HHsearch alignment for GI: 254781215 and conserved domain: PRK11448

>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional.
Probab=97.29  E-value=0.014  Score=34.94  Aligned_cols=66  Identities=18%  Similarity=0.200  Sum_probs=48.8

Q ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCH---HHHHH
Q ss_conf             84589999999999987405655542101246502576597899999999999808996699980858---99999
Q gi|254781215|r   50 APRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSE---TQLKT  122 (511)
Q Consensus        50 ~P~~WQ~e~l~~i~~~~~~~~~~~~~~~~r~aV~sgrG~GKS~l~a~l~lw~l~~~p~~kv~vtApt~---~Q~~~  122 (511)
T Consensus       416 ~lR~YQ~~AI~~v~~a~~~~~-------rraLl~MATGTGKTrtaial~~rLlk~~~~kRILFLvDR~~L~~QA~~  484 (1126)
T PRK11448        416 GLRYYQEDAIQAVEKALANGQ-------REILLAMATGTGKTRTAIALMYRLLKAKRFKRILFLVDRRALGEQALD  484 (1126)
T ss_pred             CCCHHHHHHHHHHHHHHHCCC-------CCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHH
T ss_conf             786889999999999998098-------546887248885898999999999965876725798565899999999