HHsearch results for GI: 254781215 and protein with PDBid: 1hv8_A

>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19
Probab=97.78  E-value=0.00022  Score=44.87  Aligned_cols=75  Identities=21%  Similarity=0.234  Sum_probs=50.8

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHH
Q ss_conf             55784589999999999987405655542101246502576597899999999999808996699980858999999999
Q gi|254781215|r   47 GFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQLKTTLWA  126 (511)
Q Consensus        47 ~~~~P~~WQ~e~l~~i~~~~~~~~~~~~~~~~r~aV~sgrG~GKS~l~a~l~lw~l~~~p~~kv~vtApt~~Q~~~ilw~  126 (511)
                      +|..|.++|++++.++-....           .+.|.++.|.|||.+...-++-.+....+.++++..|+..-+... -.
T Consensus        25 g~~~~t~~Q~~ai~~~l~g~~-----------~vlv~apTGsGKT~~~~lp~l~~~~~~~~~~~li~~p~~~l~~q~-~~   92 (367)
T 1hv8_A           25 GFEKPTDIQMKVIPLFLNDEY-----------NIVAQARTGSGKTASFAIPLIELVNENNGIEAIILTPTRELAIQV-AD   92 (367)
T ss_dssp             TCCSCCHHHHHHHHHHHHTCS-----------EEEEECCSSSSHHHHHHHHHHHHSCSSSSCCEEEECSCHHHHHHH-HH
T ss_pred             CCCCCCHHHHHHHHHHHCCCC-----------CEEEECCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEEHHHHHHHH-HH
T ss_conf             999999999999999975999-----------999988999769999999999986542896699995106766777-88


Q ss_pred             HHHHHHH
Q ss_conf             9999998
Q gi|254781215|r  127 EVSKWLS  133 (511)
Q Consensus       127 Ei~k~~~  133 (511)
                      .+.++..
T Consensus        93 ~~~~~~~   99 (367)
T 1hv8_A           93 EIESLKG   99 (367)
T ss_dssp             HHHHHHC
T ss_pred             HHHHHHC
T ss_conf             9998731