RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781209|ref|YP_003065622.1| hypothetical protein CLIBASIA_05580 [Candidatus Liberibacter asiaticus str. psy62] (175 letters) >d1whma_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Score = 27.1 bits (60), Expect = 0.95 Identities = 4/22 (18%), Positives = 10/22 (45%) Query: 92 RCIVARGDTPRPLSLKYIGEVP 113 R + G+T ++ + +P Sbjct: 15 RVSLKVGETIESGTVIFCDVLP 36 >d1dkza2 b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxId: 562]} Length = 118 Score = 26.0 bits (57), Expect = 1.9 Identities = 14/48 (29%), Positives = 23/48 (47%) Query: 72 YIPLKCLKVLNTSEETQLRGRCIVARGDTPRPLSLKYIGEVPLSDCDP 119 IP K +V +T+E+ Q V +G+ R K +G+ L +P Sbjct: 29 TIPTKHSQVFSTAEDNQSAVSIHVLQGERKRAADNKSLGQFNLDGINP 76 >d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Length = 206 Score = 24.0 bits (51), Expect = 7.9 Identities = 5/12 (41%), Positives = 9/12 (75%) Query: 157 VAMDMDGVEIPE 168 +D++GV +PE Sbjct: 5 ACLDLEGVLVPE 16 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.321 0.140 0.437 Gapped Lambda K H 0.267 0.0655 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 668,929 Number of extensions: 28907 Number of successful extensions: 75 Number of sequences better than 10.0: 1 Number of HSP's gapped: 75 Number of HSP's successfully gapped: 4 Length of query: 175 Length of database: 2,407,596 Length adjustment: 79 Effective length of query: 96 Effective length of database: 1,322,926 Effective search space: 127000896 Effective search space used: 127000896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.2 bits)