RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781207|ref|YP_003065620.1| hypothetical protein CLIBASIA_05570 [Candidatus Liberibacter asiaticus str. psy62] (80 letters) >gnl|CDD|34980 COG5421, COG5421, Transposase [DNA replication, recombination, and repair]. Length = 480 Score = 28.7 bits (64), Expect = 0.35 Identities = 10/27 (37%), Positives = 17/27 (62%) Query: 53 LAMHKMREQEEEEKKLLKKGLKKRQKN 79 + ++R + EEEK+L+ K KK+ K Sbjct: 423 ILEWELRTKLEEEKELIPKLKKKKTKR 449 >gnl|CDD|147748 pfam05764, YL1, YL1 nuclear protein. The proteins in this family are designated YL1. These proteins have been shown to be DNA-binding and may be a transcription factor. Length = 238 Score = 27.7 bits (62), Expect = 0.68 Identities = 11/24 (45%), Positives = 15/24 (62%) Query: 56 HKMREQEEEEKKLLKKGLKKRQKN 79 + EQEEE+KK + LKKR+ Sbjct: 204 ERYEEQEEEKKKAKIQALKKRRLY 227 >gnl|CDD|32643 COG2814, AraJ, Arabinose efflux permease [Carbohydrate transport and metabolism]. Length = 394 Score = 26.7 bits (59), Expect = 1.4 Identities = 11/50 (22%), Positives = 20/50 (40%) Query: 1 MGFWNSITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGA 50 + ++ +GA +G + A GWVGAA+ + + A Sbjct: 337 GSLNVAAFNLGIALGAALGGLVLDALGYAATGWVGAALLLLALLLALLSA 386 >gnl|CDD|110170 pfam01148, CTP_transf_1, Cytidylyltransferase family. The members of this family are integral membrane protein cytidylyltransferases. The family includes phosphatidate cytidylyltransferase EC:2.7.7.41 as well as Sec59 from yeast. Sec59 is a dolichol kinase EC:2.7.1.108. Length = 259 Score = 26.2 bits (58), Expect = 1.8 Identities = 11/47 (23%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Query: 9 SIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAM 55 + V AV+ + + L + A + G+ A++VG DL Sbjct: 171 FLGGFVAAVLVGLLFSLLLGPYPSPLHALLLGLLASLVGQ-FGDLVE 216 >gnl|CDD|145855 pfam02919, Topoisom_I_N, Eukaryotic DNA topoisomerase I, DNA binding fragment. Topoisomerase I promotes the relaxation of DNA superhelical tension by introducing a transient single-stranded break in duplex DNA and are vital for the processes of replication, transcription, and recombination. This family may be more than one structural domain. Length = 215 Score = 26.4 bits (59), Expect = 2.0 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 55 MHKMREQEEEEKKLLKKGLKKRQK 78 +++ E E+E+KK + K KK K Sbjct: 91 IYEYFEAEKEKKKAMSKEEKKALK 114 >gnl|CDD|145052 pfam01698, FLO_LFY, Floricaula / Leafy protein. This family consists of various plant development proteins which are homologues of floricaula (FLO) and Leafy (LFY) proteins which are floral meristem identity proteins. Mutations in the sequences of these proteins affect flower and leaf development. Length = 382 Score = 26.1 bits (58), Expect = 2.3 Identities = 12/39 (30%), Positives = 16/39 (41%) Query: 40 GVGAAVVGAGASDLAMHKMREQEEEEKKLLKKGLKKRQK 78 G+ G G L + E+KK KK +KR K Sbjct: 158 AAGSGGGGGGTWGLVGVPGHSSDSEKKKQRKKQRRKRSK 196 >gnl|CDD|34302 COG4685, COG4685, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 571 Score = 25.8 bits (56), Expect = 2.5 Identities = 10/40 (25%), Positives = 14/40 (35%) Query: 9 SIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGA 48 A + V + L W+G A VGAA + Sbjct: 2 GGACSGFPAVLPKHPSMKLTRKKIWIGVAALAVGAAAIVQ 41 >gnl|CDD|144619 pfam01093, Clusterin, Clusterin. Length = 460 Score = 25.8 bits (57), Expect = 2.8 Identities = 10/25 (40%), Positives = 14/25 (56%) Query: 55 MHKMREQEEEEKKLLKKGLKKRQKN 79 M + E+ EEE K L L+K +K Sbjct: 54 MKTLMERTEEEHKNLMSTLEKTKKE 78 >gnl|CDD|144263 pfam00606, Glycoprotein_B, Herpesvirus Glycoprotein B. This family of proteins contains a transmembrane region. Length = 711 Score = 25.6 bits (57), Expect = 3.3 Identities = 14/54 (25%), Positives = 21/54 (38%), Gaps = 12/54 (22%) Query: 3 FWNSITSIAATVGAVVGTVATAAA---------LATPIGWVG---AAVAGVGAA 44 F+ + ++ VG VV VA A L P G + +AG+ A Sbjct: 628 FFQGLGAVGKAVGNVVSGVAGAVGSIVSGVVSFLKNPFGGLLIILLVLAGLVAV 681 >gnl|CDD|146537 pfam03956, DUF340, Membrane protein of unknown function (DUF340). Members of this family contain a conserved core of four predicted transmembrane segments. Some members have an additional pair of N-terminal transmembrane helices. The functions of the proteins in this family are unknown. Length = 191 Score = 25.6 bits (57), Expect = 3.3 Identities = 8/36 (22%), Positives = 17/36 (47%) Query: 7 ITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVG 42 + + +G+++G + A L P+ A +G G Sbjct: 60 LIPLVTILGSLLGGLIAALILGIPLKQGLAVASGFG 95 >gnl|CDD|176857 cd07815, SRPBCC_PITP, Lipid-binding SRPBCC domain of Class I and Class II Phosphatidylinositol Transfer Proteins. This family includes the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain of the phosphatidylinositol transfer protein (PITP) family of lipid transfer proteins. This family of proteins includes Class 1 PITPs (PITPNA/PITPalpha and PITPNB/PITPbeta, Drosophila vibrator and related proteins), Class IIA PITPs (PITPNM1/PITPalphaI/Nir2, PITPNM2/PITPalphaII/Nir3, Drosophila RdgB, and related proteins), and Class IIB PITPs (PITPNC1/RdgBbeta and related proteins). The PITP family belongs to the SRPBCC domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. In vitro, PITPs bind phosphatidylinositol (PtdIns), as well as phosphatidylcholine (PtdCho) but with a lower affinity. They transfer these lipids from one membrane compartment to another. The cellular roles of PITPs include inositol lipid signaling, PtdIns metabolism, and membrane trafficking. Class III PITPs, exemplified by the Sec14p family, are found in yeast and plants but are unrelated in sequence and structure to Class I and II PITPs and belong to a different superfamily. Length = 251 Score = 25.4 bits (56), Expect = 3.9 Identities = 12/23 (52%), Positives = 14/23 (60%) Query: 52 DLAMHKMREQEEEEKKLLKKGLK 74 DL M +RE EEE K+LL K Sbjct: 229 DLTMEDIREFEEETKELLDAKRK 251 >gnl|CDD|147010 pfam04641, Rtf2, Replication termination factor 2. It is vital for effective cell-replication that replication is not stalled at any point by, for instance, damaged bases. Rtf2 stabilizes the replication fork stalled at the site-specific replication barrier RTS1 by preventing replication restart until completion of DNA synthesis by a converging replication fork initiated at a flanking origin. The RTS1 element terminates replication forks that are moving in the cen2-distal direction while allowing forks moving in the cen2-proximal direction to pass through the region. Rtf2 contains a C2HC2 motif related to the C3HC4 RING-finger motif, and would appear to fold up, creating a RING finger-like structure but forming only one functional Zn2+ ion-binding site. Length = 254 Score = 25.4 bits (56), Expect = 4.0 Identities = 13/28 (46%), Positives = 18/28 (64%) Query: 52 DLAMHKMREQEEEEKKLLKKGLKKRQKN 79 ++ + K R +EE KK KK KKR+KN Sbjct: 168 EVELLKARLEEERAKKKKKKKKKKRKKN 195 >gnl|CDD|31474 COG1283, NptA, Na+/phosphate symporter [Inorganic ion transport and metabolism]. Length = 533 Score = 25.2 bits (55), Expect = 4.1 Identities = 12/43 (27%), Positives = 21/43 (48%) Query: 2 GFWNSITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAA 44 G + +I +GA +GT TA +A + W+ + +GA Sbjct: 78 GLLSLKQAIGVILGANIGTTVTAWIVALDLSWLSPPLLAIGAI 120 >gnl|CDD|37807 KOG2596, KOG2596, KOG2596, Aminopeptidase I zinc metalloprotease (M18) [Amino acid transport and metabolism]. Length = 479 Score = 24.9 bits (54), Expect = 4.4 Identities = 7/22 (31%), Positives = 11/22 (50%) Query: 39 AGVGAAVVGAGASDLAMHKMRE 60 + G + G L+MH +RE Sbjct: 427 SKTGIRTLDLGIPQLSMHSIRE 448 >gnl|CDD|119321 cd06579, TM_PBP1_transp_AraH_like, Transmembrane subunit (TM) of Escherichia coli AraH and related proteins. E. coli AraH is the TM of a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of the monosaccharide arabinose. This group also contains E. coli RbsC, AlsC, and MglC, which are TMs of other monosaccharide transporters, the ribose transporter, the D-allose transporter and the galactose transporter, respectively. The D-allose transporter may also be involved in low affinity ribose transport. These transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. Proteins in this subgroup have a single TM which homodimerizes to generate the transmembrane pore.. Length = 263 Score = 25.1 bits (56), Expect = 4.8 Identities = 12/37 (32%), Positives = 16/37 (43%) Query: 14 VGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGA 50 VG+V A AAL + +A + A VGA Sbjct: 24 VGSVAALSAVVAALLLVNAGLPIPLAILAALAVGALI 60 Score = 23.9 bits (53), Expect = 8.7 Identities = 10/43 (23%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Query: 6 SITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGA 48 S+ S+AA V + A L + A A++G Sbjct: 23 SVGSVAALSAVVAALLLVNAGLPI---PLAILAALAVGALIGL 62 >gnl|CDD|30730 COG0381, WecB, UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane]. Length = 383 Score = 24.8 bits (54), Expect = 5.0 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Query: 45 VVGAGASDLAMHKMREQEEEEKKLLKKGLKKRQKNY 80 V G D A+ R++ E+ K+L KGL + K Y Sbjct: 172 VTGNTVID-ALLNTRDRVLEDSKILAKGLDDKDKKY 206 >gnl|CDD|35064 COG5505, COG5505, Predicted integral membrane protein [Function unknown]. Length = 384 Score = 24.5 bits (53), Expect = 6.3 Identities = 10/37 (27%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Query: 4 WNSITSIAAT-VGAVVGTVATAAALATPIGWVGAAVA 39 W + I+ + G A AAL P + A +A Sbjct: 119 WKAGGMISGSYTGGSANMAAMQAALEVPGEYFSATLA 155 >gnl|CDD|35631 KOG0410, KOG0410, KOG0410, Predicted GTP binding protein [General function prediction only]. Length = 410 Score = 24.6 bits (53), Expect = 6.5 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Query: 40 GVGAAVVGAGASDLAMHK---MREQEEEEKKLLKKGLKKRQ 77 G V G+G S + +R +E + +K L++ +KRQ Sbjct: 128 QSGGQVKGSGESIIDRDIRRLLRIKEAQLRKELQRVRRKRQ 168 >gnl|CDD|146981 pfam04600, DUF571, Protein of unknown function (DUF571). Family of hypothetical bacterial proteins. Length = 426 Score = 24.6 bits (54), Expect = 6.6 Identities = 12/52 (23%), Positives = 14/52 (26%) Query: 4 WNSITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAM 55 W + A AA LA P + AAV G A Sbjct: 79 WGPTAARRVAGLAAAAVALAAAGLALPARGATGWLTAAVAAVAGVLLLAAAA 130 >gnl|CDD|30901 COG0555, CysU, ABC-type sulfate transport system, permease component [Posttranslational modification, protein turnover, chaperones]. Length = 274 Score = 24.4 bits (53), Expect = 6.8 Identities = 16/54 (29%), Positives = 24/54 (44%), Gaps = 8/54 (14%) Query: 2 GFWNSITSIAATVGAVVGTVATAAA-------LATPIGWVGAAVAGVGAAVVGA 48 GFW+++TS + A+ T+ TA A P+ WV G +V A Sbjct: 45 GFWSALTS-PRVLAALKLTLLTAFAATLLNLVFGLPLAWVLVRYDFPGKRLVDA 97 >gnl|CDD|146478 pfam03866, HAP, Hydrophobic abundant protein (HAP). Expression of HAP is thought to be developmentally regulated and possibly involved in spherule cell wall formation. Length = 167 Score = 24.5 bits (53), Expect = 6.8 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Query: 14 VGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGA 50 +G V+G VAT AALA + VG +V G+ + A Sbjct: 75 IGTVLGLVATLAALALDL--VGGSVGGICNDFLDFDA 109 >gnl|CDD|34339 COG4723, COG4723, Phage-related protein, tail component [Function unknown]. Length = 198 Score = 24.5 bits (53), Expect = 7.5 Identities = 10/45 (22%), Positives = 14/45 (31%) Query: 7 ITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGAS 51 + V+G A+ T A G A + GAS Sbjct: 86 AGAKKGGFQTVLGAALIVASFFTAGWGAALAAGGFSAMLFSLGAS 130 >gnl|CDD|48065 cd03488, Topoisomer_IB_N_htopoI_like, Topoisomer_IB_N_htopoI_like : N-terminal DNA binding fragment found in eukaryotic DNA topoisomerase (topo) IB proteins similar to the monomeric yeast and human topo I. Topo I enzymes are divided into: topo type IA (bacterial) and type IB (eukaryotic). Topo I relaxes superhelical tension in duplex DNA by creating a single-strand nick, the broken strand can then rotate around the unbroken strand to remove DNA supercoils and, the nick is religated, liberating topo I. These enzymes regulate the topological changes that accompany DNA replication, transcription and other nuclear processes. Human topo I is the target of a diverse set of anticancer drugs including camptothecins (CPTs). CPTs bind to the topo I-DNA complex and inhibit religation of the single-strand nick, resulting in the accumulation of topo I-DNA adducts. This family may represent more than one structural domain.. Length = 215 Score = 24.5 bits (53), Expect = 7.6 Identities = 9/26 (34%), Positives = 13/26 (50%) Query: 54 AMHKMREQEEEEKKLLKKGLKKRQKN 79 M + ++EEKK + K KK K Sbjct: 89 QMFAYFKAQKEEKKAMSKEEKKAIKA 114 >gnl|CDD|145336 pfam02127, Peptidase_M18, Aminopeptidase I zinc metalloprotease (M18). Length = 425 Score = 24.3 bits (53), Expect = 7.7 Identities = 8/22 (36%), Positives = 12/22 (54%) Query: 39 AGVGAAVVGAGASDLAMHKMRE 60 A G + G + L+MH +RE Sbjct: 386 ARTGIRTIDLGPAQLSMHSIRE 407 >gnl|CDD|37213 KOG2002, KOG2002, KOG2002, TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism]. Length = 1018 Score = 24.2 bits (52), Expect = 8.2 Identities = 9/21 (42%), Positives = 14/21 (66%) Query: 57 KMREQEEEEKKLLKKGLKKRQ 77 + R +EEEEK +K K+R+ Sbjct: 855 EARRKEEEEKARREKLEKQRE 875 >gnl|CDD|48064 cd00660, Topoisomer_IB_N, Topoisomer_IB_N: N-terminal DNA binding fragment found in eukaryotic DNA topoisomerase (topo) IB proteins similar to the monomeric yeast and human topo I and heterodimeric topo I from Leishmania donvanni. Topo I enzymes are divided into: topo type IA (bacterial) and type IB (eukaryotic). Topo I relaxes superhelical tension in duplex DNA by creating a single-strand nick, the broken strand can then rotate around the unbroken strand to remove DNA supercoils and, the nick is religated, liberating topo I. These enzymes regulate the topological changes that accompany DNA replication, transcription and other nuclear processes. Human topo I is the target of a diverse set of anticancer drugs including camptothecins (CPTs). CPTs bind to the topo I-DNA complex and inhibit re-ligation of the single-strand nick, resulting in the accumulation of topo I-DNA adducts. In addition to differences in structure and some biochemical properties, Trypanosomatid parasite topo I differ from human topo I in their sensitivity to CPTs and other classical topo I inhibitors. Trypanosomatid topos I play putative roles in organizing the kinetoplast DNA network unique to these parasites. This family may represent more than one structural domain.. Length = 215 Score = 24.0 bits (52), Expect = 8.7 Identities = 9/26 (34%), Positives = 16/26 (61%) Query: 54 AMHKMREQEEEEKKLLKKGLKKRQKN 79 +++ E+E+E+KK + K KK K Sbjct: 89 PIYQYFEEEKEKKKAMSKEEKKAIKE 114 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.313 0.126 0.355 Gapped Lambda K H 0.267 0.0700 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 872,309 Number of extensions: 39544 Number of successful extensions: 449 Number of sequences better than 10.0: 1 Number of HSP's gapped: 432 Number of HSP's successfully gapped: 136 Length of query: 80 Length of database: 6,263,737 Length adjustment: 50 Effective length of query: 30 Effective length of database: 5,183,287 Effective search space: 155498610 Effective search space used: 155498610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 51 (23.5 bits)