Query         gi|254781214|ref|YP_003065627.1| hypothetical protein CLIBASIA_05605 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 110
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 33803
Date          Wed Jun  1 23:00:27 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781214.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >1vk5_A Expressed protein; str  43.4     5.1 0.00015   20.9  -0.3   41   49-99     20-60  (157)
  2 >1elj_A Maltodextrin-binding p  14.2   1E+02  0.0031   14.0   2.0   26   13-38     53-78  (100)
  3 >2zfd_B Putative uncharacteriz  13.9      70  0.0021   14.9   1.0   18   12-29     12-29  (123)
  4 >3dff_A Teicoplanin pseudoagly  11.8 1.3E+02  0.0037   13.6   1.9   30   63-92     60-89  (273)
  5 >3bl4_A Uncharacterized protei  10.0      62  0.0018   15.2  -0.3   18   85-102    22-39  (48)
  6 >1xdy_A Bacterial sulfite oxid   8.9      87  0.0026   14.4   0.1   26   72-97    164-189 (298)
  7 >3hf5_A 4-methylmuconolactone    8.6 1.4E+02  0.0043   13.2   1.2   16   75-90     25-40  (116)
  8 >2c7n_A Rabex-5, GEF 1, RAB gu   8.1 1.1E+02  0.0032   13.9   0.3   11   49-59     23-33  (74)
  9 >2oqx_A Tryptophanase; lyase,    7.6      73  0.0021   14.8  -0.7   43   61-103   122-168 (207)
 10 >2v7k_A PRNB; heme, IDO, TDO,    7.0   2E+02  0.0059   12.5   1.3   52   27-78     42-104 (138)

No 1  
>>1vk5_A Expressed protein; structural genomics, unknown function, protein structure initiative, center for eukaryotic structural genomics, CESG; HET: CPS; 1.60A {Arabidopsis thaliana} (A:)
Probab=43.39  E-value=5.1  Score=20.94  Aligned_cols=41  Identities=29%  Similarity=0.482  Sum_probs=24.5

Q ss_pred             HHHHCCCHHHCHHHHHCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHHC
Q ss_conf             444215212122477487876612799988664233433025766133304
Q gi|254781214|r   49 GGFFGSSQKEGKKEEEGVRPLEGDELAEVRRQESLRAYEMNRIPIPARRFT   99 (110)
Q Consensus        49 ggffgssqkegkkeeegvrplegdelaevrrqeslrayemnripiparrft   99 (110)
                      .||++-.|+.-..+.         |-+-.||.|-...| |..||||+.|-.
T Consensus        20 d~~~~~~~s~~~~~~---------e~~liRrAEmYQ~Y-MKqiPIP~~~~s   60 (157)
T 1vk5_A           20 DGFSPLDTSHRDVAD---------EGSLLRRAEMYQDY-MKQVPIPTNRGS   60 (157)
T ss_dssp             -------------------------CTTHHHHHHHHHH-HHTSCCCSSCCS
T ss_pred             CCCCCCCCHHHHCCC---------HHHHHHHHHHHHHH-HHHCCCCCCCCC
T ss_conf             278888841320352---------06899999999999-873898856787


No 2  
>>1elj_A Maltodextrin-binding protein; protein-carbohydrate complex, maltose binding protein, MBP fold, ABC transporter fold, thermophilic protein; HET: CME GLC; 1.85A {Pyrococcus furiosus} (A:164-220,A:339-381)
Probab=14.18  E-value=1e+02  Score=13.98  Aligned_cols=26  Identities=23%  Similarity=0.502  Sum_probs=20.1

Q ss_pred             HHHCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             22001111234434678887763123
Q gi|254781214|r   13 SLSSGFKLGSIFGPVGGVIGGLMGGA   38 (110)
Q Consensus        13 slssgfklgsifgpvggvigglmgga   38 (110)
                      ...+|-|.|+++|||.|.|.-.+-..
T Consensus        53 lF~sG~~~~~~~~~~~~~~~~~~~~~   78 (100)
T 1elj_A           53 IFLEGPKMSAVWGGVDGAINEILQDP   78 (100)
T ss_dssp             HHHTTTTHHHHHHHHHHHHHHHHTST
T ss_pred             HHHCCCCHHHHHHHHHHHHHHHHCCC
T ss_conf             76527878999999999999997699


No 3  
>>2zfd_B Putative uncharacterized protein T20L15_90; calcium binding protein, protein-protein complex, ATP- binding, kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} (B:)
Probab=13.92  E-value=70  Score=14.91  Aligned_cols=18  Identities=39%  Similarity=0.584  Sum_probs=13.8

Q ss_pred             HHHHCCCCHHHHHHHHHH
Q ss_conf             122001111234434678
Q gi|254781214|r   12 SSLSSGFKLGSIFGPVGG   29 (110)
Q Consensus        12 sslssgfklgsifgpvgg   29 (110)
                      -|+|+||.|..+|..-..
T Consensus        12 Is~SsG~DLSgLFe~~~~   29 (123)
T 2zfd_B           12 ISGSPGFNLSGLFGDARK   29 (123)
T ss_dssp             HHTSTTSSSGGGGGGGCS
T ss_pred             HHHCCCCCHHHHCCCCCC
T ss_conf             987868883684387666


No 4  
>>3dff_A Teicoplanin pseudoaglycone deacetylases ORF2; lipoglycopeptide, zinc dependent, hydrolase; HET: MSE PG4; 1.60A {Actinoplanes teichomyceticus} PDB: 3dfk_A* 3dfm_A (A:)
Probab=11.77  E-value=1.3e+02  Score=13.56  Aligned_cols=30  Identities=20%  Similarity=0.189  Sum_probs=21.0

Q ss_pred             HHCCCCCCCHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             748787661279998866423343302576
Q gi|254781214|r   63 EEGVRPLEGDELAEVRRQESLRAYEMNRIP   92 (110)
Q Consensus        63 eegvrplegdelaevrrqeslrayemnrip   92 (110)
                      +........++++++|++|..++.++--++
T Consensus        60 ~~~~~~~~~~~~~~~R~~E~~~a~~~lGv~   89 (273)
T 3dff_A           60 HTIWGLAPDDDAVLYRRKEDIAALDHLRVA   89 (273)
T ss_dssp             HHHTTSCTTSCHHHHHHHHHHHHHHHTTCE
T ss_pred             HHHCCCCCHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             442134668899999999999999985997


No 5  
>>3bl4_A Uncharacterized protein; YP_829618.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 2.20A {Arthrobacter SP} (A:77-124)
Probab=10.01  E-value=62  Score=15.19  Aligned_cols=18  Identities=33%  Similarity=0.586  Sum_probs=14.1

Q ss_pred             HHHCCCCCCCHHHHCHHH
Q ss_conf             433025766133304044
Q gi|254781214|r   85 AYEMNRIPIPARRFTSSS  102 (110)
Q Consensus        85 ayemnripiparrftsss  102 (110)
                      ..-+|..|-|+|-|||..
T Consensus        22 ~L~~~~~~cPtryFTse~   39 (48)
T 3bl4_A           22 FLGINAVPCPTKFFTSER   39 (48)
T ss_dssp             HHHHHCCSSCEEEESCHH
T ss_pred             HHHHCCCCCCCCCCCCHH
T ss_conf             997158998732608899


No 6  
>>1xdy_A Bacterial sulfite oxidase; bioinformatics, sequence analysis, electron transfer, oxidoreductase, molybdoenzymes, molybdopterin; HET: MTE; 2.20A {Escherichia coli} (A:)
Probab=8.91  E-value=87  Score=14.39  Aligned_cols=26  Identities=15%  Similarity=0.157  Sum_probs=20.8

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCHHH
Q ss_conf             27999886642334330257661333
Q gi|254781214|r   72 DELAEVRRQESLRAYEMNRIPIPARR   97 (110)
Q Consensus        72 delaevrrqeslrayemnripiparr   97 (110)
                      -.+.++...+.|-||+||--|+|...
T Consensus       164 ipl~~a~~~~vlLAy~mnGepL~~~h  189 (298)
T 1xdy_A          164 LRLDEAMHPLTLMTVGVYGKALPPQN  189 (298)
T ss_dssp             EEHHHHHSTTCEEEEEETTEECCGGG
T ss_pred             EEHHHHCCCCCEEEEEECCEECCHHH
T ss_conf             30789218661776111882787430


No 7  
>>3hf5_A 4-methylmuconolactone methylisomerase; ferredoxin, ferredoxin-like fold, beta-barrel, biodegradation, ortho- cleavage; HET: 3ML; 1.40A {Pseudomonas reinekei} PDB: 3hds_A* 3hfk_A* 2ifx_A* (A:)
Probab=8.64  E-value=1.4e+02  Score=13.23  Aligned_cols=16  Identities=25%  Similarity=0.385  Sum_probs=13.4

Q ss_pred             HHHHHHHHHHHHHCCC
Q ss_conf             9988664233433025
Q gi|254781214|r   75 AEVRRQESLRAYEMNR   90 (110)
Q Consensus        75 aevrrqeslrayemnr   90 (110)
                      .|.-|+|.||.|||..
T Consensus        25 ~e~fr~eclrh~ems~   40 (116)
T 3hf5_A           25 HEQFRKECVVHFQMSA   40 (116)
T ss_dssp             HHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             9999999976448887


No 8  
>>2c7n_A Rabex-5, GEF 1, RAB guanine nucleotide exchange factor 1; protein-binding, ubiquitin binding domain, endocytosis, nuclear protein, polyprotein; 2.1A {Homo sapiens} (A:)
Probab=8.11  E-value=1.1e+02  Score=13.92  Aligned_cols=11  Identities=27%  Similarity=0.827  Sum_probs=8.9

Q ss_pred             HHHHCCCHHHC
Q ss_conf             44421521212
Q gi|254781214|r   49 GGFFGSSQKEG   59 (110)
Q Consensus        49 ggffgssqkeg   59 (110)
                      =||||+...+|
T Consensus        23 CGFyGsp~t~g   33 (74)
T 2c7n_A           23 CGYYGNPAWQG   33 (74)
T ss_dssp             SSSCCCGGGTT
T ss_pred             CCCCCCHHHCC
T ss_conf             88878821077


No 9  
>>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} (A:1-60,A:321-467)
Probab=7.59  E-value=73  Score=14.81  Aligned_cols=43  Identities=21%  Similarity=0.312  Sum_probs=30.4

Q ss_pred             HHHHCCCCCCCHHHHHHHH----HHHHHHHHCCCCCCCHHHHCHHHH
Q ss_conf             4774878766127999886----642334330257661333040444
Q gi|254781214|r   61 KEEEGVRPLEGDELAEVRR----QESLRAYEMNRIPIPARRFTSSSL  103 (110)
Q Consensus        61 keeegvrplegdelaevrr----qeslrayemnripiparrftsssl  103 (110)
                      -.|-|||-.|-.-+..-|.    .+..-..|.-|..||-|-||.|.+
T Consensus       122 Y~e~GIR~~E~Gs~~~grdp~tg~~~~~~~ElvRLAiPRRvYT~~H~  168 (207)
T 2oqx_A          122 YKVAGIRAVEIGSFLLGRDPKTGKQLPCPAELLRLTIPRATYTQTHM  168 (207)
T ss_dssp             HHHHCEECEEESHHHHCBCTTTCSBCCCSCCEEEECCCTTTSCHHHH
T ss_pred             HHHCCCCHHCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCHHHH
T ss_conf             99729820006776533355567767775452798647888999999


No 10 
>>2v7k_A PRNB; heme, IDO, TDO, biosynthetic protein; HET: HEM DTR; 1.7A {Pseudomonas fluorescens} PDB: 2v7j_A* 2v7i_A* 2v7l_A* 2v7m_A* (A:1-120,A:208-225)
Probab=6.98  E-value=2e+02  Score=12.50  Aligned_cols=52  Identities=38%  Similarity=0.515  Sum_probs=33.4

Q ss_pred             HHHHHHHHHH--HHHHHHHHHH---------HHHHHHCCCHHHCHHHHHCCCCCCCHHHHHHH
Q ss_conf             6788877631--2322122344---------44444215212122477487876612799988
Q gi|254781214|r   27 VGGVIGGLMG--GAAGLYSEWD---------TIGGFFGSSQKEGKKEEEGVRPLEGDELAEVR   78 (110)
Q Consensus        27 vggvigglmg--gaaglysewd---------tiggffgssqkegkkeeegvrplegdelaevr   78 (110)
                      |-|++|-|-+  -+.|++|.|+         .||=|.||-...|...-+-|--||---|+-.|
T Consensus        42 v~giv~llr~flp~~~~~s~wgfveaaaamrdigfflgslkrhghepvdvvpglepvlldlar  104 (138)
T 2v7k_A           42 VPGIVGLLREFLPVRGLPSGWGFVEAAAAMRDIGFFLGSLKRHGHEPAEVVPGLEPVLLDLAR  104 (138)
T ss_dssp             HHHHHHHHHTTSCSSCCCTTCCHHHHHHHHHHHHHHHHHHHHTTCCHHHHSTTHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHH
T ss_conf             652999999862103797544729899997405899999860478987557206899998888


Done!