Query         gi|254781207|ref|YP_003065620.1| hypothetical protein CLIBASIA_05570 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 80
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 13730
Date          Wed Jun  1 11:40:34 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781207.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1w4xa1 c.3.1.5 (A:10-154,A:39   8.3      54  0.0039   12.7   0.8   13   44-56     11-23  (298)
  2 d1t27a_ d.129.3.4 (A:) Phoshat   7.4      69   0.005   12.1   1.6   26   52-77    237-262 (269)
  3 d1tlqa_ a.195.1.1 (A:) Hypothe   7.4      68   0.005   12.2   1.0   33   29-62    122-161 (161)
  4 d1jb0f_ f.23.16.1 (F:) Subunit   6.8      67  0.0049   12.2   0.7   12   27-38     73-84  (141)
  5 d2iqha1 e.75.1.1 (A:21-489) Nu   5.1      60  0.0043   12.5  -0.3   24   24-47    149-172 (469)
  6 d1onfa3 d.87.1.1 (A:377-495) G   3.7      64  0.0047   12.3  -1.0   14   41-54     72-85  (119)
  7 d1qlma_ d.147.1.1 (A:) Metheny   3.6 1.3E+02  0.0091   10.8   2.5   19   42-60    176-194 (316)
  8 d2crga1 a.4.1.3 (A:8-64) Metas   3.5 1.3E+02  0.0092   10.7   1.5   18   63-80      6-23  (57)
  9 d1h3na2 b.51.1.1 (A:226-417) L   3.4      58  0.0042   12.6  -1.5   15   66-80    178-192 (192)
 10 d1ijwc_ a.4.1.2 (C:) HIN recom   3.3 1.3E+02  0.0097   10.6   0.7   18   60-77      9-26  (47)

No 1  
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]}
Probab=8.27  E-value=54  Score=12.75  Aligned_cols=13  Identities=54%  Similarity=0.524  Sum_probs=5.4

Q ss_pred             HHHHCCHHHHHHH
Q ss_conf             7761453578999
Q gi|254781207|r   44 AVVGAGASDLAMH   56 (80)
Q Consensus        44 avvgagasdlamh   56 (80)
                      +|||||.|-|+|-
T Consensus        11 ~IIGAG~sGl~~a   23 (298)
T d1w4xa1          11 LVVGAGFSGLYAL   23 (298)
T ss_dssp             EEECCSHHHHHHH
T ss_pred             EEECCCHHHHHHH
T ss_conf             9989659999999


No 2  
>d1t27a_ d.129.3.4 (A:) Phoshatidylinositol transfer protein, PITP {Rat (Rattus norvegicus) [TaxId: 10116]}
Probab=7.39  E-value=69  Score=12.15  Aligned_cols=26  Identities=38%  Similarity=0.517  Sum_probs=20.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             78999988657999999999988765
Q gi|254781207|r   52 DLAMHKMREQEEEEKKLLKKGLKKRQ   77 (80)
Q Consensus        52 dlamhkmreqeeeekkllkkglkkrq   77 (80)
                      +|.|...|+-|++-++.|.+-.++.+
T Consensus       237 gmTmedIR~~E~e~q~~L~~~~~~~~  262 (269)
T d1t27a_         237 DLTMDDIRRMEEETKRQLDEMRQKDP  262 (269)
T ss_dssp             TCCHHHHHHHHHHHHHHHHHHHHSSC
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             99899999999999999999870465


No 3  
>d1tlqa_ a.195.1.1 (A:) Hypothetical protein YpjQ {Bacillus subtilis [TaxId: 1423]}
Probab=7.35  E-value=68  Score=12.17  Aligned_cols=33  Identities=24%  Similarity=0.250  Sum_probs=18.2

Q ss_pred             HHHHHHHH-------HHHHHHHHHHHCCHHHHHHHHHHHHH
Q ss_conf             23778888-------87544477761453578999988657
Q gi|254781207|r   29 TPIGWVGA-------AVAGVGAAVVGAGASDLAMHKMREQE   62 (80)
Q Consensus        29 tpigwvga-------avagvgaavvgagasdlamhkmreqe   62 (80)
                      -||+|...       -.--+-|++..+-+|.+| |+.++.|
T Consensus       122 g~i~~ld~~~~g~gv~lDDivagi~A~~~srlA-h~~~~~~  161 (161)
T d1tlqa_         122 GIIKELDESPDGIHTFLDDIVAALAAAAASRIA-HTHQDLQ  161 (161)
T ss_dssp             THHHHTSSSCSCCCTTHHHHHHHHHHHHHHHHH-THHHHHC
T ss_pred             HHHHHHHHCCCCCCEEHHHHHHHHHHHHHHHHH-HHCCCCC
T ss_conf             768888636998323098799999999999997-6384679


No 4  
>d1jb0f_ f.23.16.1 (F:) Subunit III of photosystem I reaction centre, PsaF {Synechococcus elongatus [TaxId: 32046]}
Probab=6.76  E-value=67  Score=12.22  Aligned_cols=12  Identities=58%  Similarity=0.960  Sum_probs=7.7

Q ss_pred             HHHHHHHHHHHH
Q ss_conf             642377888887
Q gi|254781207|r   27 LATPIGWVGAAV   38 (80)
Q Consensus        27 latpigwvgaav   38 (80)
                      .|-=|||+|-.-
T Consensus        73 IAGwIGWaGR~Y   84 (141)
T d1jb0f_          73 IAGWIGWVGRAY   84 (141)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHH
T ss_conf             842132442999


No 5  
>d2iqha1 e.75.1.1 (A:21-489) Nucleocapsid protein {Influenza A virus [TaxId: 11320]}
Probab=5.07  E-value=60  Score=12.49  Aligned_cols=24  Identities=42%  Similarity=0.581  Sum_probs=18.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             887642377888887544477761
Q gi|254781207|r   24 AAALATPIGWVGAAVAGVGAAVVG   47 (80)
Q Consensus        24 aaalatpigwvgaavagvgaavvg   47 (80)
                      .+.|.+--||.|+++-|+|.-|..
T Consensus       149 GstlprRsga~g~a~kGiGtmV~e  172 (469)
T d2iqha1         149 GSTLPRRSGAAGAAVKGVGTMVME  172 (469)
T ss_dssp             TTTSCTTSCHHHHTTCCHHHHHHH
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             688775233334321116677999


No 6  
>d1onfa3 d.87.1.1 (A:377-495) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]}
Probab=3.70  E-value=64  Score=12.31  Aligned_cols=14  Identities=21%  Similarity=0.558  Sum_probs=10.4

Q ss_pred             HHHHHHHCCHHHHH
Q ss_conf             44777614535789
Q gi|254781207|r   41 VGAAVVGAGASDLA   54 (80)
Q Consensus        41 vgaavvgagasdla   54 (80)
                      +|+.++|.+||+|-
T Consensus        72 lGa~ivG~~A~ElI   85 (119)
T d1onfa3          72 KGLHIIGLNADEIV   85 (119)
T ss_dssp             EEEEEESTTHHHHH
T ss_pred             EEEEEECCCHHHHH
T ss_conf             88999579888999


No 7  
>d1qlma_ d.147.1.1 (A:) Methenyltetrahydromethanopterin cyclohydrolase {Archaeon Methanopyrus kandleri [TaxId: 2320]}
Probab=3.60  E-value=1.3e+02  Score=10.75  Aligned_cols=19  Identities=26%  Similarity=0.361  Sum_probs=12.7

Q ss_pred             HHHHHHCCHHHHHHHHHHH
Q ss_conf             4777614535789999886
Q gi|254781207|r   42 GAAVVGAGASDLAMHKMRE   60 (80)
Q Consensus        42 gaavvgagasdlamhkmre   60 (80)
                      |...|-+-.-..+||||.|
T Consensus       176 GsvQv~aRvlE~alhKl~E  194 (316)
T d1qlma_         176 GSVQVSARVVETGLYKLLE  194 (316)
T ss_dssp             HHHHHHTTHHHHHHHHHHH
T ss_pred             EEEEEHHHHHHHHHHHHHH
T ss_conf             2563227899999999888


No 8  
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]}
Probab=3.54  E-value=1.3e+02  Score=10.72  Aligned_cols=18  Identities=28%  Similarity=0.475  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHHHCC
Q ss_conf             999999999988765269
Q gi|254781207|r   63 EEEKKLLKKGLKKRQKNY   80 (80)
Q Consensus        63 eeekkllkkglkkrqkny   80 (80)
                      +||+++...|+.+--||+
T Consensus         6 ~eE~~~F~~~~~~yGKdf   23 (57)
T d2crga1           6 ASEACLFEEALEKYGKDF   23 (57)
T ss_dssp             HHHHHHHHHHHHHTCSCH
T ss_pred             HHHHHHHHHHHHHHCCCH
T ss_conf             999999999999976259


No 9  
>d1h3na2 b.51.1.1 (A:226-417) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]}
Probab=3.39  E-value=58  Score=12.56  Aligned_cols=15  Identities=40%  Similarity=0.479  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHCC
Q ss_conf             999999988765269
Q gi|254781207|r   66 KKLLKKGLKKRQKNY   80 (80)
Q Consensus        66 kkllkkglkkrqkny   80 (80)
                      ++|-.+||-+|+.||
T Consensus       178 ~~L~~~glg~~~~nY  192 (192)
T d1h3na2         178 AWLEEKGLGKGRVTY  192 (192)
T ss_dssp             HHHHHHTSEEEEEEE
T ss_pred             HHHHHCCCCCCEEEC
T ss_conf             999978996255649


No 10 
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic}
Probab=3.31  E-value=1.3e+02  Score=10.60  Aligned_cols=18  Identities=33%  Similarity=0.604  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHHHHH
Q ss_conf             657999999999988765
Q gi|254781207|r   60 EQEEEEKKLLKKGLKKRQ   77 (80)
Q Consensus        60 eqeeeekkllkkglkkrq   77 (80)
                      ||-++-+.++..|..+.+
T Consensus         9 ~q~~~a~~l~~~G~s~~~   26 (47)
T d1ijwc_           9 HEQEQISRLLEKGHPRQQ   26 (47)
T ss_dssp             HHHHHHHHHHHTTCCHHH
T ss_pred             HHHHHHHHHHHCCCCHHH
T ss_conf             999999999988997999


Done!