RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781214|ref|YP_003065627.1| hypothetical protein CLIBASIA_05605 [Candidatus Liberibacter asiaticus str. psy62] (110 letters) >d1j20a1 c.26.2.1 (A:1-165) Argininosuccinate synthetase, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 165 Score = 28.6 bits (62), Expect = 0.17 Identities = 12/51 (23%), Positives = 21/51 (41%), Gaps = 4/51 (7%) Query: 45 WDTIGGFFGSSQKEGKKEEEGVRPLEGDELAEVRRQESLRAY-EMNRIPIP 94 F + K + + + P E + R+E + AY E + IP+P Sbjct: 118 KGNDQVRFELTAYALKPDIKVIAPWR--EWSFQGRKE-MIAYAEAHGIPVP 165 >d1vk5a_ a.220.1.1 (A:) Hypothetical protein At3g22680 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 121 Score = 25.7 bits (56), Expect = 1.2 Identities = 9/21 (42%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Query: 77 VRRQESLRAYEMNRIPIPARR 97 +RR E + Y M ++PIP R Sbjct: 4 LRRAEMYQDY-MKQVPIPTNR 23 >d2es4d1 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) {Burkholderia glumae [TaxId: 337]} Length = 280 Score = 24.2 bits (52), Expect = 3.1 Identities = 9/42 (21%), Positives = 18/42 (42%) Query: 46 DTIGGFFGSSQKEGKKEEEGVRPLEGDELAEVRRQESLRAYE 87 + FFG Q+ + + E +R L+ ++ L A + Sbjct: 123 EWAEPFFGDEQRRQRHDLERIRIANDTTLSPEQKAARLAALD 164 >d1t5ja_ a.209.1.1 (A:) Hypothetical protein MJ1187 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 301 Score = 23.7 bits (50), Expect = 4.1 Identities = 8/20 (40%), Positives = 12/20 (60%) Query: 28 GGVIGGLMGGAAGLYSEWDT 47 G V G ++G A G+ +E T Sbjct: 10 GSVFGAVIGDALGMPTENLT 29 >d1urja_ e.58.1.1 (A:) Infected cell protein 8, ICP8 {Herpes simplex virus 1 [TaxId: 10298]} Length = 1122 Score = 23.2 bits (50), Expect = 5.6 Identities = 8/38 (21%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Query: 33 GLMGGAAGLYSEWDTIGGF--FGSSQKEGKKEEEGVRP 68 G+ G +YS+ D +G + F + ++ E Sbjct: 526 GVFGTMNSMYSDCDVLGNYAAFSALKRADGSETARTIM 563 >d2p0va1 a.102.1.8 (A:39-481) Hypothetical protein BT3781 {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 443 Score = 22.8 bits (49), Expect = 8.1 Identities = 6/18 (33%), Positives = 8/18 (44%) Query: 86 YEMNRIPIPARRFTSSSL 103 Y+ NR R F S + Sbjct: 1 YQTNRPEASKRLFVSQEV 18 >d1v54a_ f.24.1.1 (A:) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]} Length = 514 Score = 22.8 bits (49), Expect = 8.9 Identities = 8/34 (23%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Query: 23 IFGPVGGVIGGLMGGAAGLYSEWDTIGGFFGSSQ 56 +FG G++G + + + +E G G Q Sbjct: 21 LFGAWAGMVGTAL--SLLIRAELGQPGTLLGDDQ 52 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.315 0.137 0.390 Gapped Lambda K H 0.267 0.0660 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 402,141 Number of extensions: 16566 Number of successful extensions: 26 Number of sequences better than 10.0: 1 Number of HSP's gapped: 26 Number of HSP's successfully gapped: 8 Length of query: 110 Length of database: 2,407,596 Length adjustment: 69 Effective length of query: 41 Effective length of database: 1,460,226 Effective search space: 59869266 Effective search space used: 59869266 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.0 bits)