RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= gi|254781206|ref|YP_003065619.1| hypothetical protein
CLIBASIA_05565 [Candidatus Liberibacter asiaticus str. psy62]
         (1246 letters)



>1few_A Second mitochondria-derived activator of caspases; SMAC,
           diablo, apoptosis, caspase activation, IAP inhibition;
           2.20A {Homo sapiens} (A:)
          Length = 184

 Score = 31.9 bits (72), Expect = 0.50
 Identities = 9/66 (13%), Positives = 17/66 (25%), Gaps = 3/66 (4%)

Query: 380 NVANFTSELKQA-TVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQE 438
                      A   +     Q E+  +     E    E   +E K+K    +  ++  E
Sbjct: 117 YQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELKQKTQ--EEGEERAE 174

Query: 439 KTPIKA 444
                 
Sbjct: 175 SEQEAY 180


>2qag_C Septin-7; cell cycle, cell division, GTP-binding,
           nucleotide-binding, phosphorylation, acetylation,
           alternative splicing, coiled coil; HET: GDP GTP; 4.00A
           {Homo sapiens} (C:)
          Length = 418

 Score = 31.1 bits (68), Expect = 0.78
 Identities = 12/100 (12%), Positives = 31/100 (31%)

Query: 339 YDQIKQLRDLASKVKADYHWAEIRHGNRFKAETRLAYSTIANVANFTSELKQATVLARAN 398
             Q+++ R               +       E                E  +  + A+  
Sbjct: 317 LAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHK 376

Query: 399 AQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQE 438
             EEK+R+ ++ K   + ++   E +  +   + +K   +
Sbjct: 377 ELEEKRRQFEDEKANWEAQQRILEQQNSSRTLEKNKKKGK 416


>1vq8_G Acidic ribosomal protein P0 homolog; ribosome 50S,
           protein-protein complex, RNA-RNA complex, protein-RNA
           complex, peptidyl transferase reaction; HET: 1MA OMU OMG
           UR3 PSU SPS; 2.20A {Haloarcula marismortui} (G:)
          Length = 348

 Score = 31.2 bits (70), Expect = 0.84
 Identities = 21/126 (16%), Positives = 40/126 (31%), Gaps = 10/126 (7%)

Query: 313 EWARTSTNIASWIGRITRTEGLGGVTYDQIKQLRDLASKVKADYHWAEI---RHGNRFKA 369
             A  + N++      T       +        + LA  ++A     E+          A
Sbjct: 221 AAAGRAFNLSVNADYPTA-TTAPTMLQSDRGNAKSLA--LQAAIEDPEVVPDLVSKA-DA 276

Query: 370 ETRLAYSTIANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADR 429
           + R   S I +      EL+            + Q  +  +++      AD  A+E  D 
Sbjct: 277 QVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD---ADADDAAEEADDD 333

Query: 430 EKADKD 435
           +  D+D
Sbjct: 334 DDDDED 339


>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-;
           fatty acid synthase, acyl-carrier-protein, beta-ketoacyl
           reductase, beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae} (A:1221-1330,A:1541-1688)
          Length = 258

 Score = 30.6 bits (69), Expect = 1.2
 Identities = 10/52 (19%), Positives = 19/52 (36%), Gaps = 3/52 (5%)

Query: 882 LAQQPSDSTADLKELQTQLSRAKK--YKESNDERIVSFIRSEFEREIKELKS 931
            AQ       +L+ L+ +          E   ER    I +E E +++  + 
Sbjct: 37  EAQIKDWVENELEALKLEAEEIPSEDQNEFLLER-TREIHNEAESQLRAAQQ 87



 Score = 30.2 bits (68), Expect = 1.3
 Identities = 20/101 (19%), Positives = 35/101 (34%), Gaps = 26/101 (25%)

Query: 64  IEQRLKKVSERYERVVSRDLTLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLLCRF 123
           +  R  ++ +  E           E  L+ LK   + +            D+++ LL R 
Sbjct: 33  LVTREAQIKDWVEN----------E--LEALKLEAEEIPS---------EDQNEFLLERT 71

Query: 124 MDMVETEDEHKINKQVRDALESAGFDLESTQENIRKVESAL 164
            + +  E E     Q+R A +  G D       I  +  AL
Sbjct: 72  RE-IHNEAE----SQLRAAQQQWGNDFYKRDPRIAPLRGAL 107



 Score = 27.5 bits (61), Expect = 9.9
 Identities = 11/77 (14%), Positives = 24/77 (31%), Gaps = 17/77 (22%)

Query: 576 NLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAKVFYRSYSPVDGSYK 635
             R A+I      + E L+        E + +  ++  +   +  +  +           
Sbjct: 34  VTREAQIKDWVENELEALKL-------EAEEIPSEDQNEFLLERTREIHNEAE------- 79

Query: 636 GTQESDKAINHFLDNDF 652
            +Q    A   +  NDF
Sbjct: 80  -SQLRA-AQQQW-GNDF 93


>2a0u_A Initiation factor 2B; SGPP, structural genomics, PSI,
           protein structure initiative, eukaryotic initiation
           factor; 2.10A {Leishmania major} (A:)
          Length = 383

 Score = 29.7 bits (66), Expect = 1.9
 Identities = 28/171 (16%), Positives = 56/171 (32%), Gaps = 17/171 (9%)

Query: 6   TSIDYQTNN---LDQDKIPSEDVAKTLTSIQDNIKHLREFIIAWSSDLNPHKDRYDYIVG 62
            SI Y   +   LDQ K+P E V   + +++D    ++E  +                  
Sbjct: 19  ESIKYTPGSLRLLDQRKLPLETVFDDVLTVEDIWSAIKEXRV------RGAPAIAVSAAL 72

Query: 63  PIEQRLKKVSERYERVVSRDLTLVIEAGLKDLKEVGDTLKRLAETGEVILSDKSDRLLCR 122
            I    ++ +   E    R++          L    D +     T  V L +    L  +
Sbjct: 73  GIAVATQRKAANGELKSGREV-------QTFLLTSCDFVXTSRPT-AVNLFNCLRDLKAQ 124

Query: 123 FMDMVETEDEHKINKQVRDALESAGFDLESTQENIRKVESALINNNMKDAF 173
              +  T+   ++ +   +  E+   +  +  E I +  +A I    K   
Sbjct: 125 VDKLDPTKAAAEVAQAFVELAEAVYTNDVAFNEGIXRHGAAHILAAAKAEG 175


>2bap_D Diaphanous protein homolog 1; armadillo repeats, all
           helical, signaling protein; 3.30A {Mus musculus} (D:)
          Length = 56

 Score = 29.9 bits (67), Expect = 1.9
 Identities = 10/23 (43%), Positives = 17/23 (73%)

Query: 405 RREQEAKEKADREKADKEAKEKA 427
           RR + AKEKA++E+ +K+ K + 
Sbjct: 2   RRAKLAKEKAEKERLEKQQKREQ 24


>3fho_A ATP-dependent RNA helicase DBP5; mRNA export, ATPase,
           translation termination, ATP-binding, cytoplasm,
           hydrolase, membrane; 2.80A {Schizosaccharomyces pombe}
           (A:1-326)
          Length = 326

 Score = 29.4 bits (65), Expect = 2.7
 Identities = 19/185 (10%), Positives = 55/185 (29%), Gaps = 46/185 (24%)

Query: 20  IP------SEDV---AKTLTSIQDNIKHLREFIIAWSSDLNPHKDR-YDYIVGPIEQRLK 69
           +P        ++   +++ T      K    F +   S ++    +     + P  +  +
Sbjct: 150 LPLLLSNPPRNMIGQSQSGTG-----KTA-AFALTMLSRVDASVPKPQAICLAPSRELAR 203

Query: 70  KVSERYERVVSRDLTL-----VIEAGLKDLKE----VGDTLKRL---AETGEVILS---- 113
           ++ +    +  +   +     + ++  K  K     V  T   +    +  ++       
Sbjct: 204 QIMDVVTEM-GKYTEVKTAFGIKDSVPKGAKIDAQIVIGTPGTVMDLMKRRQLDARDIKV 262

Query: 114 ----DKSDRLLCRFMDMVETEDEHKINKQVRDALESAGFDLESTQENIRKVESALINNNM 169
               +  + L  + +       +H + +  +  L SA F      E + K          
Sbjct: 263 FVLDEADNMLDQQGLGDQSMRIKHLLPRNTQIVLFSATFS-----ERVEK----YAERFA 313

Query: 170 KDAFR 174
            +A  
Sbjct: 314 PNANE 318


>3kdq_A Uncharacterized conserved protein; functionally unknown
           protein,corynebacterium diphtheriae, structural
           genomics, PSI-2; 3.00A {Corynebacterium diphtheriae}
           (A:)
          Length = 154

 Score = 29.3 bits (66), Expect = 2.9
 Identities = 14/58 (24%), Positives = 28/58 (48%), Gaps = 2/58 (3%)

Query: 918 IRSEFEREIKELKSVIEADAK--ENPNPNKNQKKLQKTREKLVAQLSSRLKELNIDNA 973
            R E +R   EL  ++   AK  E   P +N  ++    E+L  +++  ++ +N  N+
Sbjct: 12  QRVEAQRRYSELNQLLLDVAKVQEGDQPAENPHEILTELEELTTRINDLVRRINRTNS 69


>1l4a_E Synaphin A; snare, snare complex, membrane fusion,
           neurotransmission, endocytosis/exocytosis complex; 2.95A
           {Loligo pealei} (E:)
          Length = 79

 Score = 28.8 bits (64), Expect = 4.1
 Identities = 14/58 (24%), Positives = 30/58 (51%)

Query: 389 KQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKTPIKAEG 446
           ++A  +  A  + E++R+E+  K + +RE+  +  ++K   +K  K+  E      EG
Sbjct: 16  EEAAAIEEARREAEERRKEKHRKMEEEREEMRQTIRDKYGLKKKVKEEPEAEADLDEG 73


>2gx5_A GTP-sensing transcriptional pleiotropic repressor CODY;
           DNA-binding, nucleotide-binding, transcription
           regulation, GAF domain; HET: PG4 P6G PCG PGE; 1.74A
           {Bacillus subtilis} PDB: 2b18_A 2hgv_A* (A:)
          Length = 170

 Score = 28.9 bits (65), Expect = 4.2
 Identities = 12/67 (17%), Positives = 35/67 (52%), Gaps = 5/67 (7%)

Query: 216 LLKSNNMQDVVFTKIKEVVKKHVNAEL----GHRKLRGLAFDHTYFNDKLNQFLKEIKNH 271
           +L++   + V F ++ E ++  +++ +       KL G + +    ND++ + L++ +  
Sbjct: 23  MLQAAAGKPVNFKEMAETLRDVIDSNIFVVSRRGKLLGYSINQQIENDRMKKMLED-RQF 81

Query: 272 QKEYDES 278
            +EY ++
Sbjct: 82  PEEYTKN 88


>3fyf_A Protein BVU-3222; structural genomics, periplasmic, PSI-2,
           protein structure initiative; 2.20A {Bacteroides
           vulgatus atcc 8482} (A:)
          Length = 176

 Score = 28.6 bits (64), Expect = 4.5
 Identities = 5/42 (11%), Positives = 19/42 (45%)

Query: 399 AQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEKT 440
            ++ +  + +  K++   +KA +  ++     +A   L+  +
Sbjct: 6   RKQREDAKREAWKKERQEKKALEAQQDSVSYVQAINALKNGS 47


>2c5k_T Syntaxin TLG1, T-snare affecting A late golgi compartment
           protein 1; protein transport/complex, snare, VFT
           complex, protein transport, phosphorylation; 2.05A
           {Saccharomyces cerevisiae} PDB: 2c5j_A 2c5i_T (T:)
          Length = 95

 Score = 28.3 bits (63), Expect = 5.4
 Identities = 14/83 (16%), Positives = 28/83 (33%), Gaps = 7/83 (8%)

Query: 888 DSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREIKELKSVIEADAKENPNPNKNQ 947
           D+   L  +   ++R     + + E  +  I  + E  I +L   I    ++        
Sbjct: 14  DTKEQLNRINNYITRHNTAGDDDQEEEIQDILKDVEETIVDLDRSIIVMKRDENEDVSG- 72

Query: 948 KKLQKTREKLVAQLSSRLKELNI 970
                 RE  V  +  +L  L +
Sbjct: 73  ------REAQVKNIKQQLDALKL 89


>1rxt_A Myristoyl-, glycylpeptide N-tetradecanoyltransferase 1;
           alpha-beta structure, unique N-myristoyltransferase
           fold; 3.00A {Homo sapiens} (A:)
          Length = 496

 Score = 28.1 bits (62), Expect = 6.7
 Identities = 7/151 (4%), Positives = 25/151 (16%)

Query: 464 PPKEEELEEVKDEGKKGKEPGTTETDDREETERKNQDILDNSLLAGKTHTKNETPAIPTA 523
              E      +       E   +                       K    +ET +    
Sbjct: 18  QMMEGNGNGHEHCSDCENEEDNSYNRGGLSPANDTGAKKKKKKQKKKKEKGSETDSAQDQ 77

Query: 524 KAPPAQAHKGIQDKKPQDQREKPLASDIGVGESDYAGIKLTKKEKELQEQEENLRVAEII 583
                        +  +      +         + +       + +   +   +      
Sbjct: 78  PVKMNSLPAERIQEIQKAIELFSVGQGPAKTMEEASKRSYQFWDTQPVPKLGEVVNTHGP 137

Query: 584 QQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQ 614
            +    +   +         W +L   +   
Sbjct: 138 VEPDKDNIRQEPYTLPQGFTWDALDLGDRGV 168


>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin,
           merlin, actin binding, masking, regulation,
           SELF-inhibition cell adhesion; 2.10A {Spodoptera
           frugiperda} PDB: 2i1k_A 1e5w_A (A:116-199)
          Length = 84

 Score = 27.9 bits (62), Expect = 6.8
 Identities = 7/49 (14%), Positives = 22/49 (44%)

Query: 573 QEENLRVAEIIQQSRMQSEDLQEKAWDSYKEWKSLSPDEIKQRFQKYAK 621
             + L    +  Q +M  E+ ++   + ++E + +  ++    + K A+
Sbjct: 33  ANDRLLPQRVTDQHKMSREEWEQSITNWWQEHRGMLREDAMMEYLKIAQ 81


>3i5p_A Nucleoporin NUP170; helical stack, membrane, mRNA transport,
           nuclear pore complex, nucleus, phosphoprotein, protein
           transport; 3.20A {Saccharomyces cerevisiae} (A:217-323)
          Length = 107

 Score = 27.8 bits (62), Expect = 7.0
 Identities = 14/66 (21%), Positives = 21/66 (31%), Gaps = 3/66 (4%)

Query: 867 KNQAHLNAEVERLSGLAQQPSDSTADLKELQTQLSRAKKYKESNDERIVSFIRSEFEREI 926
           +      +  E L  LA   S+    L E    LSRA  +  S           +    I
Sbjct: 13  RRSKFFES-AEILYRLAT--SNFDITLFERIEFLSRANGFCNSVSPLSQKQRIVQLASRI 69

Query: 927 KELKSV 932
           ++   V
Sbjct: 70  QDACEV 75


>2zkr_g 60S acidic ribosomal protein P0; protein-RNA complex, 60S
           ribosomal subunit, ribosomal protein/RNA complex; 8.70A
           {Canis familiaris} (g:)
          Length = 317

 Score = 27.7 bits (61), Expect = 7.7
 Identities = 15/76 (19%), Positives = 24/76 (31%), Gaps = 11/76 (14%)

Query: 378 IANVANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQ 437
           ++   ++T  L +      A+           A   A    A   AK +A  E  + D  
Sbjct: 251 LSVETDYTFPLAEKVKAFLADPSAFVAAAPVAAATTAAPAAAAAPAKVEAKEESEESD-- 308

Query: 438 EKTPIKAEGDDFGLGL 453
                    +D G GL
Sbjct: 309 ---------EDMGFGL 315


>3cg0_A Response regulator receiver modulated diguanylate cyclase
           with PAS/PAC sensor; signal receiver domain; 2.15A
           {Desulfovibrio desulfuricans subsp} (A:1-91)
          Length = 91

 Score = 27.5 bits (61), Expect = 8.7
 Identities = 16/71 (22%), Positives = 28/71 (39%), Gaps = 9/71 (12%)

Query: 130 EDEHKINKQVRDALESAGFDLESTQEN---------IRKVESALINNNMKDAFRFLELAQ 180
           ED       +R  LES G+D+    +N           + + AL++  +  A   +E A 
Sbjct: 16  EDGRLAAATLRIQLESLGYDVLGVFDNGEEAVRCAPDLRPDIALVDIMLCGALDGVETAA 75

Query: 181 KSKETADSHII 191
           +     +  II
Sbjct: 76  RLAAGCNLPII 86


>1v9d_A Diaphanous protein homolog 1; helix bundle, protein binding;
           2.60A {Mus musculus} (A:108-340)
          Length = 233

 Score = 27.8 bits (61), Expect = 8.8
 Identities = 13/50 (26%), Positives = 25/50 (50%), Gaps = 7/50 (14%)

Query: 381 VANFTSELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADRE 430
           + NF +   QA        +E ++RRE E K +  +   +K  KE+ +++
Sbjct: 191 LHNFRNMFLQA-------VKENQKRRETEEKMRRAKLAKEKAEKERLEKQ 233


>3k5b_G V-type ATP synthase, subunit (VAPC-therm); right handed
           coiled coil, vacuolar ATPase/synthase, V-type
           ATPase/synthase, A-type ATPase/synthase; 3.10A {Thermus
           thermophilus HB8} (G:)
          Length = 104

 Score = 27.5 bits (61), Expect = 9.5
 Identities = 12/53 (22%), Positives = 23/53 (43%)

Query: 387 ELKQATVLARANAQEEKQRREQEAKEKADREKADKEAKEKADREKADKDLQEK 439
             K+        A+ E +   +EA+ KA   +A    +E+A+ E      +E+
Sbjct: 23  AAKKEAEERVKRAEAEAKALLEEAEAKAKALEAQYRERERAETEALLARYRER 75


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.312    0.130    0.366 

Gapped
Lambda     K      H
   0.267   0.0593    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 9,240,028
Number of extensions: 435540
Number of successful extensions: 1637
Number of sequences better than 10.0: 1
Number of HSP's gapped: 1567
Number of HSP's successfully gapped: 177
Length of query: 1246
Length of database: 4,956,049
Length adjustment: 99
Effective length of query: 1147
Effective length of database: 1,609,354
Effective search space: 1845929038
Effective search space used: 1845929038
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 60 (27.2 bits)