HHsearch results for GI: 254781215 and protein with PDBid: 1sxj_C

>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ ATPase, DNA polymerase; HET: ATG ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20
Probab=97.17  E-value=0.0033  Score=37.45  Aligned_cols=138  Identities=18%  Similarity=0.139  Sum_probs=75.0

Q ss_pred             HHCCCCCC--CCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             64214557--7756555784589999999999987405655542101246502576597899999999999808996699
Q gi|254781215|r   34 HFFPWGEK--GTPLEGFSAPRSWQLEFMEVVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVI  111 (511)
Q Consensus        34 ~~~~w~~~--~~~~~~~~~P~~WQ~e~l~~i~~~~~~~~~~~~~~~~r~aV~sgrG~GKS~l~a~l~lw~l~~~p~~kv~  111 (511)
                      ...||-++  +..+..+.|    |.++.+.+.....++..   |.   +...+..|+|||+++-.++-....-.....++
T Consensus        11 ~~~~w~ekyrP~~~~divg----~~~~~~~l~~~i~~~~~---~~---lLl~GppG~GKTtla~~la~~~~~~~~~~~~~   80 (340)
T 1sxj_C           11 ENLPWVEKYRPETLDEVYG----QNEVITTVRKFVDEGKL---PH---LLFYGPPGTGKTSTIVALAREIYGKNYSNMVL   80 (340)
T ss_dssp             -CCCHHHHTCCSSGGGCCS----CHHHHHHHHHHHHTTCC---CC---EEEECSSSSSHHHHHHHHHHHHHTTSHHHHEE
T ss_pred             CCCCHHHHHCCCCHHHHCC----CHHHHHHHHHHHHCCCC---CE---EEEECCCCCCHHHHHHHHHHHHHCCCCCCCEE
T ss_conf             7886788848998999059----49999999999977999---86---98889599999999999999862466776346


Q ss_pred             EEECCHHHHHHHHHHHHHHHHHHCHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCHHHHCCCCC
Q ss_conf             98085899999999999999985500013444322222233344432111235786169853035755610021202676
Q gi|254781215|r  112 CLANSETQLKTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEERPDTFVGHHNTY  191 (511)
Q Consensus       112 vtApt~~Q~~~ilw~Ei~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~ea~~G~h~~~  191 (511)
                      ..-++...-.+...........                                              ..   ....+. 
T Consensus        81 ~~~~~~~~~i~~~~~~~~~~~~----------------------------------------------~~---~~~~~~-  110 (340)
T 1sxj_C           81 ELNASDDRGIDVVRNQIKDFAS----------------------------------------------TR---QIFSKG-  110 (340)
T ss_dssp             EECTTSCCSHHHHHTHHHHHHH----------------------------------------------BC---CSSSCS-
T ss_pred             EECCCCCCCHHHHHHHHHHHHH----------------------------------------------HH---HHCCCC-
T ss_conf             6234334772589888888777----------------------------------------------66---514577-


Q ss_pred             CEEEEECCHHCCCHHHHHHHHHHHCCCCCCEEEEEECCCC
Q ss_conf             1499971110299788988888850799813899823899
Q gi|254781215|r  192 GMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPR  231 (511)
Q Consensus       192 ~~lvI~DEAsgI~d~i~e~i~~~Lt~~g~~~~~i~~~nP~  231 (511)
                      .-++|+||+..+......++..+|.......+++++.|..
T Consensus       111 ~kviiiDe~d~l~~~~qn~Ll~~le~~~~~~~~il~~n~~  150 (340)
T 1sxj_C          111 FKLIILDEADAMTNAAQNALRRVIERYTKNTRFCVLANYA  150 (340)
T ss_dssp             CEEEEETTGGGSCHHHHHHHHHHHHHTTTTEEEEEEESCG
T ss_pred             EEEEEEECHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCH
T ss_conf             4899995532413777999999998557652664314706