Query gi|254781207|ref|YP_003065620.1| hypothetical protein CLIBASIA_05570 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 80 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Mon May 30 06:04:49 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254781207.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PTZ00236 Tim17; Provisional 86.1 2.1 5.2E-05 22.8 5.3 70 2-72 82-153 (160) 2 pfam06932 DUF1283 Protein of u 53.7 16 0.00042 18.0 3.3 51 22-72 5-60 (109) 3 PRK10510 putative outer membra 47.2 26 0.00065 16.9 5.0 17 7-23 34-50 (219) 4 TIGR02005 PTS-IIBC-alpha PTS s 44.8 3.3 8.3E-05 21.7 -1.4 17 59-75 421-437 (533) 5 pfam05055 DUF677 Protein of un 43.3 30 0.00075 16.6 4.3 15 21-35 210-224 (336) 6 COG4735 Uncharacterized protei 33.5 32 0.00081 16.4 2.2 23 13-35 153-175 (211) 7 PRK02256 putative aminopeptida 27.3 26 0.00066 16.9 0.9 28 36-63 416-443 (459) 8 pfam11492 Dicistro_VP4 Cricket 26.9 50 0.0013 15.4 2.3 38 5-42 11-51 (56) 9 KOG2596 consensus 21.2 34 0.00086 16.3 0.5 24 39-62 427-450 (479) 10 pfam11240 DUF3042 Protein of u 20.4 59 0.0015 15.0 1.6 17 13-29 5-21 (54) No 1 >PTZ00236 Tim17; Provisional Probab=86.10 E-value=2.1 Score=22.84 Aligned_cols=70 Identities=21% Similarity=0.131 Sum_probs=29.3 Q ss_pred CHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 335778999999999998--88778876423778888875444777614535789999886579999999999 Q gi|254781207|r 2 GFWNSITSIAATVGAVVG--TVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMHKMREQEEEEKKLLKKG 72 (80) Q Consensus 2 gfwnsitsiaatvgavvg--tvataaalatpigwvgaavagvgaavvgagasdlamhkmreqeeeekkllkkg 72 (80) ..||||.|=++|-|..-- ....++--|.--|-+=+-+.|+|-.+---- .+-....|.+|.|-|+.+..|. T Consensus 82 D~wNsI~aGa~TGg~La~R~G~~aa~~sA~~gg~lLalIEg~gi~~~r~~-a~~~~~~~~~~~e~~~~~~~~~ 153 (160) T PTZ00236 82 DHWNAIVSGFFTGGVLAIRGGWKIAVRNAIFGGILLGIIELVSIGMNKRQ-ARTPRQQFQQQQEMEKQGERKN 153 (160) T ss_pred CCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCCCCHHHHHHHHHHHHHHCCC T ss_conf 60476999999789998520699998706999999999999999999973-1453156798899999986403 No 2 >pfam06932 DUF1283 Protein of unknown function (DUF1283). This family consists of several hypothetical proteins of around 115 residues in length which seem to be specific to Enterobacteria. The function of the family is unknown. Probab=53.72 E-value=16 Score=17.97 Aligned_cols=51 Identities=24% Similarity=0.271 Sum_probs=27.5 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHH-----HHHHHHHHHHHHHHH Q ss_conf 778876423778888875444777614535789999-----886579999999999 Q gi|254781207|r 22 ATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMHK-----MREQEEEEKKLLKKG 72 (80) Q Consensus 22 ataaalatpigwvgaavagvgaavvgagasdlamhk-----mreqeeeekkllkkg 72 (80) -..++|..|+.|.-++.|.-...|...|..|-+|.| +.||=.+.+.|-.|- T Consensus 5 lpl~~Ll~~~awq~~a~a~~sT~~~v~~~gd~~lske~Arq~kEqW~~tr~LR~KV 60 (109) T pfam06932 5 LPLALLLLLLAWQTTALAQASTCVLVIESGDSAQSREAARQSKEQWNDTRSLRNKV 60 (109) T ss_pred HHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 87999999998421354326644785079963303999998798687889999998 No 3 >PRK10510 putative outer membrane lipoprotein; Provisional Probab=47.15 E-value=26 Score=16.93 Aligned_cols=17 Identities=29% Similarity=0.464 Sum_probs=8.0 Q ss_pred HHHHHHHHHHHHHHHHH Q ss_conf 89999999999988877 Q gi|254781207|r 7 ITSIAATVGAVVGTVAT 23 (80) Q Consensus 7 itsiaatvgavvgtvat 23 (80) .+.+.+.+|++.|.+.- T Consensus 34 ~~~~ga~~Ga~~Ga~~G 50 (219) T PRK10510 34 KSGIGAGIGSLVGAGIG 50 (219) T ss_pred HHHHHHHHHHHHHHHHH T ss_conf 66675789999989862 No 4 >TIGR02005 PTS-IIBC-alpha PTS system, alpha-glucoside-specific IIBC component; InterPro: IPR010975 This entry represents the fused PTS enzyme II B and C domains. A gene from Clostridium has been partially characterised as a maltose transporter, while genes from Fusobacterium and Klebsiella , have been proposed to transport the five non-standard isomers of sucrose.; GO: 0008982 protein-N(PI)-phosphohistidine-sugar phosphotransferase activity, 0009401 phosphoenolpyruvate-dependent sugar phosphotransferase system. Probab=44.76 E-value=3.3 Score=21.75 Aligned_cols=17 Identities=59% Similarity=0.589 Sum_probs=13.2 Q ss_pred HHHHHHHHHHHHHHHHH Q ss_conf 86579999999999887 Q gi|254781207|r 59 REQEEEEKKLLKKGLKK 75 (80) Q Consensus 59 reqeeeekkllkkglkk 75 (80) ||.+|||-||.-|---| T Consensus 421 Re~~eEEvKLYsKadYK 437 (533) T TIGR02005 421 REDEEEEVKLYSKADYK 437 (533) T ss_pred CCCCCCCCCCCCCHHHH T ss_conf 88754432212103455 No 5 >pfam05055 DUF677 Protein of unknown function (DUF677). This family consists of AT14A like proteins from Arabidopsis thaliana. At14a has a small domain that has sequence similarities to integrins from fungi, insects and humans. Transcripts of At14a are found in all Arabidopsis tissues and localizes partly to the plasma membrane. Probab=43.29 E-value=30 Score=16.60 Aligned_cols=15 Identities=53% Similarity=0.702 Sum_probs=9.2 Q ss_pred HHHHHHHHHHHHHHH Q ss_conf 877887642377888 Q gi|254781207|r 21 VATAAALATPIGWVG 35 (80) Q Consensus 21 vataaalatpigwvg 35 (80) ++.|++++.||+-+| T Consensus 210 va~a~~~s~Pi~~~g 224 (336) T pfam05055 210 VGVAGALAVPLEAVG 224 (336) T ss_pred HHHHHHHCCCCHHHH T ss_conf 766887616600178 No 6 >COG4735 Uncharacterized protein conserved in bacteria [Function unknown] Probab=33.53 E-value=32 Score=16.42 Aligned_cols=23 Identities=39% Similarity=0.631 Sum_probs=18.4 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999988877887642377888 Q gi|254781207|r 13 TVGAVVGTVATAAALATPIGWVG 35 (80) Q Consensus 13 tvgavvgtvataaalatpigwvg 35 (80) ++|+-.|+|-|--.|.-|+||.= T Consensus 153 ~~ga~~~~~rtl~~l~GPvgw~l 175 (211) T COG4735 153 LRGAAYGLVRTLFSLGGPVGWAL 175 (211) T ss_pred HHHHHHHHHHHHHHHCCHHHHHH T ss_conf 66422667777998526199999 No 7 >PRK02256 putative aminopeptidase 1; Provisional Probab=27.33 E-value=26 Score=16.91 Aligned_cols=28 Identities=29% Similarity=0.335 Sum_probs=21.8 Q ss_pred HHHHHHHHHHHHCCHHHHHHHHHHHHHH Q ss_conf 8875444777614535789999886579 Q gi|254781207|r 36 AAVAGVGAAVVGAGASDLAMHKMREQEE 63 (80) Q Consensus 36 aavagvgaavvgagasdlamhkmreqee 63 (80) .-.+..|...|--|..-|+||-.||--- T Consensus 416 pi~A~~Gi~tVDvG~P~LsMHSiRE~~g 443 (459) T PRK02256 416 KFLAQYGMEVIDCGVALLSMHSPFEIAS 443 (459) T ss_pred HHHHHCCCCEEECCHHHHHHHHHHHHHC T ss_conf 9987279988970676654208988854 No 8 >pfam11492 Dicistro_VP4 Cricket paralysis virus, VP4. This is a family of minor capsid proteins, known as VP4, from the dicistroviridae. The dicistroviridae is a group of small, RNA-containing viruses that are closely structurally related to the picornaviridae. VP4 is a short, extended polypeptide chain found within the viral capsid, at the interface between the external protein shell and packaged RNA genome. Probab=26.90 E-value=50 Score=15.36 Aligned_cols=38 Identities=26% Similarity=0.471 Sum_probs=26.5 Q ss_pred HHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHH Q ss_conf 7789999999999988877---8876423778888875444 Q gi|254781207|r 5 NSITSIAATVGAVVGTVAT---AAALATPIGWVGAAVAGVG 42 (80) Q Consensus 5 nsitsiaatvgavvgtvat---aaalatpigwvgaavagvg 42 (80) ++|.+.+.+|..+.+++-. -...++|..|+-.+|+.+- T Consensus 11 G~IS~~as~Vs~va~~ls~IPvig~~aka~~wvs~~v~~iA 51 (56) T pfam11492 11 GVISKPASTVSEVASALSSIPVIGNIAKATSWVSDAVGDIA 51 (56) T ss_pred CCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHH T ss_conf 65352889999998660168601210104899999999999 No 9 >KOG2596 consensus Probab=21.18 E-value=34 Score=16.30 Aligned_cols=24 Identities=29% Similarity=0.491 Sum_probs=20.4 Q ss_pred HHHHHHHHHCCHHHHHHHHHHHHH Q ss_conf 544477761453578999988657 Q gi|254781207|r 39 AGVGAAVVGAGASDLAMHKMREQE 62 (80) Q Consensus 39 agvgaavvgagasdlamhkmreqe 62 (80) ..+|.-.+.-|...|+||-.||-- T Consensus 427 S~~G~RTlDlG~pqLsMHSiRe~~ 450 (479) T KOG2596 427 SKTGIRTLDLGIPQLSMHSIREMC 450 (479) T ss_pred HHCCCEEEECCCHHHHHHHHHHHH T ss_conf 204854661585266667899874 No 10 >pfam11240 DUF3042 Protein of unknown function (DUF3042). This family of proteins with unknown function appears to be restricted to Firmicutes. Probab=20.43 E-value=59 Score=14.99 Aligned_cols=17 Identities=47% Similarity=0.581 Sum_probs=12.2 Q ss_pred HHHHHHHHHHHHHHHHH Q ss_conf 99999988877887642 Q gi|254781207|r 13 TVGAVVGTVATAAALAT 29 (80) Q Consensus 13 tvgavvgtvataaalat 29 (80) +-|-++|+++|.+++|. T Consensus 5 ~kG~l~G~~~T~aaiag 21 (54) T pfam11240 5 AKGFLTGVLATAAAIAG 21 (54) T ss_pred HHHHHHHHHHHHHHHHH T ss_conf 10134537999999988 Done!