HHsearch alignment for GI: 254781215 and conserved domain: KOG0949

>KOG0949 consensus.
Probab=93.40  E-value=0.17  Score=27.97  Aligned_cols=69  Identities=25%  Similarity=0.363  Sum_probs=44.0

Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHH
Q ss_conf             57845899999999999874056555421012465025765978999999999998089966999808589999999999
Q gi|254781215|r   48 FSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAE  127 (511)
Q Consensus        48 ~~~P~~WQ~e~l~~i~~~~~~~~~~~~~~~~r~aV~sgrG~GKS~l~a~l~lw~l~~~p~~kv~vtApt~~Q~~~ilw~E  127 (511)
T Consensus       510 F~-Pd~WQ~elLDsvDr~e------------SavIVAPTSaGKTfisfY~iEKVLResD~~VVIyvaPtKaLVnQv-sa~  575 (1330)
T KOG0949         510 FC-PDEWQRELLDSVDRNE------------SAVIVAPTSAGKTFISFYAIEKVLRESDSDVVIYVAPTKALVNQV-SAN  575 (1330)
T ss_pred             CC-CCHHHHHHHHHHHCCC------------CEEEEEECCCCCEECCHHHHHHHHHHCCCCEEEEECCHHHHHHHH-HHH
T ss_conf             69-8388887766550566------------259982046786100589999998542798799966458776666-677


Q ss_pred             HHH
Q ss_conf             999
Q gi|254781215|r  128 VSK  130 (511)
Q Consensus       128 i~k  130 (511)
T Consensus       576 Vya  578 (1330)
T KOG0949         576 VYA  578 (1330)
T ss_pred             HHH
T ss_conf             887