HHsearch alignment for GI: 254781215 and conserved domain: TIGR01969

>TIGR01969 minD_arch cell division ATPase MinD; InterPro: IPR010224 Proper placement of the bacterial cell division site requires the site-specific inactivation of other potential division sites. In Escherichia coli, selection of the correct mid-cell site is mediated by the MinC, MinD and MinE proteins. Several members of this family are found in archaeal genomes but their function is uncharacterised. More distantly related proteins include flagellar biosynthesis proteins and ParA chromosome partitioning proteins. This entry represents the archaeal MinD family. The exact roles of the various archaeal MinD homologs are unknown. .
Probab=91.64  E-value=0.17  Score=28.05  Aligned_cols=188  Identities=16%  Similarity=0.118  Sum_probs=93.9

Q ss_pred             EEEEECCC-CCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHHHH---CHHCCCCCCCCCCCCCCCCC
Q ss_conf             24650257-659789999999999980899669998085899999999999999985---50001344432222223334
Q gi|254781215|r   79 KGAISAGR-GIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSL---LPNKHWFEMQSLSLHPAPWY  154 (511)
Q Consensus        79 r~aV~sgr-G~GKS~l~a~l~lw~l~~~p~~kv~vtApt~~Q~~~ilw~Ei~k~~~~---~~~~~~~~~~~~~~~~~~~~  154 (511)
T Consensus         2 ~I~iASGKGGtGKTT~tANLgVALA~~--Gk~V~~~DADI~MA------NL~LiLgmE~~~VTLhDVLAGeA~i~DAIY~   73 (258)
T TIGR01969         2 IITIASGKGGTGKTTITANLGVALAKL--GKKVLVLDADITMA------NLELILGMEDKPVTLHDVLAGEADIKDAIYE   73 (258)
T ss_pred             EEEEEECCCCCCHHHEEEHHHHHHHHC--CCEEEEEECCHHHH------HHHHHHCCCCCCCCCCCCCCCCCCHHHHCCC
T ss_conf             889997788986140000077889860--97689994676677------6898844688896752213445610011002


Q ss_pred             CCCCCCCCCCCCCEEEEEECCCCCCCCCHHHHCCCCCCEEEEECCHHCCCHHHHHHHHHHHCCCCCCEEEEEECCCCCCC
Q ss_conf             44321112357861698530357556100212026761499971110299788988888850799813899823899876
Q gi|254781215|r  155 SDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLS  234 (511)
Q Consensus       155 ~~~~~~~~~~~~~~~~~~~~~~s~~~~ea~~G~h~~~~~lvI~DEAsgI~d~i~e~i~~~Lt~~g~~~~~i~~~nP~~~~  234 (511)
T Consensus        74 gp~GnV~V~PagvSLEg~rKA~~~~L~dV~~~i~~~~-D~lLIDAPAGL~~~a~~Al~~-----a~el--LLVvNPEi~S  145 (258)
T TIGR01969        74 GPEGNVKVIPAGVSLEGLRKADPDKLEDVLKEIIDDT-DFLLIDAPAGLERDAVTALAA-----ADEL--LLVVNPEISS  145 (258)
T ss_pred             CCCCCEEEECCCCCHHHCCCCCHHHHHHHHHHHHCCC-CEEEEECCCCCCHHHHHHHHH-----CCCC--EEEECCCHHH
T ss_conf             8898447850612210001268333289999872043-778874789833789999986-----1866--4866765446


Q ss_pred             --CHHHH--HHHCCCCCCEEEEEC--CCCCCCCCHHHHHHHHHH-----CCCCHHHHHH
Q ss_conf             --55676--530352474179840--433677897789999975-----1898013544
Q gi|254781215|r  235 --GKFYE--IFNKPLDDWKRFQID--TRTVEGIDPSFHEGIIAR-----YGLDSDVTRV  282 (511)
Q Consensus       235 --g~fy~--~~~~~~~~w~~~~i~--~~~~p~~~~~~ie~~~~~-----~geds~~~r~  282 (511)
T Consensus       146 ItDaLK~k~va~~lGt~ilG~vlNRv~~~~tel~~~eiE~iLevPVl~~vPEDP~VR~A  204 (258)
T TIGR01969       146 ITDALKVKIVAEKLGTAILGVVLNRVTRDKTELGREEIEAILEVPVLGVVPEDPEVRRA  204 (258)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCHHHHHHHHCCCEEEEECCCHHHHHH
T ss_conf             77788999998760883246899602366663788899988479738985698434456