BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781207|ref|YP_003065620.1| hypothetical protein
CLIBASIA_05570 [Candidatus Liberibacter asiaticus str. psy62]
         (80 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254781207|ref|YP_003065620.1| hypothetical protein CLIBASIA_05570 [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254040884|gb|ACT57680.1| hypothetical protein CLIBASIA_05570 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 80

 Score =  156 bits (395), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%)

Query: 1  MGFWNSITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMHKMRE 60
          MGFWNSITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMHKMRE
Sbjct: 1  MGFWNSITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMHKMRE 60

Query: 61 QEEEEKKLLKKGLKKRQKNY 80
          QEEEEKKLLKKGLKKRQKNY
Sbjct: 61 QEEEEKKLLKKGLKKRQKNY 80


>gi|317120672|gb|ADV02495.1| hypothetical protein SC1_gp060 [Liberibacter phage SC1]
 gi|317120816|gb|ADV02637.1| hypothetical protein SC1_gp060 [Candidatus Liberibacter
          asiaticus]
          Length = 1340

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 63/84 (75%), Positives = 66/84 (78%), Gaps = 13/84 (15%)

Query: 1  MGFWNSITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMH---- 56
          MGFWNSITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMH    
Sbjct: 1  MGFWNSITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMHKMRE 60

Query: 57 ---------KMREQEEEEKKLLKK 71
                   + R +EE EK L+ K
Sbjct: 61 QEEEEKKASEKRIKEETEKLLISK 84


>gi|260437285|ref|ZP_05791101.1| phosphoenolpyruvate-protein phosphotransferase [Butyrivibrio
           crossotus DSM 2876]
 gi|292810595|gb|EFF69800.1| phosphoenolpyruvate-protein phosphotransferase [Butyrivibrio
           crossotus DSM 2876]
          Length = 554

 Score = 37.0 bits (84), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 35/74 (47%), Gaps = 1/74 (1%)

Query: 2   GFWNSITSIAATVGAVVGTVATAAALATPIGWVGAAVAGV-GAAVVGAGASDLAMHKMRE 60
           G  NS T+I A   A+   V T   L   I  V A V G  G   +      L + K R+
Sbjct: 183 GSLNSHTAILARTMAIPALVNTPLPLDEEIDGVMAVVDGTKGVIYIDPDCETLELMKKRK 242

Query: 61  QEEEEKKLLKKGLK 74
            EE+EK++L + LK
Sbjct: 243 AEEDEKRVLLQTLK 256


>gi|328474314|gb|EGF45119.1| hypothetical protein VP10329_16445 [Vibrio parahaemolyticus 10329]
          Length = 336

 Score = 35.4 bits (80), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 24/38 (63%)

Query: 8   TSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAV 45
           T+ +  VG V G   +   +ATP+GWVGA V GV ++V
Sbjct: 265 TAASTVVGTVSGIAISLFVVATPVGWVGALVLGVASSV 302


>gi|270006695|gb|EFA03143.1| hypothetical protein TcasGA2_TC013055 [Tribolium castaneum]
          Length = 1119

 Score = 35.0 bits (79), Expect = 3.9,   Method: Composition-based stats.
 Identities = 25/68 (36%), Positives = 36/68 (52%), Gaps = 6/68 (8%)

Query: 5   NSITSIAATVGAVVGTV-ATAAALATPIG----WVGAAVAGVGAAVVGAGASDLAMHKMR 59
           N I+S+ A+VGAV  +V A  A++   +G     VGA+V  VGA V   G S +    +R
Sbjct: 663 NIISSVGASVGAVGASVGAMGASVGATVGAMGAQVGASVGAVGATVGAVGRSSVGTF-IR 721

Query: 60  EQEEEEKK 67
           +  E   K
Sbjct: 722 QPTESSTK 729


>gi|242813635|ref|XP_002486206.1| efflux pump antibiotic resistance protein, putative [Talaromyces
           stipitatus ATCC 10500]
 gi|242813642|ref|XP_002486207.1| efflux pump antibiotic resistance protein, putative [Talaromyces
           stipitatus ATCC 10500]
 gi|242813648|ref|XP_002486208.1| efflux pump antibiotic resistance protein, putative [Talaromyces
           stipitatus ATCC 10500]
 gi|218714545|gb|EED13968.1| efflux pump antibiotic resistance protein, putative [Talaromyces
           stipitatus ATCC 10500]
 gi|218714546|gb|EED13969.1| efflux pump antibiotic resistance protein, putative [Talaromyces
           stipitatus ATCC 10500]
 gi|218714547|gb|EED13970.1| efflux pump antibiotic resistance protein, putative [Talaromyces
           stipitatus ATCC 10500]
          Length = 527

 Score = 34.3 bits (77), Expect = 5.9,   Method: Composition-based stats.
 Identities = 18/33 (54%), Positives = 23/33 (69%)

Query: 18  VGTVATAAALATPIGWVGAAVAGVGAAVVGAGA 50
           VGT+  AAA ++P+  VG A+AG GAA V  GA
Sbjct: 186 VGTILCAAATSSPMFIVGRAIAGFGAAGVLQGA 218


>gi|254933575|ref|ZP_05266934.1| conserved hypothetical protein [Listeria monocytogenes HPB2262]
 gi|293585136|gb|EFF97168.1| conserved hypothetical protein [Listeria monocytogenes HPB2262]
          Length = 1599

 Score = 33.9 bits (76), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 37/70 (52%), Gaps = 4/70 (5%)

Query: 1   MGFWNSITSIAA----TVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMH 56
           +G  + +TS+AA    T  AV GT   AA LA   G + A +   GAA++G G   L  H
Sbjct: 473 LGLGSKLTSLAAGFGATTTAVEGTSLAAAGLAGSFGALPAVIGLAGAALIGVGIYALDKH 532

Query: 57  KMREQEEEEK 66
             + +E +E+
Sbjct: 533 ISKIEESKER 542


>gi|103486523|ref|YP_616084.1| hypothetical protein Sala_1034 [Sphingopyxis alaskensis RB2256]
 gi|98976600|gb|ABF52751.1| protein of unknown function DUF1295 [Sphingopyxis alaskensis
           RB2256]
          Length = 269

 Score = 33.5 bits (75), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 25/52 (48%), Gaps = 4/52 (7%)

Query: 31  IGWVGAAVAGVGAAVVGAGASDLAMHKMREQEEEEKKLLKKGLKK--RQKNY 80
           IGWVGAA A  G A    G  D  +H  R     + ++L  GL +  R  NY
Sbjct: 145 IGWVGAAAALTGIAFESIG--DAQLHAFRRNPANKGRVLDTGLWRYTRHPNY 194


>gi|261333538|emb|CBH16533.1| hypothetical protein, conserved [Trypanosoma brucei gambiense
           DAL972]
          Length = 636

 Score = 33.5 bits (75), Expect = 9.4,   Method: Composition-based stats.
 Identities = 26/69 (37%), Positives = 33/69 (47%), Gaps = 10/69 (14%)

Query: 6   SITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMHKMREQEEEE 65
           SI   A    AVV   A A     P+      VAG GA      A+DLA+     QEEE+
Sbjct: 241 SIVPEALAFSAVVPHTANALQAQIPV------VAGTGAVGPAVSANDLAL----AQEEED 290

Query: 66  KKLLKKGLK 74
           +K L+K +K
Sbjct: 291 RKQLEKIIK 299


>gi|54020419|ref|YP_115774.1| hypothetical protein mhp261 [Mycoplasma hyopneumoniae 232]
 gi|53987592|gb|AAV27793.1| conserved hypothetical protein [Mycoplasma hyopneumoniae 232]
          Length = 290

 Score = 33.5 bits (75), Expect = 9.8,   Method: Composition-based stats.
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 9/64 (14%)

Query: 9   SIAATVGAVVGT-----VATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMHKMREQEE 63
           SIA  +GAV G+     ++T ++L  PIGWV   ++  GA ++  G S L+ H + +   
Sbjct: 150 SIAGGMGAVAGSSLVTLISTLSSLTGPIGWVAGLIS--GALII--GFSGLSGHYIGQSLG 205

Query: 64  EEKK 67
           E  K
Sbjct: 206 ERDK 209


Searching..................................................done


Results from round 2





CONVERGED!
>gi|254781207|ref|YP_003065620.1| hypothetical protein CLIBASIA_05570 [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254040884|gb|ACT57680.1| hypothetical protein CLIBASIA_05570 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 80

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 80/80 (100%), Positives = 80/80 (100%)

Query: 1  MGFWNSITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMHKMRE 60
          MGFWNSITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMHKMRE
Sbjct: 1  MGFWNSITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMHKMRE 60

Query: 61 QEEEEKKLLKKGLKKRQKNY 80
          QEEEEKKLLKKGLKKRQKNY
Sbjct: 61 QEEEEKKLLKKGLKKRQKNY 80


>gi|317120672|gb|ADV02495.1| hypothetical protein SC1_gp060 [Liberibacter phage SC1]
 gi|317120816|gb|ADV02637.1| hypothetical protein SC1_gp060 [Candidatus Liberibacter
          asiaticus]
          Length = 1340

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 63/84 (75%), Positives = 66/84 (78%), Gaps = 13/84 (15%)

Query: 1  MGFWNSITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMH---- 56
          MGFWNSITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMH    
Sbjct: 1  MGFWNSITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMHKMRE 60

Query: 57 ---------KMREQEEEEKKLLKK 71
                   + R +EE EK L+ K
Sbjct: 61 QEEEEKKASEKRIKEETEKLLISK 84


>gi|254933575|ref|ZP_05266934.1| conserved hypothetical protein [Listeria monocytogenes HPB2262]
 gi|293585136|gb|EFF97168.1| conserved hypothetical protein [Listeria monocytogenes HPB2262]
          Length = 1599

 Score = 37.0 bits (84), Expect = 0.83,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 37/71 (52%), Gaps = 4/71 (5%)

Query: 1   MGFWNSITSIAATVGA----VVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMH 56
           +G  + +TS+AA  GA    V GT   AA LA   G + A +   GAA++G G   L  H
Sbjct: 473 LGLGSKLTSLAAGFGATTTAVEGTSLAAAGLAGSFGALPAVIGLAGAALIGVGIYALDKH 532

Query: 57  KMREQEEEEKK 67
             + +E +E+ 
Sbjct: 533 ISKIEESKERI 543


>gi|315302848|ref|ZP_07873606.1| gp15 [Listeria ivanovii FSL F6-596]
 gi|313628795|gb|EFR97170.1| gp15 [Listeria ivanovii FSL F6-596]
          Length = 844

 Score = 35.8 bits (81), Expect = 2.2,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 29/57 (50%)

Query: 11  AATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMHKMREQEEEEKK 67
            AT  AV GT   AA LA   G + A +   GAA++G G   L  H  + +E EE+ 
Sbjct: 487 GATTTAVEGTSLAAAGLAGSFGALPAVIGLAGAALIGVGIYALDKHISKIEESEERI 543


>gi|270006695|gb|EFA03143.1| hypothetical protein TcasGA2_TC013055 [Tribolium castaneum]
          Length = 1119

 Score = 35.4 bits (80), Expect = 2.6,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 34/67 (50%), Gaps = 5/67 (7%)

Query: 5   NSITSIAATVGAVVGTV-ATAAALATPIG----WVGAAVAGVGAAVVGAGASDLAMHKMR 59
           N I+S+ A+VGAV  +V A  A++   +G     VGA+V  VGA V   G S +     +
Sbjct: 663 NIISSVGASVGAVGASVGAMGASVGATVGAMGAQVGASVGAVGATVGAVGRSSVGTFIRQ 722

Query: 60  EQEEEEK 66
             E   K
Sbjct: 723 PTESSTK 729


>gi|328474314|gb|EGF45119.1| hypothetical protein VP10329_16445 [Vibrio parahaemolyticus 10329]
          Length = 336

 Score = 35.4 bits (80), Expect = 2.6,   Method: Composition-based stats.
 Identities = 17/38 (44%), Positives = 24/38 (63%)

Query: 8   TSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAV 45
           T+ +  VG V G   +   +ATP+GWVGA V GV ++V
Sbjct: 265 TAASTVVGTVSGIAISLFVVATPVGWVGALVLGVASSV 302


>gi|313635396|gb|EFS01657.1| gp15 [Listeria seeligeri FSL N1-067]
          Length = 1337

 Score = 34.6 bits (78), Expect = 5.0,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 29/57 (50%)

Query: 11  AATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMHKMREQEEEEKK 67
            AT  AV GT   AA LA   G + A +   GAA++G G   L  H  + +E +E+ 
Sbjct: 487 GATTTAVEGTSLAAAGLAGSFGALPAVITVAGAALLGVGIYALDKHISKIEESKERI 543


>gi|224500922|ref|ZP_03669229.1| hypothetical protein LmonFR_00125 [Listeria monocytogenes FSL
           R2-561]
          Length = 1599

 Score = 34.3 bits (77), Expect = 5.2,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 29/56 (51%)

Query: 11  AATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMHKMREQEEEEK 66
            AT  AV GT   AA LA   G + A +   GAA++G G   L  H  + +E +E+
Sbjct: 487 GATTTAVEGTSLAAAGLAGSFGALPAVITVAGAALLGVGIYALDKHISKIEESKER 542


>gi|156975567|ref|YP_001446474.1| hypothetical protein VIBHAR_03299 [Vibrio harveyi ATCC BAA-1116]
 gi|156527161|gb|ABU72247.1| hypothetical protein VIBHAR_03299 [Vibrio harveyi ATCC BAA-1116]
          Length = 338

 Score = 34.3 bits (77), Expect = 6.0,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 8   TSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAV 45
           T+++  VG   G V +   LATP+GW+GA   GV + +
Sbjct: 267 TAVSTVVGLAGGAVISLVVLATPVGWIGALALGVTSGI 304


>gi|242813635|ref|XP_002486206.1| efflux pump antibiotic resistance protein, putative [Talaromyces
           stipitatus ATCC 10500]
 gi|242813642|ref|XP_002486207.1| efflux pump antibiotic resistance protein, putative [Talaromyces
           stipitatus ATCC 10500]
 gi|242813648|ref|XP_002486208.1| efflux pump antibiotic resistance protein, putative [Talaromyces
           stipitatus ATCC 10500]
 gi|218714545|gb|EED13968.1| efflux pump antibiotic resistance protein, putative [Talaromyces
           stipitatus ATCC 10500]
 gi|218714546|gb|EED13969.1| efflux pump antibiotic resistance protein, putative [Talaromyces
           stipitatus ATCC 10500]
 gi|218714547|gb|EED13970.1| efflux pump antibiotic resistance protein, putative [Talaromyces
           stipitatus ATCC 10500]
          Length = 527

 Score = 33.5 bits (75), Expect = 9.2,   Method: Composition-based stats.
 Identities = 18/33 (54%), Positives = 23/33 (69%)

Query: 18  VGTVATAAALATPIGWVGAAVAGVGAAVVGAGA 50
           VGT+  AAA ++P+  VG A+AG GAA V  GA
Sbjct: 186 VGTILCAAATSSPMFIVGRAIAGFGAAGVLQGA 218


  Database: nr
    Posted date:  May 22, 2011 12:22 AM
  Number of letters in database: 999,999,966
  Number of sequences in database:  2,987,313
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 22, 2011 12:30 AM
  Number of letters in database: 999,999,796
  Number of sequences in database:  2,903,041
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 22, 2011 12:36 AM
  Number of letters in database: 999,999,281
  Number of sequences in database:  2,904,016
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 22, 2011 12:41 AM
  Number of letters in database: 999,999,960
  Number of sequences in database:  2,935,328
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 22, 2011 12:46 AM
  Number of letters in database: 842,794,627
  Number of sequences in database:  2,394,679
  
Lambda     K      H
   0.320    0.135    0.393 

Lambda     K      H
   0.267   0.0413    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,481,746,738
Number of Sequences: 14124377
Number of extensions: 53501781
Number of successful extensions: 405371
Number of sequences better than 10.0: 195
Number of HSP's better than 10.0 without gapping: 184
Number of HSP's successfully gapped in prelim test: 256
Number of HSP's that attempted gapping in prelim test: 404498
Number of HSP's gapped (non-prelim): 944
length of query: 80
length of database: 4,842,793,630
effective HSP length: 51
effective length of query: 29
effective length of database: 4,122,450,403
effective search space: 119551061687
effective search space used: 119551061687
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.3 bits)
S2: 75 (33.5 bits)