RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781210|ref|YP_003065623.1| hypothetical protein CLIBASIA_05585 [Candidatus Liberibacter asiaticus str. psy62] (343 letters) >gnl|CDD|116521 pfam07909, DUF1663, Protein of unknown function (DUF1663). The members of this family are hypothetical proteins expressed by Trypanosoma cruzi, a eukaryotic parasite that causes Chagas' disease in humans. This region is found as multiple copies per protein. Length = 514 Score = 28.2 bits (61), Expect = 2.9 Identities = 19/83 (22%), Positives = 29/83 (34%), Gaps = 1/83 (1%) Query: 1 MATKEQLATANIYEFKKHVELALQETKSKLRPTVTEQATEGEASALVEVFKPTEAHEIVG 60 + +E A I E L E +S R E+A E A + + E + G Sbjct: 160 LELEEAAAFDEIGEMMFQDRLIQAELRS-ARHEKAEEALAAEEDAAMCILAEEEREDTYG 218 Query: 61 DMPDTIYNATDQDRRWVGHSQFG 83 D I + DRR + + Sbjct: 219 LHRDAIDSEEHADRRRIEAGEAA 241 >gnl|CDD|163089 TIGR02965, xanthine_xdhB, xanthine dehydrogenase, molybdopterin binding subunit. Members of the protein family are the molybdopterin-containing large subunit (or, in, eukaryotes, the molybdopterin-binding domain) of xanthine dehydrogenase, and enzyme that reduces the purine pool by catabolizing xanthine to urate. This model is based primarily on bacterial sequences; it does not manage to include all eukaryotic xanthine dehydrogenases and thereby discriminate them from the closely related enzyme aldehyde dehydrogenase. Length = 758 Score = 27.3 bits (61), Expect = 5.9 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Query: 214 KIEAFAGV-WFINMEKVPG-NDLFPAGTKFPGLIDGKVEY 251 + A GV + +PG ND+ P P L DGKVE+ Sbjct: 52 AVRAAPGVVDVLTAADIPGENDISPIIHDDPLLADGKVEF 91 >gnl|CDD|151595 pfam11152, DUF2930, Protein of unknown function (DUF2930). This family of proteins has no known function. Length = 196 Score = 27.2 bits (61), Expect = 6.5 Identities = 7/26 (26%), Positives = 12/26 (46%), Gaps = 4/26 (15%) Query: 64 DTIYNATDQDRRWVGHSQFGWAERID 89 + T D RW+ GWA+++ Sbjct: 175 WSPRCFTRSDERWIE----GWADKLR 196 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.316 0.133 0.384 Gapped Lambda K H 0.267 0.0696 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 5,500,558 Number of extensions: 349908 Number of successful extensions: 536 Number of sequences better than 10.0: 1 Number of HSP's gapped: 536 Number of HSP's successfully gapped: 8 Length of query: 343 Length of database: 5,994,473 Length adjustment: 94 Effective length of query: 249 Effective length of database: 3,963,321 Effective search space: 986866929 Effective search space used: 986866929 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 57 (25.8 bits)