HHsearch alignment for GI: 254781215 and conserved domain: COG4373

>COG4373 Mu-like prophage FluMu protein gp28 [General function prediction only].
Probab=99.58  E-value=5.7e-12  Score=94.11  Aligned_cols=364  Identities=18%  Similarity=0.191  Sum_probs=212.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHH---CCCCEEEEEECCHHHHHHHHHHHHHHHHHHCHHCCCCCCCCCCCCCCCC--
Q ss_conf             24650257659789999999999980---8996699980858999999999999999855000134443222222333--
Q gi|254781215|r   79 KGAISAGRGIGKTTLNAWLVLWLMST---RPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPW--  153 (511)
Q Consensus        79 r~aV~sgrG~GKS~l~a~l~lw~l~~---~p~~kv~vtApt~~Q~~~ilw~Ei~k~~~~~~~~~~~~~~~~~~~~~~~--  153 (511)
T Consensus        31 kIAEK-SRRtGlTwaeA~~dV~~Aak~k~eGG~dVfy~gs~~emArEyI-~acamwar~fN------~~A~d~~E~~f~d  102 (509)
T COG4373          31 KIAEK-SRRTGLTWAEAYEDVRDAAKPKREGGMDVFYSGSDLEMAREYI-RACAMWARIFN------VVATDLGEVVFED  102 (509)
T ss_pred             EHHHH-CCCCCCCHHHHHHHHHHHHCCCCCCCCEEEEECCCHHHHHHHH-HHHHHHHHHHH------HHHHHHHHHHHCC
T ss_conf             15353-0102642888777898752112258852588447489999999-99999999998------8877777876447


Q ss_pred             --CCCCCCCCCCCCCCEEEEEECCCCCCCCCHHHHCCCCCCEEEEECCHHCCC--HHHHHHHHHHHCCCCCCEEEEEECC
Q ss_conf             --444321112357861698530357556100212026761499971110299--7889888888507998138998238
Q gi|254781215|r  154 --YSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTP--DVINLGILGFLTERNANRFWIMTSN  229 (511)
Q Consensus       154 --~~~~~~~~~~~~~~~~~~~~~~~s~~~~ea~~G~h~~~~~lvI~DEAsgI~--d~i~e~i~~~Lt~~g~~~~~i~~~n  229 (511)
T Consensus       103 ~dk~~Iltyvi~FasG-fkI~AL-S--SnPknlRg~qG~----VviDEaAFHE~ldEllkAA~a-ltmWGa~vRvi--St  171 (509)
T COG4373         103 SDKSAILTYVIAFASG-FKITAL-S--SNPKNLRGKQGK----VVIDEAAFHEDLDELLKAAAA-LTMWGAPVRVI--ST  171 (509)
T ss_pred             CCHHHHHHHHEEECCC-CEEEEC-C--CCCCCCCCCCCC----EEEEHHHHHHHHHHHHHHHHH-HHHCCCCEEEE--EC
T ss_conf             8756556730320477-467660-4--797455467884----886236656539999998778-76517724899--62


Q ss_pred             CCCCCCHHHHHHH---CCCCCCEEEEECCCC--------------CCCCCHHHHHHHH----HHCCCCHHHHHHHHCCCC
Q ss_conf             9987655676530---352474179840433--------------6778977899999----751898013544431756
Q gi|254781215|r  230 PRRLSGKFYEIFN---KPLDDWKRFQIDTRT--------------VEGIDPSFHEGII----ARYGLDSDVTRVEVCGQF  288 (511)
Q Consensus       230 P~~~~g~fy~~~~---~~~~~w~~~~i~~~~--------------~p~~~~~~ie~~~----~~~geds~~~r~evlgeF  288 (511)
T Consensus       172 HNGvDnlFnQ~iQear~grk~ysvH~iTldDAiadGLy~RIc~v~~~~w~pE~Ea~w~a~l~~~a~t~-eda~eEy~C~-  249 (509)
T COG4373         172 HNGVDNLFNQMIQEARQGRKKYSVHSITLDDAIADGLYERICNVDRPAWAPEVEAKWLAELRAIAGTD-EDAQEEYMCN-  249 (509)
T ss_pred             CCCHHHHHHHHHHHHHCCCCCCEEEEEEHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCC-HHHHHHHCCC-
T ss_conf             68701789999999870255531788865777777899999826774567567889999888656981-4457762877-


Q ss_pred             CCCCCCEEECHHHHHHHHHCCCC------------------------------------CCCCCEEEEEEECCCCCCCCE
Q ss_conf             66678737559999886407653------------------------------------189970899962333478417
Q gi|254781215|r  289 PQQDIDSFIPLNIIEEALNREPC------------------------------------PDPYAPLIMGCDIAEEGGDNT  332 (511)
Q Consensus       289 p~~~~~~~i~~~~ie~a~~r~~~------------------------------------~~~~~~~viGvDVAr~G~D~s  332 (511)
T Consensus       250 Pk~s~gAYIphalie~a~~~~vp~l~fe~~~~f~~~~~~~r~~~~~~~cl~~l~P~Lqalnp~~r~~fGvDfaR~~-DLs  328 (509)
T COG4373         250 PKDSTGAYIPHALIEAAVAAEVPDLIFELGSEFHDIPAWLRESEVLTWCLPDLRPALQALNPGGRLYFGVDFARKR-DLS  328 (509)
T ss_pred             CCCCCCCCCCHHHHHHHHHCCCCCEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEECCCCCCCC-CCE
T ss_conf             5667766466789998875479851797574554235664245666653443568987329997165212202256-734


Q ss_pred             EEEEEC--CC----EEEEEEECCCCCHHHHHHHHHHHHHHCCCCE--EEEEECCCCHHHHHHH-HHCCCE-EEEECCCCC
Q ss_conf             999822--75----5899873277898899999999998618882--9980068763688989-864982-798427777
Q gi|254781215|r  333 VVVLRR--GP----VIEHLFDWSKTDLRTTNNKISGLVEKYRPDA--IIIDANNTGARTCDYL-EMLGYH-VYRVLGQKR  402 (511)
Q Consensus       333 vi~~r~--G~----~v~~~~~~~~~d~~~~a~~i~~~~~~~~~~~--i~iD~~GvG~gV~d~L-~~~g~~-v~~v~~~~~  402 (511)
T Consensus       329 v~~v~e~~~dta~r~v~~le-i~n~pY~qq-~qvmm~ll~~lP~l~gAafDaTGnGgyLAEaAl~~fGs~~v~~V~lneK  406 (509)
T COG4373         329 VLWVWEKVGDTAWRAVVELE-IVNFPYQQQ-EQVMMWLLHLLPMLTGAAFDATGNGGYLAEAALEDFGSEKVTKVTLNEK  406 (509)
T ss_pred             EEEEEEECCCHHHHHEEEEE-EECCCHHHH-HHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCEEEEEECHH
T ss_conf             99987445523522245898-624864678-9999999986366631223265760476789998627102256762788


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHCC--CCCHHHHHHHHHCCCEEEECCCCEEEEEEC-HHHCCCCCCHHHHHHHHHC
Q ss_conf             66402552279999999999997089--998189999985796799879984999841-2548999898999999975
Q gi|254781215|r  403 AVDLEFCRNRRTELHVKMADWLEFAS--LINHSGLIQNLKSLKSFIVPNTGELAIESK-RVKGAKSTDYSDGLMYTFA  477 (511)
Q Consensus       403 ~~~~~~y~N~rae~~~~~re~l~~g~--l~~d~~l~~el~~~~~~~~~~~gki~ie~K-kkrg~~SPD~ADAl~l~fa  477 (511)
T Consensus       407 w---------y~ewmpk~Ka~~Ed~~i~~p~~~~v~~D~~hi~v--~ng~P~idk~r~kd~~a~rHgD~avA~cma~R  473 (509)
T COG4373         407 W---------YKEWMPKFKAALEDSSIRLPGTAVVRADFKHIRV--TNGSPSIDKLRKKDRDADRHGDRAVAACMARR  473 (509)
T ss_pred             H---------HHHHHHHHHHHHCCCCEECCCCEEEECCCCCEEE--ECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             8---------8766377786513462334785035101252588--53787644011245444332178999998