HHsearch alignment for GI: 254781215 and conserved domain: pfam00176

>pfam00176 SNF2_N SNF2 family N-terminal domain. This domain is found in proteins involved in a variety of processes including transcription regulation (e.g., SNF2, STH1, brahma, MOT1), DNA repair (e.g., ERCC6, RAD16, RAD5), DNA recombination (e.g., RAD54), and chromatin unwinding (e.g., ISWI) as well as a variety of other proteins with little functional information (e.g., lodestar, ETL1).
Probab=97.22  E-value=0.0079  Score=36.43  Aligned_cols=162  Identities=19%  Similarity=0.196  Sum_probs=75.8

Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCC-CEEEEEECCHHHHHHHHHHHHHHHH
Q ss_conf             999999999998740565554210124650257659789999999999980899-6699980858999999999999999
Q gi|254781215|r   54 WQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPG-ISVICLANSETQLKTTLWAEVSKWL  132 (511)
Q Consensus        54 WQ~e~l~~i~~~~~~~~~~~~~~~~r~aV~sgrG~GKS~l~a~l~lw~l~~~p~-~kv~vtApt~~Q~~~ilw~Ei~k~~  132 (511)
T Consensus         1 yQ~~gv~wl~~~~~~~~g--------giLaDeMGLGKTiq~ia~l~~~~~~~~~~~~~LIV~P~sl~~~W--~~Ei~~~~   70 (295)
T pfam00176         1 YQLEGVNWLISLYNNGLG--------GILADEMGLGKTLQTISLLAYLKELKPLAGPHLVVCPLSTLDNW--LNEFEKWA   70 (295)
T ss_pred             CHHHHHHHHHHHHHCCCC--------EEEECCCCCCHHHHHHHHHHHHHHHCCCCCCEEEEECHHHHHHH--HHHHHHHC
T ss_conf             978899999998727999--------89722787579999999999999838899988999757888767--88999867


Q ss_pred             HHCHHCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCHHHHCCCCCCEEEEECCHHCCCHH---HH
Q ss_conf             855000134443-22222233344432111235786169853035755610021202676149997111029978---89
Q gi|254781215|r  133 SLLPNKHWFEMQ-SLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDV---IN  208 (511)
Q Consensus       133 ~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~ea~~G~h~~~~~lvI~DEAsgI~d~---i~  208 (511)
T Consensus        71 ~~~~~~~~~~~~~~r~~~~~~~--------~~~~~~~ivitsY~~~~~~~~~---l~~~~w~~vI~DEaH~iKN~~s~~~  139 (295)
T pfam00176        71 PDLNIVVYYGDGDSRSELLRNV--------LRTGKFDVLITSYEYIRRDKDE---LHKANWRYVILDEGHRIKNAKSKLS  139 (295)
T ss_pred             CCCCEEEEEECHHHHHHHHHHH--------HHCCCCCEEEECHHHHHHHHHH---HHCCCCCEEEEECCCCCCCHHHHHH
T ss_conf             9970799984707689998867--------7416885999309999975999---8408765899876201258788999


Q ss_pred             HHHHHHHCCCCCCEEEEEECCCCCCC-CHHHHH
Q ss_conf             88888850799813899823899876-556765
Q gi|254781215|r  209 LGILGFLTERNANRFWIMTSNPRRLS-GKFYEI  240 (511)
Q Consensus       209 e~i~~~Lt~~g~~~~~i~~~nP~~~~-g~fy~~  240 (511)
T Consensus       140 ~a~~-~l---~~~~r~~LTGTPiqN~l~el~~l  168 (295)
T pfam00176       140 LALK-SL---KTNNRLLLTGTPIQNNLAELWSL  168 (295)
T ss_pred             HHHH-HC---CCCCEEEEECCCCCCCHHHHHHH
T ss_conf             9999-52---35818998687455888999999