RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|254781207|ref|YP_003065620.1| hypothetical protein
CLIBASIA_05570 [Candidatus Liberibacter asiaticus str. psy62]
         (80 letters)



>d1fmja_ c.37.1.5 (A:) Retinol dehydratase {Fall armyworm
          (Spodoptera frugiperda) [TaxId: 7108]}
          Length = 342

 Score = 30.0 bits (66), Expect = 0.055
 Identities = 9/25 (36%), Positives = 12/25 (48%)

Query: 56 HKMREQEEEEKKLLKKGLKKRQKNY 80
          ++ RE   EE KL+K  L      Y
Sbjct: 4  YEFRELNPEEDKLVKANLGAFPTTY 28


>d1k4ta3 e.15.1.1 (A:201-430) Eukaryotic DNA topoisomerase I,
           N-terminal DNA-binding fragment {Human (Homo sapiens)
           [TaxId: 9606]}
          Length = 230

 Score = 27.0 bits (60), Expect = 0.52
 Identities = 6/24 (25%), Positives = 12/24 (50%)

Query: 55  MHKMREQEEEEKKLLKKGLKKRQK 78
           M +  + + E +K + K  K + K
Sbjct: 105 MSQYFKAQTEARKQMSKEEKLKIK 128


>d1v2xa_ c.116.1.1 (A:) tRNA (Gm18) methyltransferase TrmH
          {Thermus thermophilus [TaxId: 274]}
          Length = 191

 Score = 26.5 bits (57), Expect = 0.65
 Identities = 7/22 (31%), Positives = 16/22 (72%)

Query: 58 MREQEEEEKKLLKKGLKKRQKN 79
          MRE+ E  ++ +++ L++RQ +
Sbjct: 1  MRERTEARRRRIEEVLRRRQPD 22


>d1t27a_ d.129.3.4 (A:) Phoshatidylinositol transfer protein, PITP
           {Rat (Rattus norvegicus) [TaxId: 10116]}
          Length = 269

 Score = 25.5 bits (56), Expect = 1.2
 Identities = 10/28 (35%), Positives = 14/28 (50%)

Query: 52  DLAMHKMREQEEEEKKLLKKGLKKRQKN 79
           DL M  +R  EEE K+ L +  +K    
Sbjct: 237 DLTMDDIRRMEEETKRQLDEMRQKDPVK 264


>d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase
           {Pseudomonas putida [TaxId: 303]}
          Length = 201

 Score = 25.6 bits (55), Expect = 1.3
 Identities = 6/29 (20%), Positives = 9/29 (31%), Gaps = 2/29 (6%)

Query: 24  AAALATPIG--WVGAAVAGVGAAVVGAGA 50
              +A  +G   +    A  G     AG 
Sbjct: 159 KINIAEVVGVQVISLDDAPRGYGEFDAGV 187


>d1oisa_ e.15.1.1 (A:) Eukaryotic DNA topoisomerase I, N-terminal
           DNA-binding fragment {Baker's yeast (Saccharomyces
           cerevisiae) [TaxId: 4932]}
          Length = 223

 Score = 25.1 bits (55), Expect = 1.5
 Identities = 7/24 (29%), Positives = 13/24 (54%)

Query: 55  MHKMREQEEEEKKLLKKGLKKRQK 78
           M    + ++E+KK L    KK+ +
Sbjct: 97  MFDYFQLQKEQKKQLTSQEKKQIR 120


>d3b60a2 f.37.1.1 (A:10-328) Multidrug resistance ABC transporter
           MsbA, N-terminal domain {Salmonella typhimurium [TaxId:
           90371]}
          Length = 319

 Score = 24.5 bits (51), Expect = 2.6
 Identities = 8/53 (15%), Positives = 19/53 (35%), Gaps = 4/53 (7%)

Query: 13  TVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMHKMREQEEEE 65
           T G +    ++  AL  P+  +    A     +         +  + + E+E+
Sbjct: 271 TAGTITVVFSSMIALMRPLKSLTNVNAQFQRGMAACQ----TLFAILDSEQEK 319


>d1lj9a_ a.4.5.28 (A:) Transcriptional regulator SlyA {Enterococcus
           faecalis [TaxId: 1351]}
          Length = 144

 Score = 24.2 bits (52), Expect = 3.5
 Identities = 6/19 (31%), Positives = 12/19 (63%)

Query: 54  AMHKMREQEEEEKKLLKKG 72
            + +MR+   E+ + +KKG
Sbjct: 126 YLVRMRKNVSEDWEFVKKG 144


>d2hyda2 f.37.1.1 (A:1-323) Putative multidrug export
           ATP-binding/permease protein SAV1866 {Staphylococcus
           aureus [TaxId: 1280]}
          Length = 323

 Score = 23.7 bits (49), Expect = 4.2
 Identities = 7/36 (19%), Positives = 13/36 (36%)

Query: 13  TVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGA 48
           TVG +   V     L  P+  + A+   +  +    
Sbjct: 276 TVGTLAAFVGYLELLFGPLRRLVASFTTLTQSFASM 311


>d1txoa_ d.219.1.1 (A:) putative serine/threonine phosphatase
          pstp/ppp {Mycobacterium tuberculosis [TaxId: 1773]}
          Length = 235

 Score = 23.7 bits (50), Expect = 4.7
 Identities = 10/36 (27%), Positives = 17/36 (47%), Gaps = 1/36 (2%)

Query: 31 IGWVGAAVA-GVGAAVVGAGASDLAMHKMREQEEEE 65
           G    A+A G+G    G  AS L +  +   +++E
Sbjct: 24 AGARLLALADGMGGHAAGEVASQLVIAALAHLDDDE 59


>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase
          {Thermobifida fusca [TaxId: 2021]}
          Length = 298

 Score = 23.6 bits (50), Expect = 4.7
 Identities = 9/20 (45%), Positives = 12/20 (60%), Gaps = 1/20 (5%)

Query: 43 AAVVGAGASDLAM-HKMREQ 61
            VVGAG S L   +++RE 
Sbjct: 10 VLVVGAGFSGLYALYRLREL 29


>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase
          SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]}
          Length = 335

 Score = 23.5 bits (49), Expect = 5.0
 Identities = 6/12 (50%), Positives = 8/12 (66%)

Query: 44 AVVGAGASDLAM 55
          A++GAG S L  
Sbjct: 8  AIIGAGPSGLVT 19


>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3
          {Mouse (Mus musculus) [TaxId: 10090]}
          Length = 57

 Score = 22.8 bits (49), Expect = 7.5
 Identities = 5/18 (27%), Positives = 10/18 (55%)

Query: 63 EEEKKLLKKGLKKRQKNY 80
            E  L ++ L+K  K++
Sbjct: 6  ASEACLFEEALEKYGKDF 23


>d1vcha1 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase
           TTHA1613 {Thermus thermophilus [TaxId: 274]}
          Length = 174

 Score = 22.7 bits (48), Expect = 8.9
 Identities = 13/47 (27%), Positives = 18/47 (38%), Gaps = 1/47 (2%)

Query: 14  VGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMHKMRE 60
           V  VV +  T  A+   +   G  V     AV   G   LA+  + E
Sbjct: 125 VSDVVASGETMRAMEKMVLRAGGHVVAR-LAVFRQGTPGLAVDTVAE 170


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.313    0.126    0.355 

Gapped
Lambda     K      H
   0.267   0.0344    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 273,235
Number of extensions: 10740
Number of successful extensions: 77
Number of sequences better than 10.0: 1
Number of HSP's gapped: 77
Number of HSP's successfully gapped: 32
Length of query: 80
Length of database: 2,407,596
Length adjustment: 46
Effective length of query: 34
Effective length of database: 1,776,016
Effective search space: 60384544
Effective search space used: 60384544
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 47 (23.0 bits)