BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781214|ref|YP_003065627.1| hypothetical protein CLIBASIA_05605 [Candidatus Liberibacter asiaticus str. psy62] (110 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781214|ref|YP_003065627.1| hypothetical protein CLIBASIA_05605 [Candidatus Liberibacter asiaticus str. psy62] Length = 110 Score = 215 bits (548), Expect = 1e-58, Method: Compositional matrix adjust. Identities = 110/110 (100%), Positives = 110/110 (100%) Query: 1 MSFLDSSVKFGSSLSSGFKLGSIFGPVGGVIGGLMGGAAGLYSEWDTIGGFFGSSQKEGK 60 MSFLDSSVKFGSSLSSGFKLGSIFGPVGGVIGGLMGGAAGLYSEWDTIGGFFGSSQKEGK Sbjct: 1 MSFLDSSVKFGSSLSSGFKLGSIFGPVGGVIGGLMGGAAGLYSEWDTIGGFFGSSQKEGK 60 Query: 61 KEEEGVRPLEGDELAEVRRQESLRAYEMNRIPIPARRFTSSSLLSGVHVR 110 KEEEGVRPLEGDELAEVRRQESLRAYEMNRIPIPARRFTSSSLLSGVHVR Sbjct: 61 KEEEGVRPLEGDELAEVRRQESLRAYEMNRIPIPARRFTSSSLLSGVHVR 110 >gi|255764490|ref|YP_003065085.2| dehydrogenase, E1 component [Candidatus Liberibacter asiaticus str. psy62] Length = 364 Score = 23.5 bits (49), Expect = 1.1, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 3/30 (10%) Query: 69 LEGDELAEVRRQESLRAYEMNRIPIPARRF 98 LEG E++E +++ L AY R+ + RRF Sbjct: 39 LEGFEVSEFNKEQELSAY---RLMLLIRRF 65 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.315 0.137 0.390 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,791 Number of Sequences: 1233 Number of extensions: 2480 Number of successful extensions: 10 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of query: 110 length of database: 328,796 effective HSP length: 63 effective length of query: 47 effective length of database: 251,117 effective search space: 11802499 effective search space used: 11802499 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 32 (16.9 bits)