HHsearch alignment for GI: 254781215 and conserved domain: COG1111

>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair].
Probab=98.05  E-value=9.3e-05  Score=48.59  Aligned_cols=170  Identities=16%  Similarity=0.129  Sum_probs=92.0

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHH
Q ss_conf             55784589999999999987405655542101246502576597899999999999808996699980858999999999
Q gi|254781215|r   47 GFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWA  126 (511)
Q Consensus        47 ~~~~P~~WQ~e~l~~i~~~~~~~~~~~~~~~~r~aV~sgrG~GKS~l~a~l~lw~l~~~p~~kv~vtApt~~Q~~~ilw~  126 (511)
T Consensus        12 ~~ie~R~YQ~~i~a~al~~-------------NtLvvlPTGLGKT~IA~~V~~~~l~~~~~-kvlfLAPTKPLV~Qh~-~   76 (542)
T COG1111          12 NTIEPRLYQLNIAAKALFK-------------NTLVVLPTGLGKTFIAAMVIANRLRWFGG-KVLFLAPTKPLVLQHA-E   76 (542)
T ss_pred             CCCCHHHHHHHHHHHHHHC-------------CEEEEECCCCCHHHHHHHHHHHHHHHCCC-EEEEECCCCHHHHHHH-H
T ss_conf             5325889999999998644-------------83899528750799999999999874588-4899658951799999-9


Q ss_pred             HHHHHHHHCHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCHHHHCCC-CCCEEEEECCHHC-CC
Q ss_conf             999999855000134443222222333444321112357861698530357556100212026-7614999711102-99
Q gi|254781215|r  127 EVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHN-TYGMAIINDEASG-TP  204 (511)
Q Consensus       127 Ei~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~ea~~G~h~-~~~~lvI~DEAsg-I~  204 (511)
T Consensus        77 ~~~~v~~ip~~--~i~~ltGev~p~~------R~~~w~~~kVfvaTPQvveN---Dl~~Grid~~dv~~lifDEAHRAvG  145 (542)
T COG1111          77 FCRKVTGIPED--EIAALTGEVRPEE------REELWAKKKVFVATPQVVEN---DLKAGRIDLDDVSLLIFDEAHRAVG  145 (542)
T ss_pred             HHHHHHCCCHH--HEEEECCCCCHHH------HHHHHHHCCEEEECCHHHHH---HHHCCCCCHHHCEEEEECHHHHCCC
T ss_conf             99998589843--3231117778688------99987517789956387776---8761766767805898623554137


Q ss_pred             HHHH-HHHHHHHCCCCCCEEEEEECCCCCCCCHHHHHHH
Q ss_conf             7889-8888885079981389982389987655676530
Q gi|254781215|r  205 DVIN-LGILGFLTERNANRFWIMTSNPRRLSGKFYEIFN  242 (511)
Q Consensus       205 d~i~-e~i~~~Lt~~g~~~~~i~~~nP~~~~g~fy~~~~  242 (511)
T Consensus       146 nyAYv~Va~~y~~~~k~~~ilgLTASPGs~~ekI~eV~~  184 (542)
T COG1111         146 NYAYVFVAKEYLRSAKNPLILGLTASPGSDLEKIQEVVE  184 (542)
T ss_pred             CCHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHH
T ss_conf             606999999999825684379872389998799999998