HHsearch alignment for GI: 254781215 and conserved domain: PRK13826

>PRK13826 Dtr system oriT relaxase; Provisional.
Probab=96.36  E-value=0.051  Score=31.32  Aligned_cols=132  Identities=18%  Similarity=0.082  Sum_probs=69.1

Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCEEEEEE-CCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHH
Q ss_conf             8999999999998740565554210124650-257659789999999999980899669998085899999999999999
Q gi|254781215|r   53 SWQLEFMEVVDAHCLNSVNNPNPEVFKGAIS-AGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKW  131 (511)
Q Consensus        53 ~WQ~e~l~~i~~~~~~~~~~~~~~~~r~aV~-sgrG~GKS~l~a~l~lw~l~~~p~~kv~vtApt~~Q~~~ilw~Ei~k~  131 (511)
T Consensus       384 ~EQ~~Av~hiT~~------------~~Ia~VvG~AGaGKStmL~aAReawEa--~GyrV~GaALsGkAAegL-e~~----  444 (1102)
T PRK13826        384 DEQKTAIEHVAGA------------ERIAAVIGRAGAGKTTMMKAAREAWEA--AGYRVVGGALAGKAAEGL-EKE----  444 (1102)
T ss_pred             HHHHHHHHHHCCC------------CCEEEEEECCCCCHHHHHHHHHHHHHH--CCCEEEEECCCHHHHHHH-HHC----
T ss_conf             9999999985378------------866899842888788999999999997--797798015007899977-534----


Q ss_pred             HHHCHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCHHHHCCCCCCEEEEECCHHCCCHHHHHHH
Q ss_conf             98550001344432222223334443211123578616985303575561002120267614999711102997889888
Q gi|254781215|r  132 LSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGI  211 (511)
Q Consensus       132 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~ea~~G~h~~~~~lvI~DEAsgI~d~i~e~i  211 (511)
T Consensus       445 -------sGI~SrTlAs~e~~w~~g--------------------------r-~~L~-~-~dVlVIDEAGMVgsrqmarv  488 (1102)
T PRK13826        445 -------AGIASRTLSSWELRWNQG--------------------------R-DQLD-N-KTVFVLDEAGMVSSRQMALF  488 (1102)
T ss_pred             -------CCCCCHHHHHHHHHHCCC--------------------------C-CCCC-C-CCEEEEECCCCCCHHHHHHH
T ss_conf             -------695303389999874358--------------------------6-5567-8-73899845556557999999


Q ss_pred             HHHHCCCCCCEEEEEECC-----CCCCCCHHHHHH
Q ss_conf             888507998138998238-----998765567653
Q gi|254781215|r  212 LGFLTERNANRFWIMTSN-----PRRLSGKFYEIF  241 (511)
Q Consensus       212 ~~~Lt~~g~~~~~i~~~n-----P~~~~g~fy~~~  241 (511)
T Consensus       489 l~~ae~aGAKv--VLVGD~~QLQpIeAGaaFrai~  521 (1102)
T PRK13826        489 VEAVTRAGAKL--VLVGDPEQLQPIEAGAAFRAIA  521 (1102)
T ss_pred             HHHHHHCCCEE--EEECCHHHHCCCCCCHHHHHHH
T ss_conf             99999759989--9968878827610468899999