BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781212|ref|YP_003065625.1| hypothetical protein CLIBASIA_05595 [Candidatus Liberibacter asiaticus str. psy62] (109 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781212|ref|YP_003065625.1| hypothetical protein CLIBASIA_05595 [Candidatus Liberibacter asiaticus str. psy62] Length = 109 Score = 225 bits (573), Expect = 2e-61, Method: Compositional matrix adjust. Identities = 109/109 (100%), Positives = 109/109 (100%) Query: 1 MVNFRKLADMIKSKVLSRGYTVDSDALARQLEEDERRIRHYKHVYSTPEGRFVLTDLMVE 60 MVNFRKLADMIKSKVLSRGYTVDSDALARQLEEDERRIRHYKHVYSTPEGRFVLTDLMVE Sbjct: 1 MVNFRKLADMIKSKVLSRGYTVDSDALARQLEEDERRIRHYKHVYSTPEGRFVLTDLMVE 60 Query: 61 GGLLSSVSNDSAHQLALLEGKRSLAVHIASNCGLSFERIVQMYSDNPRY 109 GGLLSSVSNDSAHQLALLEGKRSLAVHIASNCGLSFERIVQMYSDNPRY Sbjct: 61 GGLLSSVSNDSAHQLALLEGKRSLAVHIASNCGLSFERIVQMYSDNPRY 109 >gi|254780272|ref|YP_003064685.1| ATP-dependent Clp protease proteolytic subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 216 Score = 23.9 bits (50), Expect = 0.83, Method: Compositional matrix adjust. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 45 YSTPEGRFVLTDLMVEGGLLSSVSNDSAHQLALLEGKRSLAVHIASNCGLSFERI 99 ++ P R +L GG S+ H +++ KR L NCG ++E + Sbjct: 128 FALPNARILLHQ--PSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180 >gi|254780694|ref|YP_003065107.1| probable transcriptional regulator protein, LuxR family [Candidatus Liberibacter asiaticus str. psy62] Length = 246 Score = 23.5 bits (49), Expect = 0.96, Method: Compositional matrix adjust. Identities = 9/19 (47%), Positives = 14/19 (73%) Query: 48 PEGRFVLTDLMVEGGLLSS 66 P+GR +L D + E GLL++ Sbjct: 149 PKGRIILRDRLWEIGLLAA 167 >gi|254780787|ref|YP_003065200.1| translation initiation factor IF-2 [Candidatus Liberibacter asiaticus str. psy62] Length = 884 Score = 23.1 bits (48), Expect = 1.4, Method: Compositional matrix adjust. Identities = 6/13 (46%), Positives = 10/13 (76%) Query: 86 VHIASNCGLSFER 98 VH +CG++FE+ Sbjct: 850 VHAGQDCGMAFEK 862 >gi|254780300|ref|YP_003064713.1| aspartate carbamoyltransferase catalytic subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 316 Score = 22.7 bits (47), Expect = 1.7, Method: Compositional matrix adjust. Identities = 9/15 (60%), Positives = 10/15 (66%) Query: 38 IRHYKHVYSTPEGRF 52 IR YKHVYS E + Sbjct: 239 IREYKHVYSLDEKKL 253 >gi|254780648|ref|YP_003065061.1| GTPase ObgE [Candidatus Liberibacter asiaticus str. psy62] Length = 335 Score = 22.3 bits (46), Expect = 2.1, Method: Composition-based stats. Identities = 11/18 (61%), Positives = 13/18 (72%) Query: 16 LSRGYTVDSDALARQLEE 33 LS+ TVDSD LAR+ E Sbjct: 278 LSQIDTVDSDTLARKKNE 295 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.320 0.134 0.372 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,737 Number of Sequences: 1233 Number of extensions: 2238 Number of successful extensions: 8 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of query: 109 length of database: 328,796 effective HSP length: 62 effective length of query: 47 effective length of database: 252,350 effective search space: 11860450 effective search space used: 11860450 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 32 (16.9 bits)