RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= gi|254781207|ref|YP_003065620.1| hypothetical protein
CLIBASIA_05570 [Candidatus Liberibacter asiaticus str. psy62]
         (80 letters)



>3dh4_A Sodium/glucose cotransporter; membrane protein, symporter,
           sugar transport, SGLT, ION transport, membrane, sodium
           transport, symport; HET: GAL; 2.70A {Vibrio
           parahaemolyticus} (A:)
          Length = 530

 Score = 26.2 bits (56), Expect = 1.8
 Identities = 8/48 (16%), Positives = 10/48 (20%)

Query: 3   FWNSITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGA 50
           FW   TS  A +G V            P+                   
Sbjct: 418 FWKKTTSKGAIIGVVASIPFALFLKFMPLSMPFMDQMLYTLLFTMVVI 465


>1kcm_A PITP alpha, phosphatidylinositol transfer protein alpha;
           phospholipid binding protein, phospholipid transport;
           2.00A {Mus musculus} (A:)
          Length = 270

 Score = 24.4 bits (53), Expect = 5.5
 Identities = 10/27 (37%), Positives = 14/27 (51%)

Query: 52  DLAMHKMREQEEEEKKLLKKGLKKRQK 78
           DL M  +R  EEE K+ L +  +K   
Sbjct: 237 DLTMDDIRRMEEETKRQLDEMRQKDPV 263


>2b9s_A Topoisomerase I-like protein; vanadate complex,
          isomerase/DNA complex; HET: DNA; 2.27A {Leishmania
          donovani} (A:1-34,A:105-155)
          Length = 85

 Score = 24.0 bits (52), Expect = 6.8
 Identities = 6/24 (25%), Positives = 11/24 (45%)

Query: 55 MHKMREQEEEEKKLLKKGLKKRQK 78
          +++    + E+K    K  KK  K
Sbjct: 37 IYQWHLVQREKKLSRTKEEKKAIK 60


>2axc_A Colicin E7; translocation domain, hydrolase; 1.70A
          {Escherichia coli str} (A:)
          Length = 264

 Score = 24.1 bits (52), Expect = 7.8
 Identities = 11/48 (22%), Positives = 16/48 (33%)

Query: 2  GFWNSITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAG 49
          GF       A T+G  V   A +AA+A     +          +   G
Sbjct: 32 GFPALAAPGAGTLGISVSGEALSAAIADIFAALKGPFKFSAWGIALYG 79


>1ujp_A Tryptophan synthase alpha chain; riken structural
           genomics/proteomics initiative, RSGI, structural
           genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus
           HB8} (A:)
          Length = 271

 Score = 24.1 bits (51), Expect = 8.0
 Identities = 15/65 (23%), Positives = 27/65 (41%), Gaps = 6/65 (9%)

Query: 14  VGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMHKMREQEEEEKKLLKKGL 73
           VG  V   ATAA  A       A    VG+A+V A     ++  + ++  +  + L+   
Sbjct: 207 VGFGVSGKATAAQAA------VADGVVVGSALVRALEEGRSLAPLLQEIRQGLQRLEANP 260

Query: 74  KKRQK 78
             ++ 
Sbjct: 261 GLKES 265


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.313    0.126    0.355 

Gapped
Lambda     K      H
   0.267   0.0678    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 564,985
Number of extensions: 21297
Number of successful extensions: 156
Number of sequences better than 10.0: 1
Number of HSP's gapped: 156
Number of HSP's successfully gapped: 27
Length of query: 80
Length of database: 4,956,049
Length adjustment: 44
Effective length of query: 36
Effective length of database: 3,468,629
Effective search space: 124870644
Effective search space used: 124870644
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 50 (23.1 bits)