HHsearch alignment for GI: 254781215 and conserved domain: cd00046

>cd00046 DEXDc DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.
Probab=97.52  E-value=0.00075  Score=42.88  Aligned_cols=52  Identities=21%  Similarity=0.219  Sum_probs=40.1

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHH
Q ss_conf             46502576597899999999999808996699980858999999999999999
Q gi|254781215|r   80 GAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWL  132 (511)
Q Consensus        80 ~aV~sgrG~GKS~l~a~l~lw~l~~~p~~kv~vtApt~~Q~~~ilw~Ei~k~~  132 (511)
T Consensus         3 ~lv~~ptGsGKT~~~~~~~~~~~~~~~~~~~lil~Pt~~L~~q~-~~~~~~~~   54 (144)
T cd00046           3 VLLAAPTGSGKTLAALLPILELLDSLKGGQVLVLAPTRELANQV-AERLKELF   54 (144)
T ss_pred             EEEECCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHH-HHHHHHHC
T ss_conf             99988997179999999999999756897699974679999999-99999974