RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781210|ref|YP_003065623.1| hypothetical protein CLIBASIA_05585 [Candidatus Liberibacter asiaticus str. psy62] (343 letters) >gnl|CDD|34627 COG5022, COG5022, Myosin heavy chain [Cytoskeleton]. Length = 1463 Score = 28.8 bits (64), Expect = 2.0 Identities = 30/154 (19%), Positives = 55/154 (35%), Gaps = 19/154 (12%) Query: 14 EFKKHVELALQETKSKLRPTVTEQATEGEASALVEVFKPTEAHEIVGDMPDTIYNATDQD 73 EF + + +SK R + ++L+ T+ H I P+ + D Sbjct: 586 EFVSTLFDDEENIESKGRFPTLGSRFKESLNSLMSTLNSTQPHYIRCIKPNEEKSPWTFD 645 Query: 74 RRWVGH-------------SQFGWAERIDPFATLDSGINPLLPYASLAT----AAMHRKQ 116 + V S+ G+ R F L P S + Sbjct: 646 NQMVLSQLRCCGVLETIRISRAGFPSRW-TFDEFVQRYRILSPSKSWTGEYTWKEDTKNA 704 Query: 117 DEAILKGMLGVNKKGKIGAETEFFSKENILSAVE 150 ++IL+ ++ + K +IG T+ F K +L+A+E Sbjct: 705 VKSILEELVIDSSKYQIG-NTKVFFKAGVLAALE 737 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.316 0.133 0.384 Gapped Lambda K H 0.267 0.0568 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,993,134 Number of extensions: 206086 Number of successful extensions: 411 Number of sequences better than 10.0: 1 Number of HSP's gapped: 411 Number of HSP's successfully gapped: 2 Length of query: 343 Length of database: 6,263,737 Length adjustment: 95 Effective length of query: 248 Effective length of database: 4,210,882 Effective search space: 1044298736 Effective search space used: 1044298736 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 58 (26.5 bits)