HHsearch alignment for GI: 254781215 and conserved domain: pfam05894

>pfam05894 Podovirus_Gp16 Podovirus DNA encapsidation protein (Gp16). This family consists of several DNA encapsidation protein (Gp16) sequences from the phi-29-like viruses. Gene product 16 catalyses the in vivo and in vitro genome-encapsidation reaction.
Probab=90.28  E-value=1.2  Score=22.63  Aligned_cols=144  Identities=18%  Similarity=0.146  Sum_probs=72.0

Q ss_pred             EECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHHHHCHHCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             50257659789999999999980899669998085899999999999999985500013444322222233344432111
Q gi|254781215|r   82 ISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCS  161 (511)
Q Consensus        82 V~sgrG~GKS~l~a~l~lw~l~~~p~~kv~vtApt~~Q~~~ilw~Ei~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  161 (511)
T Consensus        22 vIG~RGiGKTya~k~~~ikd~i~-kGeqFiYLRr~k~--------El~k~~n~-----~F~di~~~fpn~ef~Vkgnki~   87 (333)
T pfam05894        22 VIGARGIGKTYALKERVIKDFIK-KGEQFIYLRRYKT--------ELKKLANE-----FFNDVAHEFPNNEFYVKGNKFY   87 (333)
T ss_pred             EEECCCCCHHHHHHHHHHHHHHH-CCCEEEEEEECCH--------HHHHHHHH-----HHHHHHHHCCCCEEEEECCEEE
T ss_conf             98246554024677888999986-2967999991206--------88877777-----5551665378980799754899


Q ss_pred             CCCCCCEEEEEECCCCCCCCCHHHHCCCCCCEEEEECCH-------HCCCHHH---HHHHHHHHCCCCCCEEEEEECCCC
Q ss_conf             235786169853035755610021202676149997111-------0299788---988888850799813899823899
Q gi|254781215|r  162 LGIDSKHYSTMCRTYSEERPDTFVGHHNTYGMAIINDEA-------SGTPDVI---NLGILGFLTERNANRFWIMTSNPR  231 (511)
Q Consensus       162 ~~~~~~~~~~~~~~~s~~~~ea~~G~h~~~~~lvI~DEA-------sgI~d~i---~e~i~~~Lt~~g~~~~~i~~~nP~  231 (511)
T Consensus        88 ~~~k~igy~i~LS~~q-----~lKS~~Yp~V~~I~fDEfi~ek~~~~Y~pNev~~llnl~~tV~R~R-e~vr~~~lsNAv  161 (333)
T pfam05894        88 IKGELIGYAIPLSNWQ-----ALKSLAYPNVSTIFFDEFVREKDYGSYDPNEVRNFLNLMDTVFRAR-ERVRCICLSNAV  161 (333)
T ss_pred             ECCEEEEEEEEHHHHH-----HHHCCCCCCEEEEEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEEECCHH
T ss_conf             8782899998632455-----6313479855899835112445445789438999999999987503-773899964704


Q ss_pred             CCCCHHHHHHHCCC
Q ss_conf             87655676530352
Q gi|254781215|r  232 RLSGKFYEIFNKPL  245 (511)
Q Consensus       232 ~~~g~fy~~~~~~~  245 (511)
T Consensus       162 ~i~NPYF~~f~~~p  175 (333)
T pfam05894       162 SIVNPYFLLFHIEP  175 (333)
T ss_pred             HCCCHHHEEEECCC
T ss_conf             20472551551136