HHsearch alignment for GI: 254781215 and conserved domain: COG1205

>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only].
Probab=97.14  E-value=0.0093  Score=36.00  Aligned_cols=165  Identities=16%  Similarity=0.111  Sum_probs=93.4

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHH
Q ss_conf             45899999999999874056555421012465025765978999999999998089966999808589999999999999
Q gi|254781215|r   51 PRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSK  130 (511)
Q Consensus        51 P~~WQ~e~l~~i~~~~~~~~~~~~~~~~r~aV~sgrG~GKS~l~a~l~lw~l~~~p~~kv~vtApt~~Q~~~ilw~Ei~k  130 (511)
T Consensus        71 lY~HQ~~A~~~~~~G------~------~vvVtTgTgSGKTe~FllPIld~~l~~~~a~AL~lYPtnALa~DQ~-~rl~~  137 (851)
T COG1205          71 LYSHQVDALRLIREG------R------NVVVTTGTGSGKTESFLLPILDHLLRDPSARALLLYPTNALANDQA-ERLRE  137 (851)
T ss_pred             CCHHHHHHHHHHHCC------C------CEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECHHHHHHHHH-HHHHH
T ss_conf             007799999999779------9------8899789988545898999999983086650899804377676699-99999


Q ss_pred             HHHHCHHCCCCCCCCCCCCCCCCCCCC--CCC-CCCCCCCEEEEEECC-----CCCCCCCHHHHCCCCCCEEEEECCHHC
Q ss_conf             998550001344432222223334443--211-123578616985303-----575561002120267614999711102
Q gi|254781215|r  131 WLSLLPNKHWFEMQSLSLHPAPWYSDV--LHC-SLGIDSKHYSTMCRT-----YSEERPDTFVGHHNTYGMAIINDEASG  202 (511)
Q Consensus       131 ~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~-~~~~~~~~~~~~~~~-----~s~~~~ea~~G~h~~~~~lvI~DEAsg  202 (511)
T Consensus       138 ~~~~~~~~v~~---------~~y~Gdt~~~~r~~~~~~pp~IllTNpdMLh~~llr~~~~~~~~~~--~Lk~lVvDElHt  206 (851)
T COG1205         138 LISDLPGKVTF---------GRYTGDTPPEERRAIIRNPPDILLTNPDMLHYLLLRNHDAWLWLLR--NLKYLVVDELHT  206 (851)
T ss_pred             HHHHCCCCEEE---------EEECCCCCHHHHHHHHHCCCCEEEECHHHHHHHHHCCCCCHHHHHH--CCCEEEEECCEE
T ss_conf             99847875135---------4434889678889987389978983889998986368822788873--275899844412


Q ss_pred             CCH----HHHHHH---HHHHCCCCCCEEEEEECCCCCCCCHHHH
Q ss_conf             997----889888---8885079981389982389987655676
Q gi|254781215|r  203 TPD----VINLGI---LGFLTERNANRFWIMTSNPRRLSGKFYE  239 (511)
Q Consensus       203 I~d----~i~e~i---~~~Lt~~g~~~~~i~~~nP~~~~g~fy~  239 (511)
T Consensus       207 YrGv~GS~vA~llRRL~~~~~~~~~~~q~i~~SAT~~np~e~~~  250 (851)
T COG1205         207 YRGVQGSEVALLLRRLLRRLRRYGSPLQIICTSATLANPGEFAE  250 (851)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHH
T ss_conf             15603788999999999997245899628998312468288999