HHsearch alignment for GI: 254781215 and conserved domain: PRK08699

>PRK08699 DNA polymerase III subunit delta'; Validated.
Probab=95.13  E-value=0.23  Score=27.19  Aligned_cols=183  Identities=13%  Similarity=0.098  Sum_probs=86.5

Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCC-EEEEEEC-CHHHHHHHHHHHHHHH
Q ss_conf             9999999999987405655542101246502576597899999999999808996-6999808-5899999999999999
Q gi|254781215|r   54 WQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGI-SVICLAN-SETQLKTTLWAEVSKW  131 (511)
Q Consensus        54 WQ~e~l~~i~~~~~~~~~~~~~~~~r~aV~sgrG~GKS~l~a~l~lw~l~~~p~~-kv~vtAp-t~~Q~~~ilw~Ei~k~  131 (511)
T Consensus         5 W~~~~w~~l~~~~~r-----l~H--A~L~~Gp~G~Gk~~~A~~~A~~llC~~~~~~~~~Cg~C~sC~~~~----------   67 (325)
T PRK08699          5 WHQEQWRQIAEHWER-----RPN--AWLFVGKKGTGKTAFARFAAKALLCETPAPGCKPCGECMSCHLFG----------   67 (325)
T ss_pred             CCHHHHHHHHHHCCC-----CCE--EEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHH----------
T ss_conf             457999999983445-----011--797579999789999999999982899988899898888899986----------


Q ss_pred             HHHCHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCHHHHCCCCCCEEEEECCHHCCCHHHHHHH
Q ss_conf             98550001344432222223334443211123578616985303575561002120267614999711102997889888
Q gi|254781215|r  132 LSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGI  211 (511)
Q Consensus       132 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~ea~~G~h~~~~~lvI~DEAsgI~d~i~e~i  211 (511)
T Consensus        68 ~g~HPD~~~i~p~~~~~-~~g~~----~~~I~id------qiR~l~~--~~~~~~~~~~~k-V~ii~~ae~mn~~aaNaL  133 (325)
T PRK08699         68 QGSHPDFYEITPLADEP-ENGRK----LLQIKID------AVREIID--NVYLTSVRGGLR-VILIHPAESMNVQAANSL  133 (325)
T ss_pred             CCCCCCEEEEECCCCCC-CCCCC----CCCCCHH------HHHHHHH--HHCCCCCCCCCE-EEEECCHHHHCHHHHHHH
T ss_conf             59999968851344530-01665----5667699------9999999--971086568946-999857777589999999


Q ss_pred             HHHHCCCCCCE-EEEEECCCCCCCCHHHHHHHCCCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCHHH
Q ss_conf             88850799813-899823899876556765303524741798404336778977899999751898013
Q gi|254781215|r  212 LGFLTERNANR-FWIMTSNPRRLSGKFYEIFNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDV  279 (511)
Q Consensus       212 ~~~Lt~~g~~~-~~i~~~nP~~~~g~fy~~~~~~~~~w~~~~i~~~~~p~~~~~~ie~~~~~~geds~~  279 (511)
T Consensus       134 LK~LEEPp~~~~fiL~t~~~~~llpTI~SRc~~------------~~~~~p~~~~~~~~L~~~gv~~~~  190 (325)
T PRK08699        134 LKVLEEPPPQVVFLLVSHAADKVLPTIKSRCRK------------MVLPAPSHEEALAYLRERGVAEPE  190 (325)
T ss_pred             HHHHCCCCCCEEEEEEECCHHHCCCHHHHCCCC------------CCCCCCCHHHHHHHHHHCCCCCHH
T ss_conf             998417888848999879846462339864542------------108995999999999974897678