HHsearch alignment for GI: 254781215 and conserved domain: PRK05564

>PRK05564 DNA polymerase III subunit delta'; Validated.
Probab=96.28  E-value=0.081  Score=30.05  Aligned_cols=151  Identities=11%  Similarity=0.104  Sum_probs=83.4

Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCC---CEEEEEECCHHHHHHHHHHHHHHH
Q ss_conf             99999999998740565554210124650257659789999999999980899---669998085899999999999999
Q gi|254781215|r   55 QLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPG---ISVICLANSETQLKTTLWAEVSKW  131 (511)
Q Consensus        55 Q~e~l~~i~~~~~~~~~~~~~~~~r~aV~sgrG~GKS~l~a~l~lw~l~~~p~---~kv~vtApt~~Q~~~ilw~Ei~k~  131 (511)
T Consensus         9 q~~i~~~L~~~i~~~rl~H-----AyLF~Gp~G~GK~~~A~~~A~~ll~~~~~~~~~D~~~~~~~~~~~--I~vd~IR~l   81 (313)
T PRK05564          9 HENIKNRIDNSIIKGKFSH-----ASLIVGEDGIGKSILAKEIANKILGKSEQREYVDIIEYKPINKKS--IGVDDIRNI   81 (313)
T ss_pred             HHHHHHHHHHHHHCCCCCC-----EEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCEEEEECCCCCC--CCHHHHHHH
T ss_conf             2999999999998799875-----043279998509999999999982899778898658863322569--998999999


Q ss_pred             HHHCHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCHHHHCCCCCCEEEEECCHHCCCHHHHHHH
Q ss_conf             98550001344432222223334443211123578616985303575561002120267614999711102997889888
Q gi|254781215|r  132 LSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGI  211 (511)
Q Consensus       132 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~ea~~G~h~~~~~lvI~DEAsgI~d~i~e~i  211 (511)
T Consensus        82 ~~~~-----------------------------------------------~~~p~~g~~K-V~II~~ae~m~~~AaNAL  113 (313)
T PRK05564         82 IEEV-----------------------------------------------NKKPYEGDKK-VIIIYKSEKMTEQAQNAF  113 (313)
T ss_pred             HHHH-----------------------------------------------HHCCCCCCCE-EEEECCHHHHCHHHHHHH
T ss_conf             9998-----------------------------------------------4086258956-999807777589999998


Q ss_pred             HHHHCCCCCCEEEE-EECCCCCCCCHHHHHHHCCCCCCEEEEECCCCCCCCCHHHHHHHHHH
Q ss_conf             88850799813899-82389987655676530352474179840433677897789999975
Q gi|254781215|r  212 LGFLTERNANRFWI-MTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIAR  272 (511)
Q Consensus       212 ~~~Lt~~g~~~~~i-~~~nP~~~~g~fy~~~~~~~~~w~~~~i~~~~~p~~~~~~ie~~~~~  272 (511)
T Consensus       114 LKtLEEPP~~t~fIL~t~~~~~lLpTI~SRCQ~-------~~-----f~~l~~~~i~~~L~~  163 (313)
T PRK05564        114 LKTIEEPPKGVFIILLCENLEQILDTIKSRCQI-------YK-----LNRLSKEDIEKFISY  163 (313)
T ss_pred             HHCCCCCCCCEEEEEEECCHHHCCCHHHCCCEE-------EE-----CCCCCHHHHHHHHHH
T ss_conf             455036899858998649835475778706535-------66-----899899999999998