HHsearch alignment for GI: 254781215 and conserved domain: pfam05876

>pfam05876 Terminase_GpA Phage terminase large subunit (GpA). This family consists of several phage terminase large subunit proteins as well as related sequences from several bacterial species. The DNA packaging enzyme of bacteriophage lambda, terminase, is a heteromultimer composed of a small subunit, gpNu1, and a large subunit, gpA, products of the Nu1 and A genes, respectively. Terminase is involved in the site-specific binding and cutting of the DNA in the initial stages of packaging. It is now known that gpA is actively involved in late stages of packaging, including DNA translocation, and that this enzyme contains separate functional domains for its early and late packaging activities.
Probab=99.41  E-value=7e-09  Score=74.61  Aligned_cols=394  Identities=13%  Similarity=0.080  Sum_probs=202.2

Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHH
Q ss_conf             89999999999987405655542101246502576597899999999999808996699980858999999999999999
Q gi|254781215|r   53 SWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWL  132 (511)
Q Consensus        53 ~WQ~e~l~~i~~~~~~~~~~~~~~~~r~aV~sgrG~GKS~l~a~l~lw~l~~~p~~kv~vtApt~~Q~~~ilw~Ei~k~~  132 (511)
T Consensus        19 Py~~eimd~l~~----------~~v~~V~~~k~aQ~GkT~~~~n~igy~i~~~P-~p~l~v~Pt~~~a~~~s~~rl~Pmi   87 (552)
T pfam05876        19 PYLREIMDALSP----------PSVERVVFMKSAQVGKTELLLNWIGYFIDHDP-APMLVVQPTDDDAKRFSKDRLDPMI   87 (552)
T ss_pred             CHHHHHHHHCCC----------CCCEEEEEEECCCCCHHHHHHHHHHHHHHHCC-CCEEEEECCHHHHHHHHHHHHHHHH
T ss_conf             076999985488----------78449999957870388999999988663089-8879994189999999999899998


Q ss_pred             HHCHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCHHHHCCCCCCEEEEECCHHCCCHHH-----
Q ss_conf             855000134443222222333444321112357861698530357556100212026761499971110299788-----
Q gi|254781215|r  133 SLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEASGTPDVI-----  207 (511)
Q Consensus       133 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~ea~~G~h~~~~~lvI~DEAsgI~d~i-----  207 (511)
T Consensus        88 ~~sP~L~~~~~~~~---~r--~~~nt~~~K~f~gg~l~~~----ga~S~~~L~s---~~~r~l~~DEvD~~~~~~~~eGd  155 (552)
T pfam05876        88 RASPALRERLAPAR---SR--DSDNTLLSKRFPGGSLLLI----GANSPANLRS---RPVRYVILDEVDAYPEDVDGEGD  155 (552)
T ss_pred             HCCHHHHHHHCCCC---CC--CCCCCEEEEEECCCEEEEE----ECCCCHHHHC---CCCCEEEECCHHHCCCCCCCCCC
T ss_conf             61989997507555---65--6677412476078379995----5799614304---86355885134436545677879


Q ss_pred             -HHHHHHHHCCCCCCEEEEEECCCCCCC-CHHHHHHHCC-----------------------------------------
Q ss_conf             -988888850799813899823899876-5567653035-----------------------------------------
Q gi|254781215|r  208 -NLGILGFLTERNANRFWIMTSNPRRLS-GKFYEIFNKP-----------------------------------------  244 (511)
Q Consensus       208 -~e~i~~~Lt~~g~~~~~i~~~nP~~~~-g~fy~~~~~~-----------------------------------------  244 (511)
T Consensus       156 P~~La~~R~~tf~~~~K~~~~STPt~~g~s~I~~~~~~sdqr~~~vpCPhCg~~q~l~~~~l~w~~~~~p~~a~y~C~~C  235 (552)
T pfam05876       156 PISLAEKRTETFGSRRKILAGSTPTIKGTSRIEALYEESDQRRYYVPCPHCGEEQELRWERLKWDKGEAPETARYVCPHC  235 (552)
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCEEECCCCCCCCEEEECCCC
T ss_conf             89999999875302857999838999996689999866873899868989998655500546647999855349989889


Q ss_pred             -------------------------CCCCEEEEECCCCCCCCCHHHH-HHHHHH--CCCCH--HHHHHHHCCCCCCCCCC
Q ss_conf             -------------------------2474179840433677897789-999975--18980--13544431756666787
Q gi|254781215|r  245 -------------------------LDDWKRFQIDTRTVEGIDPSFH-EGIIAR--YGLDS--DVTRVEVCGQFPQQDID  294 (511)
Q Consensus       245 -------------------------~~~w~~~~i~~~~~p~~~~~~i-e~~~~~--~geds--~~~r~evlgeFp~~~~~  294 (511)
T Consensus       236 g~~i~e~~k~~m~~~G~W~~~~~~~~~~~~gfhl~~lySp~~sw~~ia~~~l~A~~~gd~~~lk~f~Nt~Lge~w~~~~~  315 (552)
T pfam05876       236 GCVIEEHHKRAMLRAGRWIATAPIRRPRHAGFHLNALYSPFRSWGELAAEFLKAERKGDPEKLKTFVNTDLGEPWEEKGE  315 (552)
T ss_pred             CCCCCHHHHHHHHHCCEEEECCCCCCCCCEEEEECHHHCCCCCHHHHHHHHHHHHHCCCHHHHHHEEECCCCCEECCCCC
T ss_conf             88889999998876899980588889981179963574552589999999998776199888635474024424213466


Q ss_pred             EEECHHHHHHHHHCC-CCCCCCCE--EEEEEECCCCCCCCEE---EEEECCC--EEEEEEECCC-CCHHHHHHHHHHHHH
Q ss_conf             375599998864076-53189970--8999623334784179---9982275--5899873277-898899999999998
Q gi|254781215|r  295 SFIPLNIIEEALNRE-PCPDPYAP--LIMGCDIAEEGGDNTV---VVLRRGP--VIEHLFDWSK-TDLRTTNNKISGLVE  365 (511)
Q Consensus       295 ~~i~~~~ie~a~~r~-~~~~~~~~--~viGvDVAr~G~D~sv---i~~r~G~--~v~~~~~~~~-~d~~~~a~~i~~~~~  365 (511)
T Consensus       316 ~~-~~~~L~~rre~y~~~~vP~g~~~LtagvDvQ~---drle~~v~gwG~~~esW~id~~~i~Gdp~~~~~w~~L~~~l~  391 (552)
T pfam05876       316 AP-DWEELAARAEDYPRGTVPAGVLVLTAGVDVQG---DRLEVEVVGWGRGGESWLIDRGVIWGDPADEETWAALDELLN  391 (552)
T ss_pred             CC-CHHHHHHHHHHCCCCCCCCCEEEEEEEEEECC---CEEEEEEEEECCCCCEEEEEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             78-98999998764466678987069999986149---989999999879985599988886189887789999999972


Q ss_pred             -H--------CCCCEEEEEEC-CCCHHHHHHHHHCC-CEEEEECCCCCCCCH--------HH-------------H----
Q ss_conf             -6--------18882998006-87636889898649-827984277776640--------25-------------5----
Q gi|254781215|r  366 -K--------YRPDAIIIDAN-NTGARTCDYLEMLG-YHVYRVLGQKRAVDL--------EF-------------C----  409 (511)
Q Consensus       366 -~--------~~~~~i~iD~~-GvG~gV~d~L~~~g-~~v~~v~~~~~~~~~--------~~-------------y----  409 (511)
T Consensus       392 ~~~~~~~G~~~~i~~~~IDsGg~~T~~VY~f~r~~~~~rv~aiKG~~~~~~p~i~~~~~~~~~~~gk~~~~gv~l~~vgt  471 (552)
T pfam05876       392 RTWPHADGGEMRIDAVAIDSGGGVTDEVYAFCRKRRRRRVIAIKGASGYGAPLIGRPSPKDVTKKGKKLRGGVRLWLVGT  471 (552)
T ss_pred             CCCCCCCCCEEEEEEEEEECCCCCHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECC
T ss_conf             74177899883114999989999579999999866886089974688778887567851233666751048835999785


Q ss_pred             HHHHHHHHHHHHHHHHH--CC--CCC--HHHHHHHHHCCCEEEECCCCEEEEEECHHHCCCCCCHHHHHHHHHCC
Q ss_conf             22799999999999970--89--998--18999998579679987998499984125489998989999999759
Q gi|254781215|r  410 RNRRTELHVKMADWLEF--AS--LIN--HSGLIQNLKSLKSFIVPNTGELAIESKRVKGAKSTDYSDGLMYTFAE  478 (511)
Q Consensus       410 ~N~rae~~~~~re~l~~--g~--l~~--d~~l~~el~~~~~~~~~~~gki~ie~Kkkrg~~SPD~ADAl~l~fa~  478 (511)
T Consensus       472 ~~~K~~l~~rL~~~-~~~~G~~hfp~~~~~~yf~QLtA-E~~-~-~kG~~~~~W~k~~-~~rNE~LDc~vya~Aa  541 (552)
T pfam05876       472 DTAKDRIYARLRRE-EPGPGYIHFPDDLPDEYFEQLTA-EER-V-SKGRPRREWVKPR-GRRNEALDCRVYALAA  541 (552)
T ss_pred             HHHHHHHHHHHCCC-CCCCCEEECCCCCCHHHHHHHHE-EEE-E-CCCCEEEEEECCC-CCCCHHHHHHHHHHHH
T ss_conf             79999999874689-99997598789999999976434-788-5-1797637995389-9987899999999999