Sbjct: 1310 DKD 1312


>gi|291238576|ref|XP_002739211.1| PREDICTED: MDN1, midasin homolog [Saccoglossus kowalevskii]
          Length = 5435

 Score = 38.9 bits (89), Expect = 5.5,   Method: Composition-based stats.
 Identities = 48/215 (22%), Positives = 87/215 (40%), Gaps = 30/215 (13%)

Query: 404  QRREQEAKEKA----DREKADKEAKEKADREKADKDLQEKTPIKAE------------GD 447
            Q R  E K+++    D    +K  ++  +    D DL E   +  E            G+
Sbjct: 4697 QPRNLEPKDESEFNDDEIDPNKANRDPPENTADDLDLSEDLNLDEEMGKDKENEDDQDGE 4756

Query: 448  DFGLGLPSVPTHSVKLPPKEEEL--EEVKDEGKKGKEPGTTETDDREETERKNQDILDNS 505
            D G   P      ++  P  EE+  EE KDE ++G +    E+    E E+K+++  DN 
Sbjct: 4757 DEGEENP----FDIETKPNVEEVKDEESKDEEQEGADELNPESTTDVEDEQKDEEAKDNE 4812

Query: 506  LLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTK 565
            +   K    ++       K     +    QD    D+ E    +D      D    K T 
Sbjct: 4813 MDVDKKADDDDEGNEEEPKDKGTHS----QDDPMNDEEETTPPTDEESKPEDITAAKETT 4868

Query: 566  KEKELQE----QEENLRVAEIIQQSRMQSEDLQEK 596
            +  E  E    Q++ +++++ ++Q   +SE+ Q+K
Sbjct: 4869 EAAEDHEKTHTQQDPVQLSDDVEQHAGKSEEDQKK 4903


>gi|68468331|ref|XP_721725.1| hypothetical protein CaO19.1648 [Candida albicans SC5314]
 gi|68468574|ref|XP_721606.1| hypothetical protein CaO19.9217 [Candida albicans SC5314]
 gi|46443529|gb|EAL02810.1| hypothetical protein CaO19.9217 [Candida albicans SC5314]
 gi|46443657|gb|EAL02937.1| hypothetical protein CaO19.1648 [Candida albicans SC5314]
          Length = 1332

 Score = 38.9 bits (89), Expect = 5.5,   Method: Composition-based stats.
 Identities = 88/452 (19%), Positives = 174/452 (38%), Gaps = 70/452 (15%)

Query: 101 LKRLAETG---EVILSDKSDRLLCRFMDMVETEDEHKINK------QVRDALESAGFDLE 151
           LKR  E G   E+ L +K + L      + E +D +++ K      +    +    F+L+
Sbjct: 485 LKRKVEVGSNNEIELEEKRNDLELTMKLLQEKKDLNEVRKLDAKIMECNTEISKLEFELD 544

Query: 152 STQENIRKVESALINNNMKDAFRFLELAQKSKETADSHIIEAID------VGTKLKENTP 205
              E  +K+ ++   ++++    FLE + KSK+   S I   ID      +G+KL  +  
Sbjct: 545 ---ELAKKLSTSNKQSDLRSKVLFLEESAKSKKAELSKIFATIDSSYFDVLGSKLDVDVG 601

Query: 206 PTTFTS-ISKVLLKSNNMQDVVFTKIKEVVKKHVNAELGHRKLRGLAFDHTYFNDKLNQF 264
            +  +  IS + +KS   Q                     +K+  L  +     + +   
Sbjct: 602 ESLLSQKISNLEIKSEEQQ---------------------KKVGSLESELQINKNSIESI 640

Query: 265 LKEIKNHQKEYDESEKGSSKARYHAA---YAHIYWDLANDWVNGRVGDKSDEWARTSTNI 321
           LK I+ +  + D  +   +K         Y ++  DL + + N      S E  R   N 
Sbjct: 641 LKTIEENNSKIDSLKSNITKVIGEDEINDYENVVNDLEDSYRNVSEDVNSAEVTRDFKNS 700

Query: 322 ASWIG----------RITRTEGLGGVTYD--------QIKQLRDLASKVKADYHWAEIRH 363
           A              R+    GLG    D        +I+++R+ + ++K      E+  
Sbjct: 701 AISFAEENKCCLLCKRLFEQGGLGSFIQDLKQSVDEHKIQEIREQSLEIKK-----ELED 755

Query: 364 GNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEA 423
                 E       +ANV NF  +LK+   L   ++Q E +  +Q  +++  +   D   
Sbjct: 756 VKSINLEVINYRECLANVQNFECKLKE---LVDKSSQIENELEQQRKEQQTIKHSLDNAL 812

Query: 424 KEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEP 483
             K     A +   E + I+ + D+    L       V +   +++ +++  + KK ++ 
Sbjct: 813 SLKKPLSDATRIHLEVSEIEFQLDELNEDLSGFGGSVVSVDELQKQQQDINLKIKKTRQD 872

Query: 484 GTTETDDREETERKNQDILDNSLLAGKTHTKN 515
               T+ + + +R+ Q  L+N +   K    N
Sbjct: 873 LNDYTESKYKAQRELQK-LENRVKDTKLQISN 903


>gi|307198143|gb|EFN79171.1| Probable ATP-dependent RNA helicase DDX10 [Harpegnathos saltator]
          Length = 738

 Score = 38.9 bits (89), Expect = 5.6,   Method: Composition-based stats.
 Identities = 38/147 (25%), Positives = 71/147 (48%), Gaps = 15/147 (10%)

Query: 364 GNRFKAETRLAYSTIA----NVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKA 419
           G       R+  S +A    N A+    ++ +  + R   Q +KQR  +  + K   EK 
Sbjct: 551 GQELIDSARMKMSELARKYENEADSGINIEMSKQILREEDQFDKQRHRERIRAKHREEKM 610

Query: 420 DKEAKEKA-----DREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVK 474
             +A +K      D+E+A++D+      +AE  + G  +  +P    K+  K+ +++E K
Sbjct: 611 KLKAAKKMKVNLNDKEEAEEDIDNNVISEAESSE-GPDMSWLPDPD-KIYGKQRDIDEEK 668

Query: 475 DEGK-KGKEPGTTETDDREETERKNQD 500
           ++ K KG++   TET+D+E  E +  D
Sbjct: 669 NDNKFKGED---TETEDKESEENEGSD 692


>gi|2104553|gb|AAC31665.1| Myosin heavy chain (MHY11) (5'partial) [Homo sapiens]
          Length = 1857

 Score = 38.9 bits (89), Expect = 5.6,   Method: Composition-based stats.
 Identities = 61/272 (22%), Positives = 118/272 (43%), Gaps = 31/272 (11%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE--ITHHTRRLVKEDPK-------RGKSESY 764
             E+ ++K   E+L    Q + ++    + E  I+  T  L +E+ K       + K ES 
Sbjct: 861  AEAKIKKLEDEILVMDDQNNKLSKERKLLEERISDLTTNLAEEEEKAKNLTKLKNKHESM 920

Query: 765  LSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTIIS-------GSEKILQGD 816
            +S++   L+K  K+  ++ ++K +L G   D  ++   L   I+         E+ LQ  
Sbjct: 921  ISELEVRLKKEEKSRQELEKLKRKLEGDASDFHEQIADLQAQIAELKMQLAKKEEELQA- 979

Query: 817  YTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAEV 876
                 L+ LD +    ++  K      G  ++  ++E+      A  ++ K +  L  E+
Sbjct: 980  ----ALARLDDEIAQKNNALKKIRELEGHISD--LQEDLDSERAARNKAEKQKRDLGEEL 1033

Query: 877  ERLSGLAQQPSDSTADLKELQ-------TQLSRAKKYKESNDERIVSFIRSEFEREIKEL 929
            E L    +   DSTA  +EL+       T L +A   +  + E  V  +R +  + ++EL
Sbjct: 1034 EALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEEL 1093

Query: 930  KSVIEADAKENPNPNKNQKKLQKTREKLVAQL 961
               +E   +   N +KN++ L+K    L  +L
Sbjct: 1094 TEQLEQFKRAKANLDKNKQTLEKENADLAGEL 1125


>gi|301615183|ref|XP_002937063.1| PREDICTED: myosin-10 [Xenopus (Silurana) tropicalis]
          Length = 1971

 Score = 38.9 bits (89), Expect = 5.7,   Method: Composition-based stats.
 Identities = 60/302 (19%), Positives = 121/302 (40%), Gaps = 66/302 (21%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   ++L  + Q S      F+KE       I   T +L +E+ K       + 
Sbjct: 977  AEAKIKKMEEDILVLEDQNS-----KFLKEKKLLEERIAESTSQLAEEEEKAKNLAKLKN 1031

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTIIS----------- 807
            K E  ++D+   L+K  KT  ++ + K +L G   D+  +   L   I            
Sbjct: 1032 KQEMMITDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIEELKLQLAKKEE 1091

Query: 808  --------GSEKILQGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTI 859
                    G E++LQ + T   +  L  Q                      ++E+     
Sbjct: 1092 ELQAALARGDEEVLQKNNTLKVVRELQAQIA-------------------ELQEDLESEK 1132

Query: 860  YAFERSLKNQAHLNAEVERLSGLAQQPSDSTADLKELQT-------QLSRAKKYKESNDE 912
             +  ++ K +  L+ E+E L    +   D+TA  +EL+T       +L ++ + +  N E
Sbjct: 1133 ASRNKAEKQKRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKSIEEETRNHE 1192

Query: 913  RIVSFIRSEFEREIKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKELNIDN 972
              +  +R      ++EL   +E   +   N  KN++ L+   ++L  ++ S L+++  ++
Sbjct: 1193 AQIQEMRQRQATALEELSEQLEQAKRFKGNLEKNKQSLESDNKELATEVKS-LQQMKAES 1251

Query: 973  AY 974
             Y
Sbjct: 1252 EY 1253


>gi|89273396|emb|CAJ83349.1| RING1 and YY1 binding protein [Xenopus (Silurana) tropicalis]
          Length = 336

 Score = 38.9 bits (89), Expect = 5.7,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 394 LARANAQEEKQRREQEAKEKADREKADKEA--KEKADREKADKDLQEKTPIKAEGDD 448
           L R     EK  RE+  +EK DREK DKE   ++K DREK D++  ++  ++ E  D
Sbjct: 110 LDREKLDREKLDREKLDREKLDREKLDKEKLDRDKIDREKLDREKNDREKLEREKLD 166


>gi|315634097|ref|ZP_07889386.1| translation initiation factor IF-2 [Aggregatibacter segnis ATCC
           33393]
 gi|315477347|gb|EFU68090.1| translation initiation factor IF-2 [Aggregatibacter segnis ATCC
           33393]
          Length = 829

 Score = 38.9 bits (89), Expect = 5.7,   Method: Composition-based stats.
 Identities = 49/221 (22%), Positives = 89/221 (40%), Gaps = 53/221 (23%)

Query: 389 KQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDD 448
           ++A  LAR  A+E+ ++  +EAK  A+   AD  + E A  +  D +L  +  ++AE + 
Sbjct: 123 RKAEELARQKAEEQARKAAEEAKRYAE---ADTSSNESASEDYTDYNLSSRYALEAEDE- 178

Query: 449 FGLGLPSVPTHSVKLPPKEEELEEVKDEGK----KGKEPGTTETDDREETERKNQDILDN 504
                             EE   E +  GK    K K+ G  +  ++ E E   +++ D 
Sbjct: 179 ------------------EERRNEGRGRGKNKVAKAKKGGRDDESNKNERESNRRNLKDG 220

Query: 505 SLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGES-------D 557
               GK     +  A+  A   P QA K                +D+ +GE+       +
Sbjct: 221 K--FGKGKNGKKGAALQQAFTKPVQAVK----------------TDVVIGETITVAELAN 262

Query: 558 YAGIKLTKKEKELQEQEENLRVAEIIQQSRMQ--SEDLQEK 596
               K T+  K + +  E + + +++ Q   Q  +E+L  K
Sbjct: 263 KMATKATEIIKAMMKMGEMVTINQVLDQETAQLVAEELGHK 303


>gi|300123333|emb|CBK24606.2| unnamed protein product [Blastocystis hominis]
          Length = 477

 Score = 38.9 bits (89), Expect = 5.8,   Method: Composition-based stats.
 Identities = 58/234 (24%), Positives = 94/234 (40%), Gaps = 42/234 (17%)

Query: 388 LKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKD-----LQEKTPI 442
           L +  + AR   Q  ++  EQ  K   + EKA ++  EKA+ E    +      + +TP 
Sbjct: 159 LPEELLQAREARQRAEKVIEQLQKRAEEAEKAKQDQTEKAEGETPKSEGETPKTEGETP- 217

Query: 443 KAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDIL 502
           KAEG+          T   +    + E E  K EG+  K  G T  D+  E+E       
Sbjct: 218 KAEGE----------TAKAEGETAKTEGETAKTEGETAKTEGETPKDESGESE------- 260

Query: 503 DNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIK 562
            +S       T +ETP + +A A  + A   + ++  QD  E              A   
Sbjct: 261 -SSPFKTTFTTMDETP-VSSAPADLSDAFSRLMERFDQDGEE--------------AASV 304

Query: 563 LTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRF 616
           L ++E E+  +   +   E   Q  +  +D Q   +  Y+  + +SP EI Q F
Sbjct: 305 LPEEESEVIGEGHIVDALEYSDQVYVHEKDRQ-MMYAMYQ--RGVSPREISQSF 355


>gi|53129001|emb|CAG31353.1| hypothetical protein RCJMB04_5f21 [Gallus gallus]
          Length = 412

 Score = 38.9 bits (89), Expect = 5.8,   Method: Composition-based stats.
 Identities = 45/202 (22%), Positives = 82/202 (40%), Gaps = 24/202 (11%)

Query: 341 QIKQLRDLASKVKADYHWAEIRH---GNRFKAETRLAYSTIANVANFTSELKQATVLARA 397
           Q++ L     K++A+    E RH     +F   T    S +  + +   E+    + A  
Sbjct: 230 QVQSLMVHQRKLEAELLQIEERHQEKKRKFLESTESFNSELKRLCSLKVEVDMEKIAAEI 289

Query: 398 NAQEEKQRREQEAKEKADREKADK-EAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSV 456
              EE+ R+ QE +EK   E+A++ +    A+ E+A   ++EK   +           S 
Sbjct: 290 AQAEEQARKRQEEREKEAAEQAERSQNNTAAEEEQAANKMEEKKEEE-----------ST 338

Query: 457 PTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNE 516
           P  +      EE   E   E ++  E GT+  DD+E  +       +       T +++ 
Sbjct: 339 PMET------EEPHPEESTENQQNGEEGTSTPDDKESGQEGADSTAEEGTSDSNTGSESN 392

Query: 517 TPAIPTAKAPPAQAHKGIQDKK 538
           +    T + PPA  +    +KK
Sbjct: 393 S---ATVEEPPADPNTEESEKK 411


>gi|149567471|ref|XP_001512488.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus]
          Length = 1192

 Score = 38.9 bits (89), Expect = 5.9,   Method: Composition-based stats.
 Identities = 54/238 (22%), Positives = 93/238 (39%), Gaps = 32/238 (13%)

Query: 399 AQEEKQRREQEAKEKADREKADKEAKEKADREKADKD--------------LQEKTPIKA 444
           A+E+ Q      K  A   K  K+ KE+ADR +  KD                 +T I+ 
Sbjct: 153 AEEDTQFNYHRKKNIAAERKEAKQEKEEADRYQRLKDEVVRAQVQLQLFKLYHNETEIEK 212

Query: 445 EGDDFGLGLPSVPTHSVKLPPKEEELEEVKDE-GKKGKEPGTTETDDREETERKNQDILD 503
              + G     +     ++   E+EL++ K E GK  +E    E + +E+    NQ    
Sbjct: 213 LNKELGSKNKEIDKDKKRMDKVEDELKDKKKELGKMMREQQQIEKEIKEKDSELNQK--R 270

Query: 504 NSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKL 563
              +  K +T ++   +  AK       K +Q+ + Q ++ K        G+ D    ++
Sbjct: 271 PQYIKAKENTSHKIKKLEAAK-------KSLQNAQKQYKKRK--------GDMDELEKEM 315

Query: 564 TKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAK 621
              EK  QE EE +      Q   +  E+ Q K +   KE  S     + Q  +K+ +
Sbjct: 316 LSVEKARQEFEERMEEESQSQGRDLTLEENQVKKYHRLKEEASKRAATLAQELEKFNR 373


>gi|190608796|gb|ACE79729.1| coiled-coil Y protein [Drosophila grimshawi]
          Length = 1235

 Score = 38.9 bits (89), Expect = 5.9,   Method: Composition-based stats.
 Identities = 45/209 (21%), Positives = 91/209 (43%), Gaps = 16/209 (7%)

Query: 1   MNELATSIDYQTNNLDQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYI 60
           MNELA  +D     ++QD  P  +    +      +  LR+ +      +    D+ D +
Sbjct: 614 MNELAKQVDC-FKQMNQDTYPGGENITNINDCMSELDRLRKLVKERDGQVGDLIDQNDCL 672

Query: 61  VGPIEQRLKKVSERYERV--VSRDLTLVIEAGLKD----LKEV------GDTLK-RLAET 107
                Q  K++ +  +++  + RD T  +E G+++    ++E+       D LK  ++  
Sbjct: 673 CEAAVQSNKRLDQLDKKLSLLDRD-TRYMEDGMRESLQLIREIDGVARENDMLKDNISGL 731

Query: 108 GEVILSDKSDRLLCRFMDMVETEDE-HKINKQVRDALESAGFDLESTQENIRKVESALIN 166
            +  L D +D L  +  D ++++ +  ++NK +RD L + G D  S ++   K     I 
Sbjct: 732 KQSELQDLTDDLRRQLEDCMKSKQKCEEVNKSLRDKLLNLGGDPHSVEKEAEKRVQEQIE 791

Query: 167 NNMKDAFRFLELAQKSKETADSHIIEAID 195
              K A    + A+++K   D  +    D
Sbjct: 792 RERKAAEDTKKAAEEAKRAGDKPVAGPAD 820


>gi|28972888|dbj|BAC65860.1| mKIAA3005 protein [Mus musculus]
          Length = 1833

 Score = 38.9 bits (89), Expect = 5.9,   Method: Composition-based stats.
 Identities = 70/300 (23%), Positives = 122/300 (40%), Gaps = 71/300 (23%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   EVL  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 833  AEAKIKKMEEEVLLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 887

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTII-------SGSEK 811
            K E  +SD+   L+K  KT  ++ + K +L G   D+  +   L   +       +  E+
Sbjct: 888  KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQVDELKVQLTKKEE 947

Query: 812  ILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERS 865
             LQG      D T    ++L V  +  +  ++L E F                    E++
Sbjct: 948  ELQGALARGDDETLHKNNALKVARELQAQIAELQEDFES------------------EKA 989

Query: 866  LKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFERE 925
             +N+A             +Q  D + +L+ L+T+L        +  E     +R++ E+E
Sbjct: 990  SRNKAE------------KQKRDLSEELEALKTELEDTLDTTAAQQE-----LRTKREQE 1032

Query: 926  IKELKSVIEADAKENPNPNKNQKKLQKTR-EKLVAQL--SSRLKELNIDNAYGLWNEYKE 982
            + ELK  +E + K +    ++ ++   T  E+L  QL  + R K     N  GL  + KE
Sbjct: 1033 VAELKKALEDETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKE 1092


>gi|291395493|ref|XP_002714279.1| PREDICTED: desmoplakin [Oryctolagus cuniculus]
          Length = 3053

 Score = 38.9 bits (89), Expect = 6.0,   Method: Composition-based stats.
 Identities = 60/280 (21%), Positives = 113/280 (40%), Gaps = 34/280 (12%)

Query: 695  ENLRANKNAVDAMSKAVEAGESSVRKHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKE 754
            EN++      +   KA+E    S+ +   E+   +     +   + + E      RL  +
Sbjct: 1851 ENVKQAHLRNEHFQKAIEDKSRSLNESKIEIERLQSLTENLTKEHLMLEEELRNLRLEYD 1910

Query: 755  DPKRGKSES------YLSDIRSELQKVNKTVMDIRIKLRLYGIFQDIPQEQPPLYTIISG 808
            D +RG+SE+       +S++RS+LQ  N         L L G+  D+ +E+  L   I  
Sbjct: 1911 DLRRGRSEADSDKNATISELRSQLQISNNRT------LELQGLLNDLQRERENLRQEIEK 1964

Query: 809  SEKILQGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWT---NNAIKEERYWTIYAFERS 865
             +K            +L+  ++   S ++  ++     +      + E+    +   E  
Sbjct: 1965 FQK-----------QALEASNRIQESKTQCTQVVQERESLLVKIKVLEQDKARLQRLEDE 2013

Query: 866  L-KNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKK------YKESNDERIVSFI 918
            L + +A L AE      L  +      DL + +TQ SR ++       +    ER  + +
Sbjct: 2014 LNRAKATLEAEARVKQRLECEKQQIQNDLNQWKTQYSRKEEAIRKIESEREKSEREKNSL 2073

Query: 919  RSEFEREIKELKSVIE-ADAKENPNPNKNQKKLQKTREKL 957
            RSE ER   E+K + E    K   +  + Q +L+  R +L
Sbjct: 2074 RSEIERLQAEIKRIEERCRRKLEDSSRETQSQLETERSRL 2113


>gi|308512455|ref|XP_003118410.1| CRE-LFI-1 protein [Caenorhabditis remanei]
 gi|308239056|gb|EFO83008.1| CRE-LFI-1 protein [Caenorhabditis remanei]
          Length = 2356

 Score = 38.9 bits (89), Expect = 6.0,   Method: Composition-based stats.
 Identities = 79/349 (22%), Positives = 148/349 (42%), Gaps = 50/349 (14%)

Query: 129 TEDEHKINKQVRDALESAGFDLESTQENIRKVESALINNNMK-----DAFRFL-ELAQKS 182
           T+ E  I + +   LES G D    Q  I ++E+ L  N  K     +A + L E+AQ S
Sbjct: 445 TKYEESIERNIE--LESKGDD---AQRKIAELEAELRRNREKLNESQNALKKLHEMAQDS 499

Query: 183 KETADSHI-IEAIDVGTKLKENTPPT--------TFTSISKVLLKSNNMQDVVFTKIKEV 233
           ++  D  + I+     +  K   PP+        TF +    + +      +  +++KE 
Sbjct: 500 EKNVDGTVSIKRTRSLSPGKTPLPPSEALRAVRNTFRNKDNDIQQLERKLKIAESQVKEF 559

Query: 234 VKKHVNAELGHRKLRGLAFDHTYFNDKLNQFLKEIKNHQKEYDESEKGSSKA--RYHAAY 291
           + K  NA+   R+L     D  + + K     +EI N QK  DE+E+ S +   +  A+ 
Sbjct: 560 LNKFENADEARRRL-----DKQFADAK-----REISNLQKSVDEAERNSRRTDDKLRASE 609

Query: 292 AH-IYWDLANDWVNGRVGDKSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLAS 350
           A  +  + A  ++   +      + ++ST+ A  + R    E    +  +   ++ +L  
Sbjct: 610 AERVAAEKARKFLEDELAKLQASFQKSSTDDARKL-RDEMDEHANSIQEEFKTRIDELNR 668

Query: 351 KVKADYHWAEIRHGNRFKAET---RLAYSTIANVANFTS---ELKQATVLARANAQEEKQ 404
           +++       +R  NR K+E    +  Y  + N  N T    + ++  +    + +   Q
Sbjct: 669 RIE-----NLLRENNRLKSEVNPLKDKYRDLENEYNSTQRRIDERETQIKYSDDIRRNIQ 723

Query: 405 RREQEAKEKADREKADKEAKEKADREKADKDL----QEKTPIKAEGDDF 449
           +   + +EK DR  +D E K   + E A K      Q+   IK + DD+
Sbjct: 724 KDLDDLREKYDRVHSDNE-KILGELEHAQKAAHLAEQQLKEIKIQRDDY 771


>gi|296473406|gb|DAA15521.1| myosin, heavy chain 11, smooth muscle [Bos taurus]
          Length = 1933

 Score = 38.9 bits (89), Expect = 6.0,   Method: Composition-based stats.
 Identities = 60/272 (22%), Positives = 119/272 (43%), Gaps = 31/272 (11%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE--ITHHTRRLVKEDPK-------RGKSESY 764
             E+ ++K   ++L    Q + ++    + E  I+  T  L +E+ K       + K ES 
Sbjct: 976  AEAKIKKLEDDILVMDDQNNKLSKERKLLEERISDLTTNLAEEEEKAKNLTKLKNKHESM 1035

Query: 765  LSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTIIS-------GSEKILQGD 816
            +S++   L+K  K+  ++ ++K +L G   D+ ++   L   I+         E+ LQ  
Sbjct: 1036 ISELEVRLKKEEKSRQELEKLKRKLDGEASDLHEQIAELQAQIAELKMQLAKKEEELQA- 1094

Query: 817  YTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAEV 876
                 L  LD +    ++  K      G  ++  ++E+      A  ++ K +  L  E+
Sbjct: 1095 ----ALGRLDDEMAQKNNALKKIRELEGHISD--LQEDLDSERAARNKAEKQKRDLGEEL 1148

Query: 877  ERLSGLAQQPSDSTADLKELQ-------TQLSRAKKYKESNDERIVSFIRSEFEREIKEL 929
            E L    +   DSTA  +EL+       T L +A   +  + E  V  +R +  + ++EL
Sbjct: 1149 EALKTELEDTLDSTATQQELRAKREQEVTMLKKALDEETRSHESQVQEMRQKHTQVVEEL 1208

Query: 930  KSVIEADAKENPNPNKNQKKLQKTREKLVAQL 961
               +E   +   N +KN++ L+K   +L  +L
Sbjct: 1209 TEQLEQFKRAKANLDKNKQALEKENAELAGEL 1240


>gi|52144448|ref|YP_082380.1| collagen-binding surface protein [Bacillus cereus E33L]
 gi|51977917|gb|AAU19467.1| collagen-binding surface protein [Bacillus cereus E33L]
          Length = 913

 Score = 38.9 bits (89), Expect = 6.0,   Method: Composition-based stats.
 Identities = 34/151 (22%), Positives = 61/151 (40%), Gaps = 11/151 (7%)

Query: 398 NAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVP 457
           N  EE ++  +E ++  +  +   E  EK   E  +   + + P    G++        P
Sbjct: 540 NPGEETEKPSEETEKPGEETEKPGEETEKPGEETEEPGEETEKP----GEE-----TEKP 590

Query: 458 THSVKLPPKEEEL--EEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKN 515
               + P +E E   EE +  G++ ++PG       EETE+  ++         K   + 
Sbjct: 591 GEETEKPGEETEKPGEETEKPGEETEKPGEETEKPGEETEKPGEETEKPGEETEKPGEET 650

Query: 516 ETPAIPTAKAPPAQAHKGIQDKKPQDQREKP 546
           E P   T K        G + +KP ++ EKP
Sbjct: 651 EKPGEETEKPGEETEKPGEETEKPGEETEKP 681


>gi|58698819|ref|ZP_00373696.1| hypothetical protein WwAna1798 [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225630188|ref|YP_002726979.1| hypothetical protein WRi_003880 [Wolbachia sp. wRi]
 gi|58534663|gb|EAL58785.1| hypothetical protein WwAna1798 [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225592169|gb|ACN95188.1| hypothetical protein WRi_003880 [Wolbachia sp. wRi]
          Length = 659

 Score = 38.9 bits (89), Expect = 6.0,   Method: Composition-based stats.
 Identities = 55/244 (22%), Positives = 97/244 (39%), Gaps = 24/244 (9%)

Query: 338 TYDQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARA 397
           T DQ+   RD   K K D         + F  ET       A  A    + K+A   A  
Sbjct: 55  TEDQVTDPRDQIEKEKKD---------DEFTRETLEECKNRAQKAE--DDAKKAVKRAED 103

Query: 398 NAQEEKQRREQEAKEKADREKAD-KEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSV 456
           +A    +R + +A+E+  R K D K+A+E+A+ +   K   E+   +A+G+         
Sbjct: 104 DAARAIKRAKDDAEEEIGRAKDDAKQARERAEEDAKAKKAAEEVAKQAQGE--------A 155

Query: 457 PTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNE 516
                +    EE  E +KD+ K+  E    +   ++  E   +     +  A +  TK E
Sbjct: 156 EEAKEQFTKCEENAERIKDDAKQAIERAEEDAKAKKAAEEVAKQAQGEAEEAKEQFTKCE 215

Query: 517 TPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEEN 576
                 A+     A + I+  K   + +   A     GE+  A  +  K EK+ +  +++
Sbjct: 216 E----NAERIKDDAKQAIERAKDDAKAKAAEAVKQAHGEAKEAKEQFAKCEKDAERIKDD 271

Query: 577 LRVA 580
            + A
Sbjct: 272 AKQA 275


>gi|330792784|ref|XP_003284467.1| hypothetical protein DICPUDRAFT_148219 [Dictyostelium purpureum]
 gi|325085610|gb|EGC39014.1| hypothetical protein DICPUDRAFT_148219 [Dictyostelium purpureum]
          Length = 717

 Score = 38.9 bits (89), Expect = 6.1,   Method: Composition-based stats.
 Identities = 38/126 (30%), Positives = 58/126 (46%), Gaps = 19/126 (15%)

Query: 374 AYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKAD 433
           +Y  I    +F + L  AT     N + EK+R E+E  EK   EK  KE KEKA++++ +
Sbjct: 133 SYPNIKRKMSFEN-LNDATTTLMENEKLEKERIEKERLEKELAEKQQKEIKEKAEKDRLE 191

Query: 434 KDLQEKTPI---KAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDD 490
           K+  EK  +   KAE D                  KE+  +E K++ +K +        +
Sbjct: 192 KERLEKERLEKEKAEKDRL---------------EKEKAQKEAKEKAEKDRLEKEKLEKE 236

Query: 491 REETER 496
           R E ER
Sbjct: 237 RLEKER 242


>gi|170115436|ref|XP_001888912.1| mycorrhiza-induced mitochondrial AAA ATPase BSC1 [Laccaria bicolor
           S238N-H82]
 gi|164636054|gb|EDR00353.1| mycorrhiza-induced mitochondrial AAA ATPase BSC1 [Laccaria bicolor
           S238N-H82]
          Length = 831

 Score = 38.9 bits (89), Expect = 6.1,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 17/80 (21%)

Query: 395 ARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLP 454
           A AN  E+    E+E +E+  REK  +E +EKA RE+  K+ Q K   K   +       
Sbjct: 676 AAANGVEDWVVSEREMRERLKREKEAREVREKALRERRKKEAQTKAEEKKTQEK------ 729

Query: 455 SVPTHSVKLPPKEEELEEVK 474
                      K+ ELE+VK
Sbjct: 730 -----------KDAELEKVK 738


>gi|182639272|sp|A8MU46|SMTL1_HUMAN RecName: Full=Smoothelin-like protein 1
          Length = 457

 Score = 38.9 bits (89), Expect = 6.1,   Method: Composition-based stats.
 Identities = 41/165 (24%), Positives = 72/165 (43%), Gaps = 16/165 (9%)

Query: 336 GVTYDQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFT-SELKQATVL 394
           G+   +++  R+   K  A+   AE++  +  K ET +    +      T SE K+A   
Sbjct: 72  GLDEVKVESQREAGGKEDAE---AELKKEDGEKEETTVGSQEMTGRKEETKSEPKEA--- 125

Query: 395 ARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLP 454
                 EEK+      K+KA+ ++A  E+ +KAD    DK  + K  ++ E         
Sbjct: 126 ------EEKESTLASEKQKAEEKEAKPESGQKADANDRDKP-EPKATVEEEDAKTASQEE 178

Query: 455 SVPTHSVKLPPKEEELEEVKDEGKK--GKEPGTTETDDREETERK 497
           +V     K  PKE + +E    G K    EPG+   +  ++ E++
Sbjct: 179 TVVEDEAKAEPKEPDGKEEAKHGAKEEADEPGSPSEEQEQDVEKE 223


>gi|156120901|ref|NP_001095597.1| myosin-11 [Bos taurus]
 gi|151554905|gb|AAI48030.1| MYH11 protein [Bos taurus]
          Length = 1972

 Score = 38.9 bits (89), Expect = 6.1,   Method: Composition-based stats.
 Identities = 60/272 (22%), Positives = 119/272 (43%), Gaps = 31/272 (11%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE--ITHHTRRLVKEDPK-------RGKSESY 764
             E+ ++K   ++L    Q + ++    + E  I+  T  L +E+ K       + K ES 
Sbjct: 976  AEAKIKKLEDDILVMDDQNNKLSKERKLLEERISDLTTNLAEEEEKAKNLTKLKNKHESM 1035

Query: 765  LSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTIIS-------GSEKILQGD 816
            +S++   L+K  K+  ++ ++K +L G   D+ ++   L   I+         E+ LQ  
Sbjct: 1036 ISELEVRLKKEEKSRQELEKLKRKLDGEASDLHEQIAELQAQIAELKMQLAKKEEELQA- 1094

Query: 817  YTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERSLKNQAHLNAEV 876
                 L  LD +    ++  K      G  ++  ++E+      A  ++ K +  L  E+
Sbjct: 1095 ----ALGRLDDEMAQKNNALKKIRELEGHISD--LQEDLDSERAARNKAEKQKRDLGEEL 1148

Query: 877  ERLSGLAQQPSDSTADLKELQ-------TQLSRAKKYKESNDERIVSFIRSEFEREIKEL 929
            E L    +   DSTA  +EL+       T L +A   +  + E  V  +R +  + ++EL
Sbjct: 1149 EALKTELEDTLDSTATQQELRAKREQEVTMLKKALDEETRSHESQVQEMRQKHTQVVEEL 1208

Query: 930  KSVIEADAKENPNPNKNQKKLQKTREKLVAQL 961
               +E   +   N +KN++ L+K   +L  +L
Sbjct: 1209 TEQLEQFKRAKANLDKNKQALEKENAELAGEL 1240


>gi|93009031|gb|ABE97924.1| nexilin [Danio rerio]
          Length = 748

 Score = 38.9 bits (89), Expect = 6.2,   Method: Composition-based stats.
 Identities = 33/107 (30%), Positives = 59/107 (55%), Gaps = 10/107 (9%)

Query: 399 AQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPT 458
           A+ EKQR+E+E K + D E+  + A+E  ++ K  K+L +K   + EGDD  L +  VP 
Sbjct: 109 AEMEKQRQEEERK-RTDEERKKRAAQEAIEKAKIQKELAKKA--EEEGDD-SLLVRVVPA 164

Query: 459 HSVKLPPK----EEELEEVKDE--GKKGKEPGTTETDDREETERKNQ 499
            S K P +     E++E+ ++E   K+ +E      D+   + R+++
Sbjct: 165 KSQKQPGRIKINFEDMEKSREEELKKRTEEEKMKRYDENRRSVRESK 211


>gi|15965621|ref|NP_385974.1| hypothetical protein SMc00141 [Sinorhizobium meliloti 1021]
 gi|15074802|emb|CAC46447.1| Hypothetical protein SMc00141 [Sinorhizobium meliloti 1021]
          Length = 671

 Score = 38.9 bits (89), Expect = 6.2,   Method: Composition-based stats.
 Identities = 27/107 (25%), Positives = 53/107 (49%), Gaps = 13/107 (12%)

Query: 395 ARANAQEEKQR---REQEAKEK-ADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFG 450
           A   A+EE  R   R+Q+A+E+ A  E A ++A+E+A R K  +   E+ P   E     
Sbjct: 48  APQQAEEEAPRRKKRQQQAEEQPAAEESAPQQAEEEAPRRKKRQQQAEEQPAAEE----- 102

Query: 451 LGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERK 497
               S P  + +  P+ ++ ++  +E    +E    + +++E T ++
Sbjct: 103 ----SAPQQAEEEAPRRKKRQQQAEEQPAAEESAPQQAEEQEPTRKR 145


>gi|237841341|ref|XP_002369968.1| hypothetical protein TGME49_021390 [Toxoplasma gondii ME49]
 gi|211967632|gb|EEB02828.1| hypothetical protein TGME49_021390 [Toxoplasma gondii ME49]
          Length = 814

 Score = 38.9 bits (89), Expect = 6.2,   Method: Composition-based stats.
 Identities = 46/213 (21%), Positives = 90/213 (42%), Gaps = 28/213 (13%)

Query: 385 TSELKQATVLARANAQE-EKQRREQEAKEKADREKADKEA-KEKADREKADKDLQEKTPI 442
           +S+ ++A+V   +N  E +K+R E+E+ E++   K+D E  KE++  E+AD D    T +
Sbjct: 78  SSDPREASVKTLSNENESDKERAEKESDEESVSAKSDSETEKEESQDERADSDASSDTDV 137

Query: 443 KAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDIL 502
                                  +  E E +K   K+  +   ++   RE   R +  + 
Sbjct: 138 -----------------------ERREPEAMKAVKKRESKRAESKATLREVVSRSDTSVS 174

Query: 503 DNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIK 562
             S  + K+ +     A  T+++  A +H+  Q     D  E     ++   E D A   
Sbjct: 175 AASYASQKSKSSTLQEAGTTSES--ALSHRSAQASVHADPNELKQRIEVLTKERDEAVQL 232

Query: 563 LTKKEKEL-QEQEENLRVAEIIQQSRMQSEDLQ 594
                 EL Q ++ N  + + + Q + + +DL+
Sbjct: 233 HQSVSAELEQARKTNASLVQELDQEKQKVQDLE 265


>gi|293390258|ref|ZP_06634592.1| translation initiation factor IF-2 [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290950792|gb|EFE00911.1| translation initiation factor IF-2 [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 830

 Score = 38.9 bits (89), Expect = 6.3,   Method: Composition-based stats.
 Identities = 47/208 (22%), Positives = 92/208 (44%), Gaps = 25/208 (12%)

Query: 400 QEEKQRREQEAKEKADR---EKADKEAKEKADREKADKDLQEKTPIKAEGDDFG-LGLPS 455
           +E+++  E E + KAD    +KA+++A++ A+  K   +L +     +  +D+    L S
Sbjct: 111 KEKRKAEEAELRRKADELACQKAEEQARKAAEEAKRYAELSDDNQHNSNTEDYSDYNLTS 170

Query: 456 VPTHSVKLPPKEEELEEVKDEGK----KGKEPGTTETDDREETERKNQDILDNSLLAGKT 511
             +++++   +EE   E +  GK    K K+ G    DD  + ER++       +  GK 
Sbjct: 171 --SYALEAEDEEERRNEGRGRGKNKVTKAKKGG--RDDDSNKNERESNRRNQKDVKGGKG 226

Query: 512 HTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGE-SDYAGIKLTKKEKEL 570
               +  A+  A   PAQA            R+  +   I V E ++   +K T+  K +
Sbjct: 227 KQAKKGSALQQAFTKPAQAV----------NRDVVIGETITVAELANKMAVKATEVIKTM 276

Query: 571 QEQEENLRVAEIIQQSRMQ--SEDLQEK 596
            +      + ++I Q   Q  +E++  K
Sbjct: 277 MKMGAMATINQVIDQETAQLVAEEMGHK 304


>gi|159122290|gb|EDP47412.1| vesicle-mediated transport protein (Imh1), putative [Aspergillus
           fumigatus A1163]
          Length = 1001

 Score = 38.9 bits (89), Expect = 6.3,   Method: Composition-based stats.
 Identities = 55/246 (22%), Positives = 100/246 (40%), Gaps = 27/246 (10%)

Query: 376 STIANVANFTSELKQATV--------LARANAQEEKQRREQEAKEKADREKADKEAKEKA 427
           ++IA+    T  L Q T+        L R   + +  +++ E  +K+ +E  D  A  K 
Sbjct: 23  TSIADPKALTEYLNQITLKGDMVIEELKRVTTERDDYKKKLEEAQKSTKEACDAVADLKK 82

Query: 428 DREKADKD----------LQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEG 477
           D+ +  K+           +++ P K E ++F      +P    +L  K+EE+E +K + 
Sbjct: 83  DKTQGAKEEKTASTEDTASKKELPAKEESEEFFSFDNELPRLESELKEKQEEVETLKSQV 142

Query: 478 KKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDK 537
           +  K         RE TE   Q+      L   T    E   I   +    +  K  +  
Sbjct: 143 ESLKRDLAVA---RESTEGMVQN------LESATRELVELRDIRDKQDSEIKKLKDTRQA 193

Query: 538 KPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKA 597
           +  D + K   S+  + ++     KL  + K+  E+ E L+     Q+   Q ++LQEK 
Sbjct: 194 EVDDVKAKLAESENTIAKAGEEAEKLKAELKQKTEEIEKLQDQVTQQKDNDQQKELQEKL 253

Query: 598 WDSYKE 603
            +  KE
Sbjct: 254 EEVAKE 259


>gi|169234928|ref|NP_001108405.1| titin1 [Bombyx mori]
 gi|18700459|dbj|BAB85197.1| Titin-like protein [Bombyx mori]
          Length = 3239

 Score = 38.9 bits (89), Expect = 6.3,   Method: Composition-based stats.
 Identities = 54/231 (23%), Positives = 95/231 (41%), Gaps = 30/231 (12%)

Query: 389 KQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDD 448
           ++  +L     QEE    + E     D  + +KE+KE+ D+ +     +   P   E   
Sbjct: 704 QKEVLLEHVKKQEEIDEEKIEQNVLKDVSETEKESKERGDKIQTKDTRKSSIPWTQE--- 760

Query: 449 FGLGLPSVPTHSVKLPPKEEELEEV------KDE--GKKGKEPGT---------TETDDR 491
               +   PT   KLP ++E+LE++      KD   G+K +E  T         TE  + 
Sbjct: 761 ---AIKLRPTKVEKLPMEKEKLEDITLKPIRKDSMLGEKPEEANTLRALVDKIHTEEQEL 817

Query: 492 EETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDI 551
           ++ ER  Q+I D  +   KT    E  A+P  +  P    +  +    ++   KP+    
Sbjct: 818 KDKERV-QEIRDEQM---KTDKPVED-AMPEERKWPTGKRRPKEATSQEEVVLKPVPKQK 872

Query: 552 GVGESDYAGIKL--TKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDS 600
              E     ++L   KKE + + +EE  +   +++    Q E  +EK   S
Sbjct: 873 EPEEEKPEEVQLKPVKKEGKRRPKEETPQEEVVLKPVPKQKEPEEEKPRSS 923


>gi|223043685|ref|ZP_03613729.1| lipase (Glycerol ester hydrolase) [Staphylococcus capitis SK14]
 gi|222442963|gb|EEE49064.1| lipase (Glycerol ester hydrolase) [Staphylococcus capitis SK14]
          Length = 785

 Score = 38.9 bits (89), Expect = 6.4,   Method: Composition-based stats.
 Identities = 45/230 (19%), Positives = 86/230 (37%), Gaps = 25/230 (10%)

Query: 390 QATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDF 449
           Q ++    N   E+Q  E E ++ A   +  K  +E+   EK       +   K+  +  
Sbjct: 96  QTSLHNENNQNTEQQDSETEEQDTAQNTEQTKSTEEQGKEEKTSAQDATQNSTKSSDEQV 155

Query: 450 GLGLPSVPTHSV---------KLPPKEEELEEVKD----EGKKGKEPGTT----ETDDRE 492
                S   +S          +   K E+ EE  D      +K  E  +T    E +  +
Sbjct: 156 ESSEDSQVDNSKEDAKQEDANQADSKSEQTEEQTDVQSQPTEKSDEDKSTQSKPEVNQNQ 215

Query: 493 ETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIG 552
           E+E+ + +  DN         K + P         + + K +Q     +Q+E  L+SD  
Sbjct: 216 ESEKDSSETQDN--------LKQDNPKTEDKTEEVSDSQKDLQKDTQNNQKEDDLSSDKE 267

Query: 553 VGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDSYK 602
             +SD A     K E E  + +++   ++   + +   +D +  A +  K
Sbjct: 268 TTQSDRAVKNQAKDETEASQTDKDQDQSQTATKPKASQQDKENDAEEQQK 317


>gi|70981913|ref|XP_746485.1| vesicle-mediated transport protein (Imh1) [Aspergillus fumigatus
           Af293]
 gi|66844108|gb|EAL84447.1| vesicle-mediated transport protein (Imh1), putative [Aspergillus
           fumigatus Af293]
          Length = 1001

 Score = 38.9 bits (89), Expect = 6.4,   Method: Composition-based stats.
 Identities = 55/246 (22%), Positives = 100/246 (40%), Gaps = 27/246 (10%)

Query: 376 STIANVANFTSELKQATV--------LARANAQEEKQRREQEAKEKADREKADKEAKEKA 427
           ++IA+    T  L Q T+        L R   + +  +++ E  +K+ +E  D  A  K 
Sbjct: 23  TSIADPKALTEYLNQITLKGDMVIEELKRVTTERDDYKKKLEEAQKSTKEACDAVADLKK 82

Query: 428 DREKADKD----------LQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEG 477
           D+ +  K+           +++ P K E ++F      +P    +L  K+EE+E +K + 
Sbjct: 83  DKTQGAKEEKTASTEDTASKKELPAKEESEEFFSFDNELPRLESELKEKQEEVETLKSQV 142

Query: 478 KKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDK 537
           +  K         RE TE   Q+      L   T    E   I   +    +  K  +  
Sbjct: 143 ESLKRDLAVA---RESTEGMVQN------LESATRELVELRDIRDKQDSEIKKLKDTRQA 193

Query: 538 KPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKA 597
           +  D + K   S+  + ++     KL  + K+  E+ E L+     Q+   Q ++LQEK 
Sbjct: 194 EVDDVKAKLAESENTIAKAGEEAEKLKAELKQKTEEIEKLQDQVTQQKDNDQQKELQEKL 253

Query: 598 WDSYKE 603
            +  KE
Sbjct: 254 EEVAKE 259


>gi|195978992|ref|YP_002124236.1| Emm-like cell surface protein CspZ.2 [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
 gi|195975697|gb|ACG63223.1| Emm-like cell surface protein CspZ.2 [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
          Length = 626

 Score = 38.5 bits (88), Expect = 6.5,   Method: Composition-based stats.
 Identities = 57/248 (22%), Positives = 117/248 (47%), Gaps = 33/248 (13%)

Query: 365 NRFKAETRLAYSTIANVAN-FTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEA 423
           NR   ++R A+ T++ ++N    +LK+A V  +   ++ K+    + K + D + A +E+
Sbjct: 151 NRELVKSREAHRTVSEISNELEKKLKRAIVDKKQAEEQAKKATAAKEKAEKDTKTAQQES 210

Query: 424 KEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEP 483
           ++   ++ A++   EK   ++E +   L        + KL    EE E+ K E +K K  
Sbjct: 211 EQA--KKAANQAETEKKKAESEANTAKLDSQRAQEEANKL---REEAEKAKQEAEKAKTA 265

Query: 484 GTTETDDRE-----------ETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHK 532
             T+    E           E E+K +++ ++S+       KN+T A    K   A   K
Sbjct: 266 LETQKQKLEQEIKQAQKSKTEAEQKLKELQESSM-------KNDTAAQQLKKEKEALETK 318

Query: 533 GIQDKKPQDQRE----KPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRM 588
            +QD + Q + +    + L  ++   + +    +L ++E++L+EQ    +V E ++Q  M
Sbjct: 319 -LQDLQKQAKEKSTEIEKLKQELEANKQNSG--QLGQQEQKLKEQLN--KVQEELKQKEM 373

Query: 589 QSEDLQEK 596
           + E  +E+
Sbjct: 374 ELEKAKEQ 381


>gi|328791967|ref|XP_392873.4| PREDICTED: intraflagellar transport protein 74 homolog [Apis
           mellifera]
          Length = 620

 Score = 38.5 bits (88), Expect = 6.6,   Method: Composition-based stats.
 Identities = 54/207 (26%), Positives = 93/207 (44%), Gaps = 28/207 (13%)

Query: 376 STIANVANFTSELKQATVLARANAQEEKQRREQ--EAKEKADREKADKEAKEKADREKAD 433
           S I N+     +L+Q     +   ++EK+R E+  ++ +   +EK D+  KEK   E+  
Sbjct: 209 SRIENMFEERKQLEQKLTKIQNQLEDEKKRTERLIDSMDSDTKEKYDELLKEKIKVEEKA 268

Query: 434 KDLQEKTPIKAEGDDF---GLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDD 490
            +LQ+K     +   +    + L  +   +VKL  K  E+EE +D   K KE        
Sbjct: 269 NELQQKLDELYKEQLYLEEEITLSPLKQEAVKLHLKIIEMEEKRD---KLKEEEKQRISP 325

Query: 491 REETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASD 550
            EE E+  Q I            K +   I  A+A  ++  K IQ+    +Q+ + L +D
Sbjct: 326 EEEKEKLLQKI------------KQDNMDIAAAEAQLSEKKKQIQE---TEQKLEQLEAD 370

Query: 551 IGVGESDYAGIKLTKKEKELQEQEENL 577
           I   +S+        K KEL+++EE +
Sbjct: 371 IEDTQSEK-----QIKYKELRKREETI 392


>gi|169624325|ref|XP_001805568.1| hypothetical protein SNOG_15420 [Phaeosphaeria nodorum SN15]
 gi|111055965|gb|EAT77085.1| hypothetical protein SNOG_15420 [Phaeosphaeria nodorum SN15]
          Length = 697

 Score = 38.5 bits (88), Expect = 6.6,   Method: Composition-based stats.
 Identities = 25/89 (28%), Positives = 43/89 (48%), Gaps = 5/89 (5%)

Query: 359 AEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARANAQEE--KQRREQEAKEKADR 416
           + +    R   E ++    +   A    +      +  +  Q+E  KQR + EA  KA+R
Sbjct: 279 SNVPESERIATENKMKAEALKTAAEQQRKRDADAKVTESKRQQEVIKQRIKDEADRKAER 338

Query: 417 EKADKEAKEKADREKADKDLQEKTPIKAE 445
           E+ +KE KE+A   K DK+L  +  ++AE
Sbjct: 339 ERHEKEVKERA---KIDKELFRRQELEAE 364


>gi|268567205|ref|XP_002639918.1| C. briggsae CBR-NMY-2 protein [Caenorhabditis briggsae]
          Length = 2000

 Score = 38.5 bits (88), Expect = 6.6,   Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 56/120 (46%), Gaps = 16/120 (13%)

Query: 863  ERSLKNQAH---------LNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDER 913
            E+ L+ QA          L  E E      ++  + TA L   +T+LS+       NDE 
Sbjct: 1053 EKHLRQQAENARRAADVLLREEQEACLEKTRKAEELTAQLMRKETELSQISM---KNDEE 1109

Query: 914  IVSFIRSEFEREIKELKSVIEADAKENPNPNK-NQKKLQKTREKLVAQLSSRLKELNIDN 972
            +   IR + EREI+E+++  + DA E  N  K  ++K +K R  +  +L S   EL   N
Sbjct: 1110 LA--IRQQLEREIREIRAQCD-DAVEELNKEKAARQKAEKARRDMAEELESYKAELEESN 1166


>gi|325973390|ref|YP_004250454.1| hypothetical protein MSU_0541 [Mycoplasma suis str. Illinois]
 gi|325989827|ref|YP_004249526.1| hypothetical protein Msui04790 [Mycoplasma suis KI3806]
 gi|323574912|emb|CBZ40572.1| hypothetical protein Msui04790 [Mycoplasma suis]
 gi|323651992|gb|ADX98074.1| hypothetical protein MSU_0541 [Mycoplasma suis str. Illinois]
          Length = 204

 Score = 38.5 bits (88), Expect = 6.6,   Method: Composition-based stats.
 Identities = 36/152 (23%), Positives = 69/152 (45%), Gaps = 15/152 (9%)

Query: 871  HLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIKELK 930
            +L    E L G     S+S + +KELQ +++  K+Y +     +      EF++ I+++K
Sbjct: 40   YLEENKENLKGKKIHLSESFSSIKELQEKINSVKEYLDGKTNSLDKLENQEFKKVIQDVK 99

Query: 931  SVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKELNIDNAYGLWNEYKEDFKASF-- 988
            S ++ +       N + KK      K +  LS+ L +   +    L +E  +D  + +  
Sbjct: 100  SWMDKEG------NSDTKKKFGEASKKIDDLSNFLGKKFAETPDELKHEQLQDLLSKYMK 153

Query: 989  EYPLGTYEPAIL-------GAMKDMDRLHPIY 1013
            +  +G   P IL        A K+++R HP +
Sbjct: 154  KEEVGNLTPFILPIVSAINEADKELNRKHPSF 185


>gi|8163682|gb|AAF73799.1|AF154030_1 surface protein PspC [Streptococcus pneumoniae]
          Length = 657

 Score = 38.5 bits (88), Expect = 6.6,   Method: Composition-based stats.
 Identities = 57/242 (23%), Positives = 107/242 (44%), Gaps = 49/242 (20%)

Query: 375 YSTIA-NVANFTSELKQATV-LARANAQEEKQR---REQEAKEKADREKADKEAKEKADR 429
           Y T+   +A    E+K+A + L +  A+E +     ++ EAK ++ + +A K  K K DR
Sbjct: 167 YKTLELEIAESDVEVKKADLKLLKEEAKESRDEGTIKQAEAKVESKKAEATKLEKIKTDR 226

Query: 430 EKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETD 489
           EKA+++ + +                      KL  + +  ++ K   K+    G   T 
Sbjct: 227 EKAEEEAKRRAGANCR----------------KLMLRLQGQDKPKGRAKRAV-LGEPATP 269

Query: 490 DREETERKNQDILDNSLLAGKTHTKNETPAIPTAK---------APPAQAHKGIQDKKPQ 540
           D++E + K+ D          +    ET   P+ K             +A K  +D+K +
Sbjct: 270 DKKENDAKSSD----------SSVGEETLPSPSLKPEKKVAEAEKKVEEAKKKAKDQKEE 319

Query: 541 DQREKPLAS----DIGVGESDYAGIKLTKKEKEL-QEQEENLRVAEIIQQSRMQSEDLQE 595
           D+R  P  +    ++ + ESD   +K+ + E EL +E+ +  R  E I+Q++ + E  Q 
Sbjct: 320 DRRNYPTNTYKTLELEIAESD---VKVKEAELELVKEEAKEPRDEEKIKQAKAEVESKQA 376

Query: 596 KA 597
           +A
Sbjct: 377 EA 378


>gi|332223675|ref|XP_003260996.1| PREDICTED: leucine-rich repeat-containing protein 16B [Nomascus
           leucogenys]
          Length = 1362

 Score = 38.5 bits (88), Expect = 6.7,   Method: Composition-based stats.
 Identities = 37/161 (22%), Positives = 76/161 (47%), Gaps = 20/161 (12%)

Query: 29  LTSIQDNIKHLREFI--IAWSSDLNPHKDRYDYIV---GPIEQRLKKVSERYERVVSRDL 83
           L  +QD + + R+ I     S  L P      +++   GP+ QRL+ V+    + V ++L
Sbjct: 698 LEPVQDELLYARDLIKDAKNSRALFPSLYELGHVLANDGPVRQRLESVASEVSKAVDKEL 757

Query: 84  TLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLLCRFMDMVETEDEHKINKQVRDA- 142
            +++E+ +   +E+     R+AE    +LS+ ++R+                   +R A 
Sbjct: 758 QVILESMVSLTQELCPVAMRVAEGHNKMLSNVAERVTVP-------------RNFIRGAL 804

Query: 143 LESAGFDLESTQENIR-KVESALINNNMKDAFRFLELAQKS 182
           LE AG D+++  + ++  V + L N+ + +  + L  + KS
Sbjct: 805 LEQAGQDIQNKLDEVKLSVVTYLTNSIVDEILQELYHSHKS 845


>gi|297297542|ref|XP_001103904.2| PREDICTED: leucine-rich repeat-containing protein 16B-like [Macaca
           mulatta]
          Length = 1350

 Score = 38.5 bits (88), Expect = 6.7,   Method: Composition-based stats.
 Identities = 37/161 (22%), Positives = 76/161 (47%), Gaps = 20/161 (12%)

Query: 29  LTSIQDNIKHLREFI--IAWSSDLNPHKDRYDYIV---GPIEQRLKKVSERYERVVSRDL 83
           L  +QD + + R+ I     S  L P      +++   GP+ QRL+ V+    + V ++L
Sbjct: 688 LEPVQDELLYARDLIKDAKNSRALFPSLYELGHVLANDGPVRQRLESVASEVSKAVDKEL 747

Query: 84  TLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLLCRFMDMVETEDEHKINKQVRDA- 142
            +++E+ +   +E+     R+AE    +LS+ ++R+                   +R A 
Sbjct: 748 QVILESMVSLTQELCPVAMRVAEGHNKMLSNVAERVTVP-------------RNFIRGAL 794

Query: 143 LESAGFDLESTQENIR-KVESALINNNMKDAFRFLELAQKS 182
           LE AG D+++  + ++  V + L N+ + +  + L  + KS
Sbjct: 795 LEQAGQDIQNKLDEVKLSVVTYLTNSIVDEILQELYHSHKS 835


>gi|296214602|ref|XP_002753698.1| PREDICTED: leucine-rich repeat-containing protein 16B [Callithrix
           jacchus]
          Length = 1372

 Score = 38.5 bits (88), Expect = 6.7,   Method: Composition-based stats.
 Identities = 37/161 (22%), Positives = 76/161 (47%), Gaps = 20/161 (12%)

Query: 29  LTSIQDNIKHLREFI--IAWSSDLNPHKDRYDYIV---GPIEQRLKKVSERYERVVSRDL 83
           L  +QD + + R+ I     S  L P      +++   GP+ QRL+ V+    + V ++L
Sbjct: 708 LEPVQDELLYARDLIKDAKNSRALFPSLYELGHVLANDGPVRQRLESVASEVSKAVDKEL 767

Query: 84  TLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLLCRFMDMVETEDEHKINKQVRDA- 142
            +++E+ +   +E+     R+AE    +LS+ ++R+                   +R A 
Sbjct: 768 QVILESMVSLTQELCPVAMRVAEGHNKMLSNVAERVTVP-------------RNFIRGAL 814

Query: 143 LESAGFDLESTQENIR-KVESALINNNMKDAFRFLELAQKS 182
           LE AG D+++  + ++  V + L N+ + +  + L  + KS
Sbjct: 815 LEQAGQDIQNKLDEVKLSVVTYLTNSIVDEILQELYHSHKS 855


>gi|167533485|ref|XP_001748422.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163773234|gb|EDQ86877.1| predicted protein [Monosiga brevicollis MX1]
          Length = 1007

 Score = 38.5 bits (88), Expect = 6.7,   Method: Composition-based stats.
 Identities = 60/294 (20%), Positives = 127/294 (43%), Gaps = 56/294 (19%)

Query: 339 YDQIKQ----LRDLASKVKADYHW---AEIRHGNRFK---AETRLAY-STIANVANFTSE 387
           Y+Q+++    LR    ++KA ++     E R  +RF+   AE    Y S + ++   +  
Sbjct: 391 YEQLEREAATLRIEVKRLKAQHNSQTSTEQREKSRFEEHTAELEQNYNSALDDIRRLSQR 450

Query: 388 LKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGD 447
           L+ + V  R   Q+E+ R ++EA+++ DR+     A ++ D  +A +  QE    +AE  
Sbjct: 451 LRDSEVALR-ELQDERTREQEEAQQQRDRDA----AVQREDVNRAHRLQQELDAARAE-- 503

Query: 448 DFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDD-REETERKNQDILDNSL 506
                               E L+++ +E ++ ++ G    D+ R ++ER     L   L
Sbjct: 504 -------------------NERLQQLFNEAQQRQQQGDLANDELRTKSER-----LQRQL 539

Query: 507 LAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKK 566
              + + + ++  +P+  AP  +    +  ++   +RE P            A     K 
Sbjct: 540 DEAQRNQRPQSSELPS-DAPTHEVKIHVTHEQEGKKREPPRG----------ASYSPLKD 588

Query: 567 EKELQEQEENLRVAE-IIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKY 619
             +L+     LR A+ ++   R+Q+  L++   +  +  +    DE +Q  ++Y
Sbjct: 589 RTQLETDPSTLREAQDMLADERVQNAQLKQDL-EMLRRSRERLDDEDQQLLERY 641


>gi|123492947|ref|XP_001326174.1| hypothetical protein [Trichomonas vaginalis G3]
 gi|121909085|gb|EAY13951.1| hypothetical protein TVAG_490890 [Trichomonas vaginalis G3]
          Length = 1042

 Score = 38.5 bits (88), Expect = 6.7,   Method: Composition-based stats.
 Identities = 43/205 (20%), Positives = 88/205 (42%), Gaps = 27/205 (13%)

Query: 385 TSELKQATVLARANAQEEKQRREQEA-KEKADREKADKEAKEKADREKADKDLQEKTPIK 443
           T  +K+ TV +     E++Q     + K+  + +K +   + +  +E+  + +QE T  +
Sbjct: 370 TEHVKEETVESVQETDEKQQENSSSSQKDNENEQKLENSQEPRTQKEEIAETIQEDTEKQ 429

Query: 444 AEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILD 503
            E ++            VK    +EE +E+ +  +   EP     ++  E E++NQ++ +
Sbjct: 430 QENNE-------TSPEPVKEEINDEEQKEISNSTQNELEP-----ENIPEQEQENQEVTE 477

Query: 504 N--SLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREK--------PLASDIGV 553
           +   L   KT ++N      T      +  +   DK+ ++ +E+        P  +    
Sbjct: 478 SVKELNQQKTESQNPEQEQNTENVQVNEEKQQDTDKETEENKEQTTTVTIETPQQNTTEN 537

Query: 554 GESDYAGIKLTKKEKELQEQEENLR 578
           GE +    K  KKEK  +E  E +R
Sbjct: 538 GEQE----KTIKKEKSKEELNEIMR 558


>gi|114652244|ref|XP_509860.2| PREDICTED: leucine-rich repeat-containing protein 16B [Pan
           troglodytes]
          Length = 1372

 Score = 38.5 bits (88), Expect = 6.7,   Method: Composition-based stats.
 Identities = 37/161 (22%), Positives = 76/161 (47%), Gaps = 20/161 (12%)

Query: 29  LTSIQDNIKHLREFI--IAWSSDLNPHKDRYDYIV---GPIEQRLKKVSERYERVVSRDL 83
           L  +QD + + R+ I     S  L P      +++   GP+ QRL+ V+    + V ++L
Sbjct: 708 LEPVQDELLYARDLIKDAKNSRALFPSLYELGHVLANDGPVRQRLESVASEVSKAVDKEL 767

Query: 84  TLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLLCRFMDMVETEDEHKINKQVRDA- 142
            +++E+ +   +E+     R+AE    +LS+ ++R+                   +R A 
Sbjct: 768 QVILESMVSLTQELCPVAMRVAEGHNKMLSNVAERVTVP-------------RNFIRGAL 814

Query: 143 LESAGFDLESTQENIR-KVESALINNNMKDAFRFLELAQKS 182
           LE AG D+++  + ++  V + L N+ + +  + L  + KS
Sbjct: 815 LEQAGQDIQNKLDEVKLSVVTYLTNSIVDEILQELYHSHKS 855


>gi|73962643|ref|XP_547741.2| PREDICTED: similar to CG1399-PB, isoform B [Canis familiaris]
          Length = 1154

 Score = 38.5 bits (88), Expect = 6.7,   Method: Composition-based stats.
 Identities = 37/161 (22%), Positives = 76/161 (47%), Gaps = 20/161 (12%)

Query: 29  LTSIQDNIKHLREFI--IAWSSDLNPHKDRYDYIV---GPIEQRLKKVSERYERVVSRDL 83
           L  +QD + + R+ I     S  L P      +++   GP+ QRL+ V+    + V ++L
Sbjct: 754 LEPVQDELLYARDLIKDAKNSRALFPSLYELGHVLANDGPVRQRLESVASEVSKAVDKEL 813

Query: 84  TLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLLCRFMDMVETEDEHKINKQVRDA- 142
            +++E+ +   +E+     R+AE    +LS+ ++R+                   +R A 
Sbjct: 814 QVILESMVSLTQELCPVAMRVAEGHNKMLSNVAERVTVP-------------RNFIRGAL 860

Query: 143 LESAGFDLESTQENIR-KVESALINNNMKDAFRFLELAQKS 182
           LE AG D+++  + ++  V + L N+ + +  + L  + KS
Sbjct: 861 LEQAGQDIQNKLDEVKLSVVTYLTNSIVDEILQELYHSHKS 901


>gi|66912205|ref|NP_001019816.1| leucine-rich repeat-containing protein 16B [Mus musculus]
 gi|172044636|sp|Q3UFQ8|LR16B_MOUSE RecName: Full=Leucine-rich repeat-containing protein 16B
 gi|162318420|gb|AAI57092.1| Leucine rich repeat containing 16B [synthetic construct]
 gi|162319116|gb|AAI56311.1| Leucine rich repeat containing 16B [synthetic construct]
          Length = 1375

 Score = 38.5 bits (88), Expect = 6.7,   Method: Composition-based stats.
 Identities = 37/161 (22%), Positives = 76/161 (47%), Gaps = 20/161 (12%)

Query: 29  LTSIQDNIKHLREFI--IAWSSDLNPHKDRYDYIV---GPIEQRLKKVSERYERVVSRDL 83
           L  +QD + + R+ I     S  L P      +++   GP+ QRL+ V+    + V ++L
Sbjct: 708 LEPVQDELLYARDLIKDAKNSRALFPSLYELGHVLANDGPVRQRLESVASEVSKAVDKEL 767

Query: 84  TLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLLCRFMDMVETEDEHKINKQVRDA- 142
            +++E+ +   +E+     R+AE    +LS+ ++R+                   +R A 
Sbjct: 768 QVILESMVSLTQELCPVAMRVAEGHNKMLSNVAERVTVP-------------RNFIRGAL 814

Query: 143 LESAGFDLESTQENIR-KVESALINNNMKDAFRFLELAQKS 182
           LE AG D+++  + ++  V + L N+ + +  + L  + KS
Sbjct: 815 LEQAGQDIQNKLDEVKLSVVTYLTNSIVDEILQELYHSHKS 855


>gi|74201795|dbj|BAE28502.1| unnamed protein product [Mus musculus]
          Length = 898

 Score = 38.5 bits (88), Expect = 6.7,   Method: Composition-based stats.
 Identities = 37/161 (22%), Positives = 76/161 (47%), Gaps = 20/161 (12%)

Query: 29  LTSIQDNIKHLREFI--IAWSSDLNPHKDRYDYIV---GPIEQRLKKVSERYERVVSRDL 83
           L  +QD + + R+ I     S  L P      +++   GP+ QRL+ V+    + V ++L
Sbjct: 708 LEPVQDELLYARDLIKDAKNSRALFPSLYELGHVLANDGPVRQRLESVASEVSKAVDKEL 767

Query: 84  TLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLLCRFMDMVETEDEHKINKQVRDA- 142
            +++E+ +   +E+     R+AE    +LS+ ++R+                   +R A 
Sbjct: 768 QVILESMVSLTQELCPVAMRVAEGHNKMLSNVAERVTVP-------------RNFIRGAL 814

Query: 143 LESAGFDLESTQENIR-KVESALINNNMKDAFRFLELAQKS 182
           LE AG D+++  + ++  V + L N+ + +  + L  + KS
Sbjct: 815 LEQAGQDIQNKLDEVKLSVVTYLTNSIVDEILQELYHSHKS 855


>gi|297679748|ref|XP_002817689.1| PREDICTED: mitotic spindle assembly checkpoint protein MAD1-like
           [Pongo abelii]
          Length = 689

 Score = 38.5 bits (88), Expect = 6.7,   Method: Composition-based stats.
 Identities = 26/93 (27%), Positives = 52/93 (55%), Gaps = 5/93 (5%)

Query: 403 KQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVK 462
           + ++ QEA +K    +A +EA+  AD E+  KDL++K  ++ +       + ++ +  V+
Sbjct: 197 QHKKCQEANQKIQELQASQEAR--ADHEQQIKDLEQKLSLQEQDAAI---VKNMKSELVR 251

Query: 463 LPPKEEELEEVKDEGKKGKEPGTTETDDREETE 495
           LP  E EL+++++E  + +E   T    +EE E
Sbjct: 252 LPRLERELKQLREESARLREMRETNGLLQEELE 284


>gi|198470934|ref|XP_001355443.2| GA13235 [Drosophila pseudoobscura pseudoobscura]
 gi|198145688|gb|EAL32502.2| GA13235 [Drosophila pseudoobscura pseudoobscura]
          Length = 6081

 Score = 38.5 bits (88), Expect = 6.7,   Method: Composition-based stats.
 Identities = 61/219 (27%), Positives = 87/219 (39%), Gaps = 24/219 (10%)

Query: 399  AQEEKQRREQEAKE-KADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVP 457
            A +E  R E  A+  K + EKA+   +  AD  KA     EK+P+ A+        P   
Sbjct: 3115 ASKEASRPESVAESLKDETEKAESRRESVADSVKAGSAKDEKSPLAAK----EASRPESV 3170

Query: 458  THSVK--LPPKEEELEEVKDEGKKGK---EPGTTETDDREETERKNQDILDNSLLAGKTH 512
              SVK  +   E   E V D  K G    E     + D    E   + + D    A KT 
Sbjct: 3171 AESVKDEIEKPESRRESVADSVKTGSAKDEKSPLASKDASRPESVAESVKDE---AKKTE 3227

Query: 513  TKNETPAIPTAKA------PPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKK 566
            ++ E+ A     A       P  + +  + +  QD+ +KP +    V ES   G   TK 
Sbjct: 3228 SRRESVAESLKAASAKDEKSPLSSKEASRPESVQDKADKPESRRESVAESVKLGS--TKD 3285

Query: 567  EKELQEQEENLR---VAEIIQQSRMQSEDLQEKAWDSYK 602
            EK      E  R   VAE ++    + E  +E A DS K
Sbjct: 3286 EKSPLASIEASRPESVAESVKDVTEKPESRRESAADSVK 3324


>gi|68071921|ref|XP_677874.1| hypothetical protein [Plasmodium berghei strain ANKA]
 gi|56498154|emb|CAH96758.1| conserved hypothetical protein [Plasmodium berghei]
          Length = 654

 Score = 38.5 bits (88), Expect = 6.7,   Method: Composition-based stats.
 Identities = 53/265 (20%), Positives = 114/265 (43%), Gaps = 21/265 (7%)

Query: 435 DLQEKTPIKAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREET 494
           +L+E    +++ D  G  L S  +HS +L     + +E K + +K KE       ++E+ 
Sbjct: 321 NLEEARVQESQKDGTGENLQSSKSHSNELQVNIRQSDEYKADVEKEKEDKANAEKEKEDK 380

Query: 495 ERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVG 554
               ++  DN+        + E  A    +   A   K  +DK    ++EK   +++   
Sbjct: 381 ANVEKEKEDNA----NVEKEKEDKANVEKEKDKANVEKEKEDKA-NVEKEKEDKANVEKE 435

Query: 555 ESDYAGIKLTKKEKELQEQEENLRVAEIIQQSRMQSE-----DLQEKAWDSYKEWKSLSP 609
           + + +G  +  + K+  +Q E +    ++    ++ +     DL +K  + YK    L+ 
Sbjct: 436 KEEASGDTIQNEHKKKMQQLEEVYQKALLDYKTIERQFNNIIDLTQKLTNEYKNVYFLTK 495

Query: 610 DEIKQRFQKYAKVFYRSYSPVDGSYKGTQESDKAINHFLDNDFGYYRIHNFL-----SQW 664
           +E    F++  K         +  ++   +SD  +N+ +   + YY I+NF+     S  
Sbjct: 496 NE----FEEICKKLEECKESGNILWQLKWQSD--VNNNIYGPYNYYDIYNFISLGIVSAA 549

Query: 665 SPLGLMYEKDELHGVEAVYQKLDVL 689
           +P+ L    +E   +E ++Q  D +
Sbjct: 550 NPILLRRVSNENKMLENIWQSYDTV 574


>gi|296201286|ref|XP_002747977.1| PREDICTED: myosin-10 [Callithrix jacchus]
          Length = 1776

 Score = 38.5 bits (88), Expect = 6.9,   Method: Composition-based stats.
 Identities = 70/300 (23%), Positives = 122/300 (40%), Gaps = 71/300 (23%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   E+L  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 776  AEAKIKKMEEEILLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 830

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTII-------SGSEK 811
            K E  +SD+   L+K  KT  ++ + K +L G   D+  +   L   I       +  E+
Sbjct: 831  KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKLQLAKKEE 890

Query: 812  ILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERS 865
             LQG      D T    ++L V  +  +  ++L E F                    E++
Sbjct: 891  ELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFES------------------EKA 932

Query: 866  LKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFERE 925
             +N+A             +Q  D + +L+ L+T+L        +  E     +R++ E+E
Sbjct: 933  SRNKAE------------KQKRDLSEELEALKTELEDTLDTTAAQQE-----LRTKREQE 975

Query: 926  IKELKSVIEADAKENPNPNKNQKKLQKTR-EKLVAQL--SSRLKELNIDNAYGLWNEYKE 982
            + ELK  +E + K +    ++ ++   T  E+L  QL  + R K     N  GL  + KE
Sbjct: 976  VAELKKALEEETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKE 1035


>gi|194853276|ref|XP_001968134.1| GG24702 [Drosophila erecta]
 gi|190660001|gb|EDV57193.1| GG24702 [Drosophila erecta]
          Length = 5592

 Score = 38.5 bits (88), Expect = 7.0,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 31/44 (70%), Gaps = 1/44 (2%)

Query: 397  ANAQEEKQRREQEAKEKADREKADKEAKEKADR-EKADKDLQEK 439
            A+  E+ QR E+E KE+ +++K +K+ +++ +R EK  K LQE+
Sbjct: 1925 ADKAEKNQRHEREKKERQEKDKREKDLRKQVEREEKERKALQEE 1968


>gi|22474513|dbj|BAC10618.1| Titin-like protein [Bombyx mori]
          Length = 2888

 Score = 38.5 bits (88), Expect = 7.0,   Method: Composition-based stats.
 Identities = 54/231 (23%), Positives = 95/231 (41%), Gaps = 30/231 (12%)

Query: 389 KQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDD 448
           ++  +L     QEE    + E     D  + +KE+KE+ D+ +     +   P   E   
Sbjct: 704 QKEVLLEHVKKQEEIDEEKIEQNVLKDVSETEKESKERGDKIQTKDTRKSSIPWTQE--- 760

Query: 449 FGLGLPSVPTHSVKLPPKEEELEEV------KDE--GKKGKEPGT---------TETDDR 491
               +   PT   KLP ++E+LE++      KD   G+K +E  T         TE  + 
Sbjct: 761 ---AIKLRPTKVEKLPMEKEKLEDITLKPIRKDSMLGEKPEEANTLRALVDKIHTEEQEL 817

Query: 492 EETERKNQDILDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDI 551
           ++ ER  Q+I D  +   KT    E  A+P  +  P    +  +    ++   KP+    
Sbjct: 818 KDKERV-QEIRDEQM---KTDKPVED-AMPEERKWPTGKRRPKEATSQEEVVLKPVPKQK 872

Query: 552 GVGESDYAGIKL--TKKEKELQEQEENLRVAEIIQQSRMQSEDLQEKAWDS 600
              E     ++L   KKE + + +EE  +   +++    Q E  +EK   S
Sbjct: 873 EPEEEKPEEVQLKPVKKEGKRRPKEETPQEEVVLKPVPKQKEPEEEKPRSS 923


>gi|158302411|ref|XP_321966.4| AGAP001194-PA [Anopheles gambiae str. PEST]
 gi|157012939|gb|EAA01819.4| AGAP001194-PA [Anopheles gambiae str. PEST]
          Length = 3956

 Score = 38.5 bits (88), Expect = 7.1,   Method: Composition-based stats.
 Identities = 39/139 (28%), Positives = 56/139 (40%), Gaps = 4/139 (2%)

Query: 406  REQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSVPTHSVKLPP 465
            +E+     A    ADK   EK++  KAD D +E  P  A         PS  +  +K   
Sbjct: 3119 KEESRPASAASGPADKALSEKSNELKAD-DKEESRPASAASGPADKA-PSEKSIDLKAET 3176

Query: 466  KEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGK--THTKNETPAIPTA 523
            KEE        G   K P     D + ET+ +++     S  A K  +   NE  A    
Sbjct: 3177 KEESRPASAASGPADKAPSEKSVDLKAETKEESRPASAASGPADKALSEKSNELKADDKE 3236

Query: 524  KAPPAQAHKGIQDKKPQDQ 542
            ++ PA A  G  DK P ++
Sbjct: 3237 ESRPASAASGPADKAPSEK 3255


>gi|308492319|ref|XP_003108350.1| hypothetical protein CRE_10024 [Caenorhabditis remanei]
 gi|308249198|gb|EFO93150.1| hypothetical protein CRE_10024 [Caenorhabditis remanei]
          Length = 485

 Score = 38.5 bits (88), Expect = 7.2,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 33/49 (67%)

Query: 400 QEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDD 448
           +E++ R+E+E K + +RE  D+  KE+ DR+++ K+ +++   + + +D
Sbjct: 350 REDRSRKEREDKSRKEREDRDRSRKEREDRDRSRKEREDRDRSRKDRED 398


>gi|291405064|ref|XP_002719031.1| PREDICTED: myosin heavy chain [Oryctolagus cuniculus]
          Length = 1976

 Score = 38.5 bits (88), Expect = 7.2,   Method: Composition-based stats.
 Identities = 69/300 (23%), Positives = 122/300 (40%), Gaps = 71/300 (23%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   E+L  + Q S      F+KE       I   + +L +E+ K       R 
Sbjct: 976  AEAKIKKMEEEILLLEDQNS-----KFLKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 1030

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTII-------SGSEK 811
            K E  +SD+   L+K  KT  ++ + K +L G   D+  +   L   I       +  E+
Sbjct: 1031 KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKIQLAKKEE 1090

Query: 812  ILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERS 865
             LQG      D T    ++L V  +  +  ++L E F                    E++
Sbjct: 1091 ELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFES------------------EKA 1132

Query: 866  LKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFERE 925
             +N+A             +Q  D + +L+ L+T+L        +  E     +R++ E+E
Sbjct: 1133 SRNKAE------------KQKRDLSEELEALKTELEDTLDTTAAQQE-----LRTKREQE 1175

Query: 926  IKELKSVIEADAKENPNPNKNQKKLQKTR-EKLVAQL--SSRLKELNIDNAYGLWNEYKE 982
            + ELK  +E + K +    ++ ++   T  E+L  QL  + R K     N  GL  + KE
Sbjct: 1176 VAELKKALEEETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKE 1235


>gi|253582580|ref|ZP_04859801.1| chromosomal replication initiator protein dnaA [Fusobacterium
           varium ATCC 27725]
 gi|251835450|gb|EES63990.1| chromosomal replication initiator protein dnaA [Fusobacterium
           varium ATCC 27725]
          Length = 596

 Score = 38.5 bits (88), Expect = 7.3,   Method: Composition-based stats.
 Identities = 59/265 (22%), Positives = 112/265 (42%), Gaps = 27/265 (10%)

Query: 719 RKHSFEVLSSKHQKSVIAVNNFIKEITHHTRRLVKEDPKRGKSESYLSDIRSELQKVNKT 778
           +K  + V  +K+ +  I    +IK  +     ++ +DP  G+   Y+S IR E       
Sbjct: 209 KKIYYRVTLNKNIRQKIKDKRYIKYNSKSLLEILTKDPIAGRIYKYISKIRYE------- 261

Query: 779 VMDIRIKLRLYGIFQDIPQEQPPLYTIISGSEKILQGDYTFPPLSSLDVQSKFDSSYSKL 838
            MD RI LR       IP +   +   ++ + +I Q  Y    +    V  + + ++  L
Sbjct: 262 SMDGRINLRTLAAI--IPLKTEQVTERVNKNGEIKQ--YILCRVKQ--VLKRIEKAFDVL 315

Query: 839 FEIFY-GDWTNNAIKEE-RYWTIYAFERSLKNQAHLNAEVERLSG----------LAQQP 886
            E+ Y   + +  +KEE  Y+  Y F +    + H+++ +E  +G          LA + 
Sbjct: 316 VEMGYIIQYNSEYVKEEDNYYINYIFNKEKDGECHVSSFLENKTGRDMGRKRPAALAAKN 375

Query: 887 SDSTADLKELQ-TQLSRAKKYKESNDERIVSFIRSEFEREIKELKSVIEADAKENPNPNK 945
           +    D + ++ T   +  K +  + E  V F     ER  K  +++    A +    NK
Sbjct: 376 NLEIEDAEVIEHTSREKISKPETKHKEPAVEFPEGIIERVQKAKRNIYVQRAWDRRTDNK 435

Query: 946 NQKKLQKTREKLVAQLSSRL-KELN 969
            +K  ++  E +  ++ S L K LN
Sbjct: 436 IKKIYREEGEAIAKEVLSILYKNLN 460


>gi|309359375|emb|CAP33058.2| CBR-LFI-1 protein [Caenorhabditis briggsae AF16]
          Length = 2488

 Score = 38.5 bits (88), Expect = 7.3,   Method: Composition-based stats.
 Identities = 79/349 (22%), Positives = 148/349 (42%), Gaps = 50/349 (14%)

Query: 129 TEDEHKINKQVRDALESAGFDLESTQENIRKVESALINNNMK-----DAFRFL-ELAQKS 182
           T+ E  I + +   LES G D    Q  I ++E+ L  N  K      A + L E+AQ S
Sbjct: 559 TKYEESIERNIE--LESKGDD---AQRKIAELEAELRRNREKLNEHQSALKKLHEMAQDS 613

Query: 183 KETADSHI-IEAIDVGTKLKENTPPTTFTSISKVLL--KSNNMQD------VVFTKIKEV 233
           ++  D  + I+     +  K   PP+      +     K N++Q       +  ++ KE 
Sbjct: 614 EKNVDGTVSIKRTRSLSPGKTPLPPSEALRAVRNTFRNKDNDIQQLERKLKIAESQAKEF 673

Query: 234 VKKHVNAELGHRKLRGLAFDHTYFNDKLNQFLKEIKNHQKEYDESEKGSSKA--RYHAAY 291
           + K  NA+   R+L          + +L    +EI N QK +DE+E+ S +   +  A+ 
Sbjct: 674 LNKFENADEARRRL----------DKQLADAKREISNLQKSFDETERTSRRTEDKLRASE 723

Query: 292 AH-IYWDLANDWVNGRVGDKSDEWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLAS 350
           A  +  + A  ++   +      + +++T+ A  + R    E    +  +   ++ +L  
Sbjct: 724 AERVAAEKARKFLEDELAKLQASFQKSTTDDARKL-RDEMDEHTNSIQEEFKTRIDELNR 782

Query: 351 KVKADYHWAEIRHGNRFKAET---RLAYSTIANVANFTS---ELKQATVLARANAQEEKQ 404
           +++       +R  NR K+E    +  Y  + N  N T    E ++  +    + ++  Q
Sbjct: 783 RIE-----NLLRENNRLKSEVNPLKDKYRDLENEYNSTQRRIEERETQLRYADDIRKNIQ 837

Query: 405 RREQEAKEKADREKADKEAKEKADREKADKDL----QEKTPIKAEGDDF 449
           +   + +EK DR  +D E K   + E A K      Q+   IK + DD+
Sbjct: 838 KDLDDLREKYDRVYSDNE-KILGELEHAQKAAHLAEQQLKEIKIQRDDY 885


>gi|255079650|ref|XP_002503405.1| hypothetical protein MICPUN_113349 [Micromonas sp. RCC299]
 gi|226518671|gb|ACO64663.1| hypothetical protein MICPUN_113349 [Micromonas sp. RCC299]
          Length = 658

 Score = 38.5 bits (88), Expect = 7.4,   Method: Composition-based stats.
 Identities = 56/236 (23%), Positives = 102/236 (43%), Gaps = 35/236 (14%)

Query: 368 KAETRLAYSTIANVANFTSE----LKQATVLARANAQEEKQRRE--------------QE 409
           +AE R   S IA +  +  E    L++ T  AR +  EE Q+++              +E
Sbjct: 125 EAEVRREKSRIAELEAYYKEKVERLQKQTDDARFSKDEELQKQKDDFLVLERQLVRQLEE 184

Query: 410 AKEKADREKADKEAKEKADREKADKDLQEKTP-IKAEGDDFGLGLPSVPTHSVKLPPKEE 468
            K+  + ++AD  A+     ++A+++ +E    ++AE       L      S+ L     
Sbjct: 185 QKQLLEAQRADMHAQVAERGKRAEEEAKEPIARLQAE-------LHQEKAQSLALAG--- 234

Query: 469 ELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGK--THTKNETPAIP--TAK 524
           ELE  + E +  K+      DD+ E ER+  D  +  +   +     K+E  A+   TA 
Sbjct: 235 ELEAAQAESQGFKDEIQAAVDDKREAEREAADCRERVVAVEELLASMKSELDAVKEFTAT 294

Query: 525 APPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKE--LQEQEENLR 578
              A      +    Q ++E+ LA+ +   + + A ++   KE E  L+  EE+LR
Sbjct: 295 EKAAVVEADAEAVNAQREKERELATTVQDQKDEIAQLRRKVKELEASLESAEESLR 350


>gi|293342085|ref|XP_002725151.1| PREDICTED: similar to hypothetical protein [Rattus norvegicus]
 gi|293353833|ref|XP_002728329.1| PREDICTED: leucine-rich repeat-containing protein 16B [Rattus
           norvegicus]
          Length = 1374

 Score = 38.5 bits (88), Expect = 7.5,   Method: Composition-based stats.
 Identities = 37/161 (22%), Positives = 76/161 (47%), Gaps = 20/161 (12%)

Query: 29  LTSIQDNIKHLREFI--IAWSSDLNPHKDRYDYIV---GPIEQRLKKVSERYERVVSRDL 83
           L  +QD + + R+ I     S  L P      +++   GP+ QRL+ V+    + V ++L
Sbjct: 708 LEPVQDELLYARDLIKDAKNSRALFPSLCELGHVLANDGPVRQRLESVASEVSKAVDKEL 767

Query: 84  TLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLLCRFMDMVETEDEHKINKQVRDA- 142
            +++E+ +   +E+     R+AE    +LS+ ++R+                   +R A 
Sbjct: 768 QVILESMVSLTQELCPVAMRVAEGHNKMLSNVAERVTVP-------------RNFIRGAL 814

Query: 143 LESAGFDLESTQENIR-KVESALINNNMKDAFRFLELAQKS 182
           LE AG D+++  + ++  V + L N+ + +  + L  + KS
Sbjct: 815 LEQAGQDIQNKLDEVKLSVVTYLTNSIVDEILQELYHSHKS 855


>gi|221504461|gb|EEE30134.1| conserved hypothetical protein [Toxoplasma gondii VEG]
          Length = 814

 Score = 38.5 bits (88), Expect = 7.5,   Method: Composition-based stats.
 Identities = 46/213 (21%), Positives = 90/213 (42%), Gaps = 28/213 (13%)

Query: 385 TSELKQATVLARANAQE-EKQRREQEAKEKADREKADKEA-KEKADREKADKDLQEKTPI 442
           +S+ ++A+V   +N  E +K+R E+E+ E++   K+D E  KE++  E+AD D    T +
Sbjct: 78  SSDPREASVKTLSNENESDKERAEKESDEESVSAKSDSETEKEESQDERADSDASSDTDV 137

Query: 443 KAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDIL 502
                                  +  E E +K   K+  +   ++   RE   R +  + 
Sbjct: 138 -----------------------ERREPEAMKAVRKRESKRAESKATLREVVSRSDTSVS 174

Query: 503 DNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIK 562
             S  + K+ +     A  T+++  A +H+  Q     D  E     ++   E D A   
Sbjct: 175 AASYASQKSKSSTLQEAGTTSES--ALSHRSAQASVHADPNELKQRIEVLTKERDEAVQL 232

Query: 563 LTKKEKEL-QEQEENLRVAEIIQQSRMQSEDLQ 594
                 EL Q ++ N  + + + Q + + +DL+
Sbjct: 233 HQSVSAELEQARKTNASLVQELDQEKQKVQDLE 265


>gi|211828753|gb|AAH83918.2| LOC361041 protein [Rattus norvegicus]
          Length = 689

 Score = 38.5 bits (88), Expect = 7.5,   Method: Composition-based stats.
 Identities = 37/161 (22%), Positives = 76/161 (47%), Gaps = 20/161 (12%)

Query: 29  LTSIQDNIKHLREFI--IAWSSDLNPHKDRYDYIV---GPIEQRLKKVSERYERVVSRDL 83
           L  +QD + + R+ I     S  L P      +++   GP+ QRL+ V+    + V ++L
Sbjct: 24  LEPVQDELLYARDLIKDAKNSRALFPSLCELGHVLANDGPVRQRLESVASEVSKAVDKEL 83

Query: 84  TLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLLCRFMDMVETEDEHKINKQVRDA- 142
            +++E+ +   +E+     R+AE    +LS+ ++R+                   +R A 
Sbjct: 84  QVILESMVSLTQELCPVAMRVAEGHNKMLSNVAERVTVP-------------RNFIRGAL 130

Query: 143 LESAGFDLESTQENIR-KVESALINNNMKDAFRFLELAQKS 182
           LE AG D+++  + ++  V + L N+ + +  + L  + KS
Sbjct: 131 LEQAGQDIQNKLDEVKLSVVTYLTNSIVDEILQELYHSHKS 171


>gi|172045960|sp|Q5XHY1|LR16B_RAT RecName: Full=Leucine-rich repeat-containing protein 16B
          Length = 1373

 Score = 38.5 bits (88), Expect = 7.5,   Method: Composition-based stats.
 Identities = 37/161 (22%), Positives = 76/161 (47%), Gaps = 20/161 (12%)

Query: 29  LTSIQDNIKHLREFI--IAWSSDLNPHKDRYDYIV---GPIEQRLKKVSERYERVVSRDL 83
           L  +QD + + R+ I     S  L P      +++   GP+ QRL+ V+    + V ++L
Sbjct: 708 LEPVQDELLYARDLIKDAKNSRALFPSLCELGHVLANDGPVRQRLESVASEVSKAVDKEL 767

Query: 84  TLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLLCRFMDMVETEDEHKINKQVRDA- 142
            +++E+ +   +E+     R+AE    +LS+ ++R+                   +R A 
Sbjct: 768 QVILESMVSLTQELCPVAMRVAEGHNKMLSNVAERVTVP-------------RNFIRGAL 814

Query: 143 LESAGFDLESTQENIR-KVESALINNNMKDAFRFLELAQKS 182
           LE AG D+++  + ++  V + L N+ + +  + L  + KS
Sbjct: 815 LEQAGQDIQNKLDEVKLSVVTYLTNSIVDEILQELYHSHKS 855


>gi|156059058|ref|XP_001595452.1| hypothetical protein SS1G_03541 [Sclerotinia sclerotiorum 1980]
 gi|154701328|gb|EDO01067.1| hypothetical protein SS1G_03541 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 1296

 Score = 38.5 bits (88), Expect = 7.5,   Method: Composition-based stats.
 Identities = 57/233 (24%), Positives = 93/233 (39%), Gaps = 29/233 (12%)

Query: 340 DQIKQLRDLASKV--KADYHWAEIRHGNR--FKAETRLAYSTIANVANFTSELKQATVLA 395
           DQ+   +   +K   + +   AEI + N+  FK          AN      ++KQ   L 
Sbjct: 101 DQLMNQKTYVTKALERLERRTAEILYRNQQWFKWVRECQDDEEANREKEQKKVKQEAQLW 160

Query: 396 RANAQ------EEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEGDDF 449
           + N +      EEK RRE++ K+    EK  KE  ++ +  +   D  E  PI+ E +D 
Sbjct: 161 QRNWKQAKPRMEEKMRREEKKKQDTFLEKVYKEKMKEVEENEGTDDDMEWDPIEDELEDG 220

Query: 450 GLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDRE----ETERKNQDILDNS 505
                 +  H + +       EE+  E  K  +P + E D  +      E + Q I  NS
Sbjct: 221 RENFIDLMRHFLWM----SSEEELTTEESKMDKPPSNEIDKNDLIENNVESQEQTIDTNS 276

Query: 506 LLAGKTHTKNETPAI----------PTAKAPPAQAHKGIQDK-KPQDQREKPL 547
           L    +  ++ T +           P    PP+Q  K  +   KPQ+  +K L
Sbjct: 277 LDELVSQIESSTISKKSKKKKKKNGPATTTPPSQTTKASKSTAKPQELPDKSL 329


>gi|149063960|gb|EDM14230.1| rCG23421, isoform CRA_c [Rattus norvegicus]
          Length = 287

 Score = 38.5 bits (88), Expect = 7.5,   Method: Composition-based stats.
 Identities = 37/161 (22%), Positives = 76/161 (47%), Gaps = 20/161 (12%)

Query: 29  LTSIQDNIKHLREFI--IAWSSDLNPHKDRYDYIV---GPIEQRLKKVSERYERVVSRDL 83
           L  +QD + + R+ I     S  L P      +++   GP+ QRL+ V+    + V ++L
Sbjct: 79  LEPVQDELLYARDLIKDAKNSRALFPSLCELGHVLANDGPVRQRLESVASEVSKAVDKEL 138

Query: 84  TLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLLCRFMDMVETEDEHKINKQVRDA- 142
            +++E+ +   +E+     R+AE    +LS+ ++R+                   +R A 
Sbjct: 139 QVILESMVSLTQELCPVAMRVAEGHNKMLSNVAERVTVP-------------RNFIRGAL 185

Query: 143 LESAGFDLESTQENIR-KVESALINNNMKDAFRFLELAQKS 182
           LE AG D+++  + ++  V + L N+ + +  + L  + KS
Sbjct: 186 LEQAGQDIQNKLDEVKLSVVTYLTNSIVDEILQELYHSHKS 226


>gi|157875544|ref|XP_001686160.1| hypothetical protein [Leishmania major strain Friedlin]
 gi|68129234|emb|CAJ07774.1| conserved hypothetical protein [Leishmania major strain Friedlin]
          Length = 3167

 Score = 38.5 bits (88), Expect = 7.5,   Method: Composition-based stats.
 Identities = 58/230 (25%), Positives = 103/230 (44%), Gaps = 41/230 (17%)

Query: 399  AQEEKQRREQE---AKEKADREKADKE-------------AKEKADREKADKDLQEKTPI 442
            AQEE +R   E   A+E+A+R+KADKE              K  AD EKA++D + +   
Sbjct: 1495 AQEEAERLAAELEKAQEEAERQKADKERLAAELDRAQEEAEKLAADLEKAEEDAERQ--- 1551

Query: 443  KAEGDDFGLGLPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDI- 501
            KA+ +            + +L   +EE E +  + +K +E       D E  +  N+ + 
Sbjct: 1552 KADNERL----------AAELNRAQEEAERLAADLEKAEE-------DAERQKADNRRLA 1594

Query: 502  LDNSLLAGKTHTKNETPAIPTAKAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGI 561
             DN  LA +     E      A+   AQ      +++  D+       D    E++    
Sbjct: 1595 ADNERLAAELERAQEEAERLAAELEKAQEEA---ERQKADKERLAAELDRAQEEAEKLAA 1651

Query: 562  KLTKKEKELQEQE-ENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPD 610
             L K E+E + Q+ EN R+A  +++++ ++E L  +   + +E + L+ D
Sbjct: 1652 DLEKAEEEAERQKAENRRLAAELERAQEEAERLAAELDRAQEEAEKLAAD 1701


>gi|73965997|ref|XP_862981.1| PREDICTED: similar to SWI/SNF-related matrix-associated
           actin-dependent regulator of chromatin e1 isoform 7
           [Canis familiaris]
          Length = 341

 Score = 38.5 bits (88), Expect = 7.5,   Method: Composition-based stats.
 Identities = 45/209 (21%), Positives = 87/209 (41%), Gaps = 31/209 (14%)

Query: 341 QIKQLRDLASKVKADYHWAEIRH---GNRFKAETRLAYSTIANVANFTSELKQATVLARA 397
           Q++ L     K++A+    E RH     +F   T    + +  +     E+    + A  
Sbjct: 160 QVQSLMVHQRKLEAELLQIEERHQEKKRKFLESTDSFNNELKRLCGLKVEVDMEKIAAEI 219

Query: 398 NAQEEKQRREQEAKEKADREKADK-EAKEKADREKADKDLQEKTPIKAEGDDFGLGLPSV 456
              EE+ R+ QE +EK   E+A++ ++    + E A    QEK       DD        
Sbjct: 220 AQAEEQARKRQEEREKEAAEQAERSQSSMVPEEEPAASKTQEKK------DD-------- 265

Query: 457 PTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNE 516
              S+ +  +E  LEE  +  + G+E GT+  +D+E  +     + +       T +++ 
Sbjct: 266 --ESIPMETEETHLEEATESQQNGEE-GTSTPEDKESGQEGVDSMAEEGTSDSNTGSESN 322

Query: 517 TPAIPTAKAPPAQAHKGIQDKKPQDQREK 545
           +    T + PP        D  P+D++++
Sbjct: 323 S---ATVEEPPT-------DPTPEDEKKE 341


>gi|148694126|gb|EDL26073.1| solute carrier family 24 (sodium/potassium/calcium exchanger),
           member 1 [Mus musculus]
          Length = 880

 Score = 38.5 bits (88), Expect = 7.6,   Method: Composition-based stats.
 Identities = 31/109 (28%), Positives = 54/109 (49%), Gaps = 5/109 (4%)

Query: 397 ANAQEEKQRREQEAKEKADREKADKEAKEKADREKAD----KDLQEKTPIKAEGDDFGLG 452
           A  +E++Q  E EA+ K D ++ + EA+ K ++E       K+ +++   +AEG +   G
Sbjct: 770 AEGKEDEQEGETEAEGKKDEQEGETEAEGKEEQEGETEAEGKEDEQEGETEAEGKEEQEG 829

Query: 453 LPSVPTHSVKLPPKEEELEEVKDEGKKGKEPGTTETDDRE-ETERKNQD 500
                +  V+   + E   + K EG+   +P  TE  D E ETE   +D
Sbjct: 830 ETEAESKEVEQERETEAEGKDKHEGQGETQPDDTEVKDGEGETEANAED 878


>gi|311268379|ref|XP_003132027.1| PREDICTED: myosin-10, partial [Sus scrofa]
          Length = 1861

 Score = 38.5 bits (88), Expect = 7.6,   Method: Composition-based stats.
 Identities = 68/304 (22%), Positives = 122/304 (40%), Gaps = 84/304 (27%)

Query: 714  GESSVRKHSFEVLSSKHQKSVIAVNNFIKE-------ITHHTRRLVKEDPK-------RG 759
             E+ ++K   E+L  + Q S      FIKE       I   + +L +E+ K       R 
Sbjct: 861  AEAKIKKMEEEILLLEDQNS-----KFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRN 915

Query: 760  KSESYLSDIRSELQKVNKTVMDI-RIKLRLYGIFQDIPQEQPPLYTII-------SGSEK 811
            K E  +SD+   L+K  KT  ++ + K +L G   D+  +   L   I       +  E+
Sbjct: 916  KQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKIQVAKKEE 975

Query: 812  ILQG------DYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYWTIYAFERS 865
             LQG      D T    ++L V  +  +  ++L E F                    E++
Sbjct: 976  ELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFES------------------EKA 1017

Query: 866  LKNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFERE 925
             +N+A             +Q  D + +L+ L+T+L        +  E     +R++ E+E
Sbjct: 1018 SRNKAE------------KQKRDLSEELEALKTELEDTLDTTAAQQE-----LRTKREQE 1060

Query: 926  IKELKSVIEADAKENPNPNKNQKKLQKTREKLVAQLSSRLKELNIDNAYGLWNEYKEDFK 985
            + ELK  +E + K       ++ ++Q  R++  A L    ++L          E  + FK
Sbjct: 1061 VAELKKALEEETK------NHEAQIQDMRQRHAAALEELSEQL----------EQAKRFK 1104

Query: 986  ASFE 989
            A+ E
Sbjct: 1105 ANLE 1108


>gi|194763773|ref|XP_001964007.1| GF21330 [Drosophila ananassae]
 gi|190618932|gb|EDV34456.1| GF21330 [Drosophila ananassae]